bahuvrihi / external

array-like access to external data files

This URL has Read+Write access

name age message
file .gitignore Mon Sep 22 15:07:27 -0700 2008 Updates to run tests with (limited) warnings. [bahuvrihi]
file History Mon Jun 29 09:18:45 -0700 2009 gemspec updates for release [bahuvrihi]
file MIT-LICENSE Sat Sep 27 09:21:40 -0700 2008 Converted the defualt io back to a Tempfile. Up... [Simon Chiang]
file README Sat Sep 27 14:04:47 -0700 2008 Updates to documentation and files for release.... [bahuvrihi]
file Rakefile Tue Jun 23 22:38:47 -0700 2009 fixed a failing test [bahuvrihi]
file Rapfile Mon Jun 29 09:18:45 -0700 2009 gemspec updates for release [bahuvrihi]
directory docs/ Fri Sep 26 15:40:22 -0700 2008 Updated README and files associated with release. [Simon Chiang]
file external.gemspec Mon Jun 29 09:18:45 -0700 2009 gemspec updates for release [bahuvrihi]
directory lib/ Tue Jun 23 23:04:52 -0700 2009 sketched out load/dump binary tasks [bahuvrihi]
directory test/ Tue Jun 23 22:38:47 -0700 2009 fixed a failing test [bahuvrihi]
README
= External 

Indexing and array-like access to data stored on disk rather than in memory.

== Description

External provides a way to index and access array data directly from a file
without loading it into memory.  Indexes may be cached in memory or stored 
on disk with the data file, in essence giving you arbitrarily large arrays.
Externals automatically chunk and buffer methods like <tt>each</tt> so that
the memory footprint remains low even during enumeration.  

The main External classes are:

* ExternalIndex   --  for formatted binary data
* ExternalArchive --  for string data
* ExternalArray   --  for objects (serialized as YAML)

The array-like behavior of these classes is developed using modified versions
of the RubySpec[http://rubyspec.org] specification for Array.  The idea is to 
eventually duck-type all Array methods, including sort and collect, with 
acceptable performance.

* Rubyforge[http://rubyforge.org/projects/external]
* Lighthouse[http://bahuvrihi.lighthouseapp.com/projects/10590-external]
* Github[http://github.com/bahuvrihi/external/tree/master]

==== Bugs/Known Issues

* only a limited set of array methods are currently supported
* currently only [] and []= are fully tested vs RubySpec
* documentation is patchy

Note also that YAML dump/load of some objects doesn't work or doesn't
reproduce the object; such objects will not be properly stored in an
ExternalArray.  Problematic objects include:

Proc and Class:

  block = lambda {}
  YAML.load(YAML.dump(block))         # !> TypeError: allocator undefined for Proc
  YAML.dump(Object)                   # !> TypeError: can't dump anonymous class Class

Carriage returns ("\r"):

  YAML.load(YAML.dump("\r"))          # => nil
  YAML.load(YAML.dump("\r\n"))        # => ""
  YAML.load(YAML.dump("string with \r\n inside"))  # => "string with \n inside"

Chains of newlines ("\n"):

  YAML.load(YAML.dump("\n"))          # => ""
  YAML.load(YAML.dump("\n\n"))        # => ""
  
DateTime is loaded as Time:

  YAML.load(YAML.dump(DateTime.now)).class         # => Time
  
== Usage

=== ExternalArray

ExternalArray can be initialized from data using the [] operator and used like
an array.

  a = ExternalArray['str', {'key' => 'value'}]
  a[0]                                # => 'str'
  a.last                              # => {'key' => 'value'}
  a << [1,2]; a.to_a                  # => ['str', {'key' => 'value'}, [1,2]]

ExternalArray serializes and stores entries to an io while building an io_index
that tracks the start and length of each entry.  By default ExternalArray
will serialize to a Tempfile and use an Array as the io_index:

  a.io.class                          # => Tempfile
  a.io.rewind; a.io.read              # => "--- str\n--- \nkey: value\n--- \n- 1\n- 2\n"
  a.io_index.class                    # => Array
  a.io_index.to_a                     # => [[0, 8], [8, 16], [24, 13]]

To save this data more permanently, provide a path to <tt>close</tt>; the tempfile
is moved to the path and a binary index file will be created:

  a.close('example.yml')
  File.read('example.yml')            # => "--- str\n--- \nkey: value\n--- \n- 1\n- 2\n"
  
  index = File.read('example.index')
  index.unpack('I*')                  # => [0, 8, 8, 16, 24, 13]

ExternalArray provides <tt>open</tt> to create ExternalArrays from an existing 
file; the instance will use an index file if it exists and automatically
reindex the data if it does not.  Manual calls to reindex may be necessary when
you initialize an ExternalArray with <tt>new</tt> instead of <tt>open</tt>:

  # use of an existing index file
  ExternalArray.open('example.yml') do |b|
    File.basename(b.io_index.io.path) # => 'example.index'
    b.to_a                            # => ['str', {'key' => 'value'}, [1,2]]
  end

  # automatic reindexing
  FileUtils.rm('example.index')
  ExternalArray.open('example.yml') do |b|
    b.to_a                            # => ['str', {'key' => 'value'}, [1,2]]
  end
  
  # manual reindexing
  file = File.open('example.yml')
  c = ExternalArray.new(file)
  
  c.to_a                              # => []
  c.reindex
  c.to_a                              # => ['str', {'key' => 'value'}, [1,2]]

=== ExternalArchive

ExternalArchive is exactly like ExternalArray except that it only stores
strings (ExternalArray is actually a subclass of ExternalArchive which
dumps/loads strings).

  arc = ExternalArchive["swift", "brown", "fox"]
  arc[2]                              # => "fox"
  arc.to_a                            # => ["swift", "brown", "fox"]
  arc.io.rewind; arc.io.read          # => "swiftbrownfox"

ExternalArchive is useful as a base for classes to access archival data.
Here is a simple parser for FASTA[http://en.wikipedia.org/wiki/Fasta_format]
data:

  # A sample FASTA entry
  # >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
  # LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
  # EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
  # LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
  # GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
  # IENY
  
  class FastaEntry
    attr_reader :header, :body
    
    def initialize(str)
      @body = str.split(/\r?\n/)
      @header = body.shift
    end
  end
  
  class FastaArchive < ExternalArchive
    def str_to_entry(str); FastaEntry.new(str); end
    def entry_to_str(entry); ([entry.header] + entry.body).join("\n"); end
    
    def reindex
      reindex_by_sep('>', :entry_follows_sep => true)
    end
  end
  
  require 'open-uri'
  fasta = FastaArchive.new open('http://external.rubyforge.org/doc/tiny_fasta.txt')
  fasta.reindex
  
  fasta.length                        # => 5
  fasta[0].body                       # => ["MEVNILAFIATTLFVLVPTAFLLIIYVKTVSQSD"]

The non-redundant {NCBI protein database}[ftp://ftp.ncbi.nih.gov/blast/db/FASTA/]
contains greater than 7 million FASTA entries in a 3.56 GB file; ExternalArchive
is targeted at files that size, where lazy loading of data and a small memory 
footprint are critical.

=== ExternalIndex

ExternalIndex provides array-like access to formatted binary data.  The index of an 
uncached ExternalArray is an ExternalIndex configured for binary data like 'II'; two
integers corresponding to the start position and length an entry.

  index = ExternalIndex[1, 2, 3, 4, 5, 6, {:format => 'II'}]
  index.format                        # => 'I*'
  index.frame                         # => 2
  index[1]                            # => [3,4]
  index.to_a                          # => [[1,2], [3,4], [5,6]]

ExternalIndex handles arbitrary packing formats, opening many possibilities:

  Tempfile.new('sample.txt') do |file|
    file << [1,2,3].pack("IQS")
    file << [4,5,6].pack("IQS")
    file << [7,8,9].pack("IQS")
    file.flush

    index = ExternalIndex.new(file, :format => "IQS")
    index[1]                          # => [4,5,6]
    index.to_a                        # => [[1,2,3], [4,5,6], [7,8,9]]
  end

== Installation

External is available from RubyForge[http://rubyforge.org/projects/external].  Use:

  % gem install external

== Info 

Copyright (c) 2006-2008, Regents of the University of Colorado.
Developer:: {Simon Chiang}[http://bahuvrihi.wordpress.com], {Biomolecular Structure Program}[http://biomol.uchsc.edu/], 
{Hansen Lab}[http://hsc-proteomics.uchsc.edu/hansenlab/] 
Support:: CU Denver School of Medicine Deans Academic Enrichment Fund
Licence:: {MIT-Style}[link:files/MIT-LICENSE.html]