Permalink
Fetching contributors…
Cannot retrieve contributors at this time
4637 lines (4556 sloc) 385 KB
<?xml version="1.0" encoding="UTF-8"?>
<MzIdentML xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xsi:schemaLocation="http://psidev.info/psi/pi/mzIdentML/1.1 ../../schema/mzIdentML1.1.0.xsd"
xmlns="http://psidev.info/psi/pi/mzIdentML/1.1"
id="example_mzidentml_1"
version="1.1.0"
creationDate="2009-08-18T17:59:55">
<cvList>
<cv id="PSI-MS" fullName="Proteomics Standards Initiative Mass Spectrometry Vocabularies"
uri="http://psidev.cvs.sourceforge.net/viewvc/*checkout*/psidev/psi/psi-ms/mzML/controlledVocabulary/psi-ms.obo"
version="2.25.0"/>
<cv id="UNIMOD" fullName="UNIMOD" uri="http://www.unimod.org/obo/unimod.obo"/>
<cv id="UO" fullName="UNIT-ONTOLOGY"
uri="http://obo.cvs.sourceforge.net/*checkout*/obo/obo/ontology/phenotype/unit.obo"/>
</cvList>
<AnalysisSoftwareList>
<AnalysisSoftware id="AS_mascot_server" name="Mascot Server" version="2.2.03"
uri="http://www.matrixscience.com/search_form_select.html">
<ContactRole contact_ref="ORG_MSL">
<Role>
<cvParam accession="MS:1001267" name="software vendor" cvRef="PSI-MS"/>
</Role>
</ContactRole>
<SoftwareName>
<cvParam accession="MS:1001207" name="Mascot" cvRef="PSI-MS"/>
</SoftwareName>
<Customizations>
No customisations
</Customizations>
</AnalysisSoftware>
<AnalysisSoftware id="AS_mascot_parser" name="Mascot Parser" version="2.3.0.0"
uri="http://www.matrixscience.com/msparser.html">
<ContactRole contact_ref="ORG_MSL">
<Role>
<cvParam accession="MS:1001267" name="software vendor" cvRef="PSI-MS"/>
</Role>
</ContactRole>
<SoftwareName>
<cvParam accession="MS:1001478" name="Mascot Parser" cvRef="PSI-MS"/>
</SoftwareName>
<Customizations>
No customisations
</Customizations>
</AnalysisSoftware>
</AnalysisSoftwareList>
<Provider id="PROVIDER">
<ContactRole contact_ref="PERSON_DOC_OWNER">
<Role>
<cvParam accession="MS:1001271" name="researcher" cvRef="PSI-MS"/>
</Role>
</ContactRole>
</Provider>
<AuditCollection>
<Person id="XX">
<Affiliation organization_ref="ORG_DOC_OWNER"/>
</Person>
<Person id="PERSON_DOC_OWNER" firstName="" lastName="Some Person">
<cvParam accession="MS:1000589" name="contact email" cvRef="PSI-MS" value="someone@someuniversity.edu"/>
<Affiliation organization_ref="ORG_MSL"/>
</Person>
<Organization id="ORG_MSL" name="Matrix Science Limited">
<cvParam accession="MS:1000589" name="contact email" cvRef="PSI-MS" value="support@matrixscience.com"/>
<cvParam accession="MS:1000587" name="contact address" cvRef="PSI-MS" value="64 Baker Street, London W1U 7GB, UK"/>
<userParam name="contact phone" value="+44 (0)20 7486 1050"/>
<userParam name="contact fax" value="+44 (0)20 7224 1344"/>
</Organization>
<Organization id="ORG_DOC_OWNER">
<Parent organization_ref="ORG_MSL" />
</Organization>
</AuditCollection>
<AnalysisSampleCollection>
<Sample id="sample1" name="name23">
<ContactRole contact_ref="ORG_MSL">
<Role>
<cvParam accession="MS:1001267" name="software vendor" cvRef="PSI-MS"/>
</Role>
</ContactRole>
<ContactRole contact_ref="ORG_MSL">
<Role>
<cvParam accession="MS:1001267" name="software vendor" cvRef="PSI-MS"/>
</Role>
</ContactRole>
</Sample>
<Sample id="sample2" name="name24">
<SubSample sample_ref="sample1"/>
</Sample>
</AnalysisSampleCollection>
<SequenceCollection>
<DBSequence id="DBSeq_HSP7D_MANSE" length="652" searchDatabase_ref="SDB_SwissProt" accession="HSP7D_MANSE">
<Seq>MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTDRLIGDAAKNQVAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKSQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDEKQKETIQAKNALESYCFNMKSTMEDEKLKDKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKLYQGAGGMPGGMPGGMPGFPGGAPGAGGAAPGGGAGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein cognate 4 (Hsc 70-4) - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Manduca sexta"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7130"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_ICTPU" length="649" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_ICTPU">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDSVVQADMKHWPFKVISDGGRPRLEVEYKGEAKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQRTKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFDLKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISDNKRAVRRLATACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQVHDIVLVGGSTRIPKMEKLLQDFFNGKELNKSINPDEAVAYGAAVQAESSLGDKSENVQDLVLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKHKILDKCNEVISWLDKNQTAEKDEYEHQQKDLEKVCNPIITKLYQSDGGMPGGMPDGMPGGFQELGAAPGGGSSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein - Ictalurus punctatus (Channel catfish)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Ictalurus punctatus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7998"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_ONCMY" length="651" searchDatabase_ref="SDB_SwissProt" accession="HSP70_ONCMY">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPCNTVFDAKRLIGRRFDDGVVQSDMKHWPFEVINDSTRPKLQVEYKGETKSFYPEEISSMVLVKMKEIAEAYLGKTVNNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQVHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKCEDDVQRDKVSSKNSLESYAFNMKSTVEDEKLQGKISDEDKTKILEKCNEVIGWLDKNQTAEKEEYEHHQKELEKVCNPIITKLYQGAGGMPGGMPEGMAGGFPGAGGAAPGGGGSSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 70 kDa protein (HSP70) - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Oncorhynchus mykiss"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="8022"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_ECHGR" length="665" searchDatabase_ref="SDB_SwissProt" accession="HSP70_ECHGR">
<Seq>MMSKGPAVGIDLGTTFSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDRAVQDDIKHWAFKVINAGGKPKIEVEYRGETKCFSAEEISSMVLLKMKETAEAYLGKKVSDTVISVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVERERNVLIFDLGGGTFDVSILSIEDGIFEVKSTAGDTHLGGEDFDSRLVNHFVEEFKRKHKGKDLTTNKRAVRRLRTACERAKRTLSSSAQANIEIDSLLEGIDFYTSITRARFEELCSDLFRSTLDPVEKALRDAKLDKGAVHEIVLVGGSTRIPKVQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILTGDKSEAVQDLLLLDVAPLSLGLETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMKRDNNLLGKFELSGIPPGPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITRDKGRLSKEEIERMVNDAEKFKQEDEKQRDRVAAKNGLESYAFSMKSTVEDEKVKEKIGESDRRRIMEKCEETVKWLDGNQQAEKEEYEHRQKELESVCNPIIAKMYQEAGGVGGIPGGIPGGGMPGGTPGGGIPAGMAGGMSGDPSSGGRGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 70 kDa protein (HSP70) - Echinococcus granulosus"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Echinococcus granulosus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="6210"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_ORYLA" length="686" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_ORYLA">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMNDWPFNVINDNTRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRSACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLNQVYEVGAMTKDNNLLGKFELTGIPPALWCPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYVHQQKELEKVCNPIITKLYQSAGGMPGGCQRECQEVSLELVVLLAVALLDQPLKKLIKHSMTSPSKIFTKKTLFKCNMQSIKSVMRLNQFPFITIT</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Hsc70.1) - Oryzias latipes (Medaka fish) (Japanese ricefish)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Oryzias latipes"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="8090"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7A_CAEEL" length="640" searchDatabase_ref="SDB_SwissProt" accession="HSP7A_CAEEL">
<Seq>MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein A - Caenorhabditis elegans"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Caenorhabditis elegans"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="6239"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_BRARE" length="649" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_BRARE">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVLDANRLNGRQFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYSNDSQRQATKDAGTISGLNVLVIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGSFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPEGMPGGFPGAGAAPGGGSSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) - Brachydanio rerio (Zebrafish) (Danio rerio)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Danio rerio"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7955"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_PONPY" length="646" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_PONPY">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLAKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVPSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) - Pongo pygmaeus (Orangutan)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Pongo pygmaeus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9600"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_BRUMA" length="644" searchDatabase_ref="SDB_SwissProt" accession="HSP70_BRUMA">
<Seq>MSKNAIGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDANRLIGRKFDDGSVQSDMKHWPFKVVNAGGGKPKVQVEYKGETKTFTPEEISSMVLVKMKETAEAFLGHAVKDAVITVPAYFNDSQRQATKDSGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGEDFDNRMVNHFVAEFKRNDKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKALRDAKMDKAQVHDIVLVGGSTRIPKVQKLLSDFFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTSETFTTYSDNQPGVLIQVYEGERALTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAQDKSTGKQNKITITNDKGRLSKDEIERMVQEAEKYKADDEAQKDRIAAKNALESYAFNMKQTIEDEKLKDKISEEDKKKIQEKCDETVRWLDGNQTAEKDEFEHRQKELESVCNPIITKLYQSAGGMPGGMPGGMPGGAPGAGSTGGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein - Brugia malayi (Filarial nematode worm)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Brugia malayi"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="6279"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_CHICK" length="634" searchDatabase_ref="SDB_SwissProt" accession="HSP70_CHICK">
<Seq>MSGKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKYDDPTVQSDMKHWPFRVVNEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGKKVETAVITVPAYFNDSQRQATKDAGTITGLNVMRIINEPTAAAIAYGLDKKGTRAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNRFVEEFKGKHKRDNAGNKRAVRRLRTACERARRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAEDEANRDRVGAKNSLESYTYNMKQTVEDEKLKGKISDQDKQKVLDKCQEVISSLDRNQMAEKEEYEHKQKELEKLCNPIVTKLYQGAGGAGAGGSGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein (HSP70) - Gallus gallus (Chicken)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Gallus gallus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9031"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_HYDMA" length="654" searchDatabase_ref="SDB_SwissProt" accession="HSP70_HYDMA">
<Seq>MSKAPAIGIDLGTTYSCVGVFQHGKVEIIANEQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFNDPSVTSDRKHWPFNVIDDGSRPKIQVEFKGETKSFYPEEISSMVLLKMEEIADAYLGKKVTDVVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKVGTEKNVLIFDLGGGTFDVSILAIEDGIFEIKSTAGDTHLGGEDFDNRLVNHFVDEFKRKHKKDISSNKRALRRLRTACERAKRTLSASTQASVEIDSLFDGIDFYTSITRARFEELCIDLFRGTLGPVADAIRGAGKNSSGQNFSKSDIHEVVLVGGSTRIPKVQSLLQEFFNGKELNKSINPDEAVAYGAAVQAAILAGDKHEAVQDLLLLDVAPLSLGIETAGGVFTPLIKRNTTVPTKYSQVFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELSGIPLAPRGVPQIEVTFDVDANGILNVSALDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKADDELQRDKVQAKNSLESYCYNMKQTVEDEKVKGKISEEDKKTIIKKCNETVEWVDKNQTAEKDQYEHKQKELEKVCNPIITKLYQAGGGMPGGMPGGMPGGMPGSGSKASSGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein - Hydra magnipapillata (Hydra)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Hydra magnipapillata"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="6085"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_ONCTS" length="644" searchDatabase_ref="SDB_SwissProt" accession="HSP70_ONCTS">
<Seq>MSSAKGPSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFNDQVVQADMKHWPFKVVSDGGKPKVQVDYKGENKSFNPEEISSMVLVKMREIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGMDKGMSRERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGRELNKSINPDEAVAYGAAIQAAILSGDKSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPSKQTQTFTTYSDNQPGVMIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQDADKYKAEDDAQREKIAAKNSLESYAFNMKSSVEDDNMKGKISQEDKKKVVDRCDQTISWLENNQLGDKEEYEHQLKELEKVCQPIITKLYQQGGMPTGCCGDQARTSSGDSSQGPTIEEID</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein (HSP70) - Oncorhynchus tschawytscha (Chinook salmon) (King salmon)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Oncorhynchus tshawytscha"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="74940"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_PLEWA" length="645" searchDatabase_ref="SDB_SwissProt" accession="HSP70_PLEWA">
<Seq>MSAPKGVAFGIDLGTTYSCVGVFQHGKVEIIANNQGNRTTPSYVAFTDTERLIGAPAKNQVSLNPQNTVFDAKRLIGRKFNDTVVQADMKHWPFKVVSDEWKPKVQVEYKGDNKTFFPDEVSSMVLIKMKEIAEAYLGHLVSNAVITVPSYLTASQRQATKDAGVLAGLNVLSIVNEPTAAAIAYDLDKAGRGELNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMVNHFHEPFKRKHKKDITKNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELCADLFRGPLEPVEKALRDAKLDKAQIHEIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDKSENLQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNSLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSSGKQNKITITNDKGRLSKEEIERMVQEAERYKADDEAQREKVSAKNTLESIAFNMKSTVEGDNLKDKISEDDRKKIVDKCNQTISWMENNQMAEKEEYEHQQKELEKVCNSIITKLYQGGMPGGMPSGSSGAQARQGSSSTGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein (HSP70) - Pleurodeles waltlii (Iberian ribbed newt)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Pleurodeles waltl"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="8319"/>
</DBSequence>
<DBSequence id="DBSeq_HSP71_ORYLA" length="639" searchDatabase_ref="SDB_SwissProt" accession="HSP71_ORYLA">
<Seq>MSAAKSVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVVSEGGKPKIQVDYKGENKTFFPEEISSMVLVKMKEIAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVQRIINEPTAAAIAYGLDKGKSGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSVTRARFEELCSDLFRGTLEPVEKALRDAKMDKGQIHDVVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILSGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQVFSTYADNQPGVLIQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGNENKITITNDKGRLSKEDIERMVQEAEKYKAEDEQQRDKIAAKNSLESLAFNLKSSAQDDSLKDKISQEDRKRVVEKCDETIAWLENNQLADKDEFQHKQKELEKVCNPIISKLYQGGMPSGSCREQARADSQGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1 (HSP70-1) - Oryzias latipes (Medaka fish) (Japanese ricefish)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Oryzias latipes"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="8090"/>
</DBSequence>
<DBSequence id="DBSeq_HSP71_RAT" length="641" searchDatabase_ref="SDB_SwissProt" accession="HSP71_RAT">
<Seq>MAKKTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVVNDGDKPKVQVNYKGENRSFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVAAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDSNTLAEKEEFVHKREELERVCNPIISGLYQGAGAPGAGGFGAQAPKGGSGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1A/1B (Heat shock 70 kDa protein 1/2) (HSP70.1/2) - Rattus norvegicus (Rat)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Rattus norvegicus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10116"/>
</DBSequence>
<DBSequence id="DBSeq_HSP73_BOVIN" length="631" searchDatabase_ref="SDB_SwissProt" accession="HSP73_BOVIN">
<Seq>MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGTAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHWAEEFKRKHKKDIAPARLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRVPLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGCLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISDQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGGSGASGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 3 - Bos taurus (Bovine)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Bos taurus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9913"/>
</DBSequence>
<DBSequence id="DBSeq_HSP76_HUMAN" length="643" searchDatabase_ref="SDB_SwissProt" accession="HSP76_HUMAN">
<Seq>MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 6 (Heat shock 70 kDa protein B&apos;) - Homo sapiens (Human)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_HSP77_HUMAN" length="247" searchDatabase_ref="SDB_SwissProt" accession="HSP77_HUMAN">
<Seq>MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKNQAALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFKVVSGGGKPKVRVCYRGEDKTFYPEEISSMVLTKMKETAEAYLGQPVKHAVITVPTYFSNSQRQATKDAGAIAGLKVLPIINEATAAAIAYGLDRRRAGKRNVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEF</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 7 (Heat shock 70 kDa protein B) (Fragment) - Homo sapiens (Human)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_BOVIN" length="650" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_BOVIN">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLKSYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) - Bos taurus (Bovine)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Bos taurus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9913"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_CRIGR" length="646" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_CRIGR">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGEAKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRNDKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) - Cricetulus griseus (Chinese hamster)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Cricetulus griseus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10029"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_HUMAN" length="646" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_HUMAN">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) - Homo sapiens (Human)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_MOUSE" length="646" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_MOUSE">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) - Mus musculus (Mouse)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mus musculus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10090"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_RAT" length="646" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_RAT">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) - Rattus norvegicus (Rat)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Rattus norvegicus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10116"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7C_SAGOE" length="646" searchDatabase_ref="SDB_SwissProt" accession="HSP7C_SAGOE">
<Seq>MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) (Intracellular vitamin D-binding protein 1) - Saguinus oedipus (Cotton-top tamarin)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Saguinus oedipus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9490"/>
</DBSequence>
<DBSequence id="DBSeq_HS70A_BOVIN" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70A_BOVIN">
<Seq>MAKNMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISRLYQGAGGPGAGGFGAQGPKGGSGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1A (HSP70.1) - Bos taurus (Bovine)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Bos taurus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9913"/>
</DBSequence>
<DBSequence id="DBSeq_HS70A_MOUSE" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70A_MOUSE">
<Seq>MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELERVCSPIISGLYQGAGAPGAGGFGAQAPKGASGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1A (Heat shock 70 kDa protein 3) (HSP70.3) (Hsp68) - Mus musculus (Mouse)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mus musculus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10090"/>
</DBSequence>
<DBSequence id="DBSeq_HS70B_BOSMU" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70B_BOSMU">
<Seq>MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVEATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISRLYQGAGGPGAGGFGAQAPKGGSGPGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1B (HSP70.2) - Bos mutus grunniens (Wild yak) (Bos grunniens)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Bos grunniens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="30521"/>
</DBSequence>
<DBSequence id="DBSeq_HS70B_BOVIN" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70B_BOVIN">
<Seq>MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISRLYQGAGGPGAGGFGAQGPKGGSGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1B (HSP70.2) - Bos taurus (Bovine)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Bos taurus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9913"/>
</DBSequence>
<DBSequence id="DBSeq_HS70B_MOUSE" length="642" searchDatabase_ref="SDB_SwissProt" accession="HS70B_MOUSE">
<Seq>MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELERVCSPIISGLYQGAGAPGAGGFGAQAPPKGASGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1B (HSP70.1) - Mus musculus (Mouse)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mus musculus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10090"/>
</DBSequence>
<DBSequence id="DBSeq_HS70B_PIG" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70B_PIG">
<Seq>MAKSVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQADMKHWPFRVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEIQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGAGGFGAQAPKGGSGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1B (HSP70.2) - Sus scrofa (Pig)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Sus scrofa"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9823"/>
</DBSequence>
<DBSequence id="DBSeq_HSP71_CANFA" length="641" searchDatabase_ref="SDB_SwissProt" accession="HSP71_CANFA">
<Seq>MAKSAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVVNDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRDRVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIITGLYQGAGGPGAGGFGAQAPKGGSGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1 - Canis familiaris (Dog)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Canis lupus familiaris"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9615"/>
</DBSequence>
<DBSequence id="DBSeq_HSP71_CERAE" length="638" searchDatabase_ref="SDB_SwissProt" accession="HSP71_CERAE">
<Seq>MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEADLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTRTIAYALDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTTWVEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETPGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPGVPQIEVTFEIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYALNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGGGGPGPGGFGAQGPKGGSGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1 - Cercopithecus aethiops (Green monkey) (Grivet)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Chlorocebus aethiops"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9534"/>
</DBSequence>
<DBSequence id="DBSeq_HSP71_HUMAN" length="641" searchDatabase_ref="SDB_SwissProt" accession="HSP71_HUMAN">
<Seq>MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1 (HSP70.1) (HSP70-1/HSP70-2) - Homo sapiens (Human)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_HSP72_HUMAN" length="639" searchDatabase_ref="SDB_SwissProt" accession="HSP72_HUMAN">
<Seq>MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock-related 70 kDa protein 2 (Heat shock 70 kDa protein 2) - Homo sapiens (Human)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_HSP72_MOUSE" length="633" searchDatabase_ref="SDB_SwissProt" accession="HSP72_MOUSE">
<Seq>MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDRKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFELKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGSSGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock-related 70 kDa protein 2 (Heat shock protein 70.2) - Mus musculus (Mouse)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mus musculus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10090"/>
</DBSequence>
<DBSequence id="DBSeq_HSP72_RAT" length="633" searchDatabase_ref="SDB_SwissProt" accession="HSP72_RAT">
<Seq>MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEADGYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGSSGGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock-related 70 kDa protein 2 (Heat shock protein 70.2) (Testis-specific heat shock protein-related) (HST) - Rattus norvegicus (Rat)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Rattus norvegicus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10116"/>
</DBSequence>
<DBSequence id="DBSeq_HSP76_PIG" length="643" searchDatabase_ref="SDB_SwissProt" accession="HSP76_PIG">
<Seq>MSAAREVAIGIDLGTTYSCVGVFQHGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPQNTVFDAKRLIGRKFADPTVQSDLKHWPFQVVSEGGKPKVRVSYRGEDKAFYPEEISSMVLSKMKETAEAYLGQPVRHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHRKDLSRNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGRANKITITNDKGRLSKEEVERMVREADEYKVEDEAQRDRVAAKNSLEAYVFHVKGSLHEESLRDKIPEEDRCKVQDKCQEVLTWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGAPGIPGGSSCGAQARQGAPSTGPVIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 6 (Heat shock 70 kDa protein B&apos;) - Sus scrofa (Pig)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Sus scrofa"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9823"/>
</DBSequence>
<DBSequence id="DBSeq_HSP76_SAGOE" length="643" searchDatabase_ref="SDB_SwissProt" accession="HSP76_SAGOE">
<Seq>MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPLNTVFDAKRLIGRKFADATVQADMKHWPFQVVSEGCKPKVRVSYRGEDKSFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAHGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFVEEFRRKHRKDLSWNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPRVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVRDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVREAEQYKAEDEAQRDRVAAKNSLETHVFHVKGSLQEESLRDKIPKEDRHKVQDKCQEVLAWLEHNQLADKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGAQARQGDRSTGPIIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 6 (Hsp-70-related intracellular vitamin D-binding protein) - Saguinus oedipus (Cotton-top tamarin)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Saguinus oedipus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9490"/>
</DBSequence>
<DBSequence id="DBSeq_HSP72_PARLI" length="372" searchDatabase_ref="SDB_SwissProt" accession="HSP72_PARLI">
<Seq>MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNKTASNPYRSLDAKRLIGRNFSDTNVKADMKHWPFTVIEEGGRPKIKIEFKGESKTFYAEEISSMVLLKMKETAEAYLGKESVTDAVVTVPAYFNDSQRQATKECGVISGMNILRIINEPTAAAIAYGLDKKGGAERNVLIFDLVGGTFDVSVLTIEEGIFEVKSTSRDTHLGGEDFDNRMVTHSSPEFKRKHKKDITPNKRAVRRLRTACERAKRTLSSSTQAKIEIDSLFEGIDYYTSVTRARFEELNSDLFRGTLEPVENALRDAKLDKEKIHEIVLVGGSTRIPKIQKLQDFFHGKELNKSINPDEAVAIVQ</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein II (HSP70 II) (Fragment) - Paracentrotus lividus (Common sea urchin)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Paracentrotus lividus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7656"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7A_DROSI" length="214" searchDatabase_ref="SDB_SwissProt" accession="HSP7A_DROSI">
<Seq>MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEAFAENGKPRIRGTFDVSVLTIEDGFEVKATAGDTHLGREDFDNRLVNHLVQEFQRKHGKDLGQNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNGDLFRGT</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein cognate 1 (Heat shock 70 kDa protein 70C) (Fragments) - Drosophila simulans (Fruit fly)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Drosophila simulans"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7240"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7A_DROME" length="641" searchDatabase_ref="SDB_SwissProt" accession="HSP7A_DROME">
<Seq>MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDLGGGTFDVSVLTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFQRKHKKDLGQNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNGDLFRGTMEPVAKALRDAKMDKGQIHDIVLVGGSTRIPKVQRLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEAVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQIFTTYADNQPGVLIQVFEGERAMTRDNNSLGKFELSAIPPAPRGVPQVEVTFDIDANGILNVTALEKSTGKENRITITNDKGRLSKEDIERMVNDAEAYRQADEQQRDRINAKNQLESYCFQLRSTLDDEHLSSRFSPADRETIQQRSSETIAWLDANQLAERQEFEHKQQELERICSPIITRLYQGAGMAPPPTAGGSNPGATGGSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein cognate 1 (Heat shock 70 kDa protein 70C) - Drosophila melanogaster (Fruit fly)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Drosophila melanogaster"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7227"/>
</DBSequence>
<DBSequence id="DBSeq_HS70L_HUMAN" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70L_HUMAN">
<Seq>MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1L (Heat shock 70 kDa protein 1-like) (Heat shock 70 kDa protein 1-Hom) (HSP70-Hom) - Homo sapiens (Human)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_HS70L_MOUSE" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70L_MOUSE">
<Seq>MAANKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELENMCNPIITKLYQSGCTGPTCTPGYTPGRAATGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1L (Heat shock 70 kDa protein 1-like) (Heat shock 70 kDa-like protein 1) (Spermatid-specific heat shock protein 70) - Mus musculus (Mouse)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mus musculus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10090"/>
</DBSequence>
<DBSequence id="DBSeq_HSP70_XENLA" length="647" searchDatabase_ref="SDB_SwissProt" accession="HSP70_XENLA">
<Seq>MATKGVAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQCDLKHWPFQVVSDEGKPKVKVEYKGEEKSFFPEEISSMVLTKMKETAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVLAGLNILRIINEPTAAAIAYGLDKGARGEQNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDIGQNKRALRRLRTACDRAKRTLSSSSQASIEIDSLFEGIDFYTAITRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHEIVLVGGSTRIPKVQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTVLIKRNTTIPTKQTQSFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKSSGKQNKITITNDKGRLSKEDIEKMVQEAEKYKADDDAQRERVDAKNALESYAFNLKSMVEDENVKGKISDEDKRTISEKCTQVISWLENNQLAEKEEYAFQQKDLEKVCQPIITKLYQGGVPGGVPGGMPGSSCGAQARQGGNSGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein (HSP70) - Xenopus laevis (African clawed frog)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Xenopus laevis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="8355"/>
</DBSequence>
<DBSequence id="DBSeq_HS70L_RAT" length="641" searchDatabase_ref="SDB_SwissProt" accession="HS70L_RAT">
<Seq>MAANKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVLVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCSEVLSWLEANQLAEKEEFDHKRKELENMCNPIITKLYQSGCTGPTCAPGYTPGRAATGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein 1L (Heat shock 70 kDa protein 1-like) (Heat shock 70 kDa protein 3) (HSP70.3) - Rattus norvegicus (Rat)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Rattus norvegicus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10116"/>
</DBSequence>
<DBSequence id="DBSeq_HSP7D_DROME" length="651" searchDatabase_ref="SDB_SwissProt" accession="HSP7D_DROME">
<Seq>MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS"
value="Heat shock 70 kDa protein cognate 4 (Heat shock 70 kDa protein 88E) - Drosophila melanogaster (Fruit fly)"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Drosophila melanogaster"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7227"/>
</DBSequence>
<Peptide id="peptide_1_1">
<PeptideSequence>DAGTISGLNVLR</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_1_2">
<PeptideSequence>DAGTISGLNVLR</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="10" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_1_3">
<PeptideSequence>ANQSALSRNLLR</PeptideSequence>
</Peptide>
<Peptide id="peptide_1_4">
<PeptideSequence>AQAEALALQASLR</PeptideSequence>
</Peptide>
<Peptide id="peptide_1_5">
<PeptideSequence>ASTSAGRITVPR</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_1_6">
<PeptideSequence>LEKEATNLALLK</PeptideSequence>
</Peptide>
<Peptide id="peptide_1_7">
<PeptideSequence>DAVEEGLDIVR</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_1_8">
<PeptideSequence>SQAVNNKNVIK</PeptideSequence>
<Modification location="7" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_1_9">
<PeptideSequence>NQCLATLPDLK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_1_10">
<PeptideSequence>VDTALKQLGQIR</PeptideSequence>
</Peptide>
<Peptide id="peptide_2_1">
<PeptideSequence>TTPSYVAFTDTER</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_2">
<PeptideSequence>TTPSYVAFTESER</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_3">
<PeptideSequence>TENPAEGKEQEEK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_4">
<PeptideSequence>MIKTGESGMTVFR</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="1" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="63.998291"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="9" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="63.998291"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_5">
<PeptideSequence>MIKTGESGMTVFR</PeptideSequence>
<Modification location="1" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="63.998291"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="3" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="9" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="63.998291"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_6">
<PeptideSequence>KGPGSPTDPSAMLSK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="12" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_7">
<PeptideSequence>KGPGSPTDPSAMLSK</PeptideSequence>
<Modification location="1" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="12" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_8">
<PeptideSequence>VTVLHYSGNVSSPK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_9">
<PeptideSequence>CHESRVMIFSSFR</PeptideSequence>
<Modification location="7" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="63.998291"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_2_10">
<PeptideSequence>TFDPMAFNHPAIK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_1">
<PeptideSequence>NQVAMNPNNTIFDAK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="5" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="15" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_2">
<PeptideSequence>NQVAMNPQNTVFDAK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="5" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="15" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_3">
<PeptideSequence>NQVAMNPKNTVFDAK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="5" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="15" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_4">
<PeptideSequence>NQVAMNPTQTIFDAK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="5" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="15" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_5">
<PeptideSequence>NQVAMNPKNTVFDAK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="5" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="8" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_6">
<PeptideSequence>MSNPTGSTSRILDIPCK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_7">
<PeptideSequence>SAGESKLDSHSDDDTK</PeptideSequence>
<Modification location="6" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="16" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_8">
<PeptideSequence>LGIFGFLSTGDKHMPGNR</PeptideSequence>
</Peptide>
<Peptide id="peptide_3_9">
<PeptideSequence>MSKPAGSTSRILDIPCK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="1" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_3_10">
<PeptideSequence>AVPTSEPNNTKTAYAK</PeptideSequence>
<Modification location="11" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="16" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_1">
<PeptideSequence>QPLMVITDPDMIKTVLVK</PeptideSequence>
<Modification location="13" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_2">
<PeptideSequence>MAHAERTFIAVKPDGVQR</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="1" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_3">
<PeptideSequence>FIDLPVEELINENKNK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="16" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_4">
<PeptideSequence>MLMMMALLVPLVYTIK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="1" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="4" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="5" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="16" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_5">
<PeptideSequence>MLMMMALLVPLVYTIK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="1" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="3" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="5" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="16" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_6">
<PeptideSequence>KPTCAVXNQMETVKPK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="1" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="16" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<SubstitutionModification location="7" originalResidue="X" replacementResidue="N"/>
</Peptide>
<Peptide id="peptide_4_7">
<PeptideSequence>MQSCRLVHFEPHMRPR</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="13" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_8">
<PeptideSequence>TKPVVAVAQSTLTFIKPLK</PeptideSequence>
<Modification location="19" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_9">
<PeptideSequence>MLMMMALLVPLVYTIK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="1" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="3" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="4" residues="M" monoisotopicMassDelta="15.994919">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
<cvParam accession="MS:1001524" name="fragment neutral loss" cvRef="PSI-MS" value="0"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</Modification>
<Modification location="16" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<Peptide id="peptide_4_10">
<PeptideSequence>FIDLPVEELINENKNK</PeptideSequence>
<Modification location="0" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
<Modification location="14" residues="K" monoisotopicMassDelta="127.063324">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</Modification>
</Peptide>
<PeptideEvidence peptide_ref="peptide_1_1" id="PE_1_1_HSP70_ECHGR_0" start="161" end="172" pre="K" post="I"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_ECHGR"/>
<PeptideEvidence peptide_ref="peptide_1_1" id="PE_1_1_HSP70_ONCMY_0" start="160" end="171" pre="K" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_ONCMY"/>
<PeptideEvidence peptide_ref="peptide_1_1" id="PE_1_1_HSP7C_ICTPU_0" start="160" end="171" pre="K" post="I"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_ICTPU"/>
<PeptideEvidence peptide_ref="peptide_1_1" id="PE_1_1_HSP7C_ORYLA_0" start="160" end="171" pre="K" post="I"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_ORYLA"/>
<PeptideEvidence peptide_ref="peptide_1_1" id="PE_1_1_HSP7D_MANSE_0" start="160" end="171" pre="K" post="I"
isDecoy="false" dBSequence_ref="DBSeq_HSP7D_MANSE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70A_BOVIN_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70A_BOVIN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70A_MOUSE_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70A_MOUSE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70B_BOSMU_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70B_BOSMU"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70B_BOVIN_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70B_BOVIN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70B_MOUSE_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70B_MOUSE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70B_PIG_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70B_PIG"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70L_HUMAN_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70L_HUMAN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70L_MOUSE_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70L_MOUSE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HS70L_RAT_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HS70L_RAT"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP70_BRUMA_0" start="36" end="48" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_BRUMA"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP70_CHICK_0" start="38" end="50" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_CHICK"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP70_ECHGR_0" start="38" end="50" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_ECHGR"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP70_HYDMA_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_HYDMA"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP70_ONCTS_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_ONCTS"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP70_PLEWA_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_PLEWA"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP70_XENLA_0" start="38" end="50" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_XENLA"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP71_CANFA_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP71_CANFA"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP71_CERAE_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP71_CERAE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP71_HUMAN_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP71_HUMAN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP71_ORYLA_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP71_ORYLA"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP71_RAT_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP71_RAT"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP72_HUMAN_0" start="38" end="50" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP72_HUMAN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP72_MOUSE_0" start="38" end="50" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP72_MOUSE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP72_PARLI_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP72_PARLI"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP72_RAT_0" start="38" end="50" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP72_RAT"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP73_BOVIN_0" start="38" end="50" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP73_BOVIN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP76_HUMAN_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP76_HUMAN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP76_PIG_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP76_PIG"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP76_SAGOE_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP76_SAGOE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP77_HUMAN_0" start="39" end="51" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP77_HUMAN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7A_CAEEL_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7A_CAEEL"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_BOVIN_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_BOVIN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_BRARE_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_BRARE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_CRIGR_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_CRIGR"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_HUMAN_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_HUMAN"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_MOUSE_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_MOUSE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_ORYLA_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_ORYLA"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_PONPY_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_PONPY"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_RAT_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_RAT"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7C_SAGOE_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7C_SAGOE"/>
<PeptideEvidence peptide_ref="peptide_2_1" id="PE_2_1_HSP7D_DROME_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7D_DROME"/>
<PeptideEvidence peptide_ref="peptide_2_2" id="PE_2_2_HSP7A_DROME_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7A_DROME"/>
<PeptideEvidence peptide_ref="peptide_2_2" id="PE_2_2_HSP7A_DROSI_0" start="37" end="49" pre="R" post="L"
isDecoy="false" dBSequence_ref="DBSeq_HSP7A_DROSI"/>
<PeptideEvidence peptide_ref="peptide_3_1" id="PE_3_1_HSP7A_DROME_0" start="57" end="71" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HSP7A_DROME"/>
<PeptideEvidence peptide_ref="peptide_3_1" id="PE_3_1_HSP7A_DROSI_0" start="57" end="71" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HSP7A_DROSI"/>
<PeptideEvidence peptide_ref="peptide_3_1" id="PE_3_1_HSP7D_MANSE_0" start="57" end="71" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HSP7D_MANSE"/>
<PeptideEvidence peptide_ref="peptide_3_2" id="PE_3_2_HS70L_HUMAN_0" start="59" end="73" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HS70L_HUMAN"/>
<PeptideEvidence peptide_ref="peptide_3_2" id="PE_3_2_HS70L_MOUSE_0" start="59" end="73" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HS70L_MOUSE"/>
<PeptideEvidence peptide_ref="peptide_3_2" id="PE_3_2_HS70L_RAT_0" start="59" end="73" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HS70L_RAT"/>
<PeptideEvidence peptide_ref="peptide_3_2" id="PE_3_2_HSP70_XENLA_0" start="58" end="72" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HSP70_XENLA"/>
<PeptideEvidence peptide_ref="peptide_3_4" id="PE_3_4_HSP7D_DROME_0" start="57" end="71" pre="K" post="R"
isDecoy="false" dBSequence_ref="DBSeq_HSP7D_DROME"/>
</SequenceCollection>
<AnalysisCollection>
<SpectrumIdentification id="SI" spectrumIdentificationProtocol_ref="SIP" spectrumIdentificationList_ref="SIL_1"
activityDate="2008-07-09T18:33:47">
<InputSpectra spectraData_ref="SD_1"/>
<SearchDatabaseRef searchDatabase_ref="SDB_SwissProt"/>
</SpectrumIdentification>
<ProteinDetection id="PD_1" proteinDetectionProtocol_ref="PDP_MascotParser_1" proteinDetectionList_ref="PDL_1"
activityDate="2009-08-18T18:01:21">
<InputSpectrumIdentifications spectrumIdentificationList_ref="SIL_1"/>
</ProteinDetection>
</AnalysisCollection>
<AnalysisProtocolCollection>
<SpectrumIdentificationProtocol id="SIP" analysisSoftware_ref="AS_mascot_server">
<SearchType>
<cvParam accession="MS:1001083" name="ms-ms search" cvRef="PSI-MS" value=""/>
</SearchType>
<AdditionalSearchParams>
<cvParam accession="MS:1001211" name="parent mass type mono" cvRef="PSI-MS"/>
<cvParam accession="MS:1001259" name="param: immonium ion" cvRef="PSI-MS"/>
<cvParam accession="MS:1001108" name="param: a ion" cvRef="PSI-MS"/>
<cvParam accession="MS:1001146" name="param: a ion-NH3" cvRef="PSI-MS"/>
<cvParam accession="MS:1001118" name="param: b ion" cvRef="PSI-MS"/>
<cvParam accession="MS:1001149" name="param: b ion-NH3" cvRef="PSI-MS"/>
<cvParam accession="MS:1001262" name="param: y ion" cvRef="PSI-MS"/>
<cvParam accession="MS:1001151" name="param: y ion-NH3" cvRef="PSI-MS"/>
<cvParam accession="MS:1001406" name="param: internal yb ion" cvRef="PSI-MS"/>
<cvParam accession="MS:1001407" name="param: internal ya ion" cvRef="PSI-MS"/>
<userParam name="Mascot User Comment" value="Example Mascot MS-MS search for PSI mzIdentML"/>
<userParam name="Mascot Instrument Name" value="ESI-TRAP"/>
</AdditionalSearchParams>
<ModificationParams>
<SearchModification fixedMod="false" massDelta="15.994915" residues="M">
<cvParam accession="UNIMOD:35" name="Oxidation" cvRef="UNIMOD"/>
</SearchModification>
<SearchModification fixedMod="false" massDelta="127.063329" residues="K">
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</SearchModification>
<SearchModification fixedMod="false" massDelta="127.063329" residues="">
<SpecificityRules>
<cvParam accession="MS:1001189" cvRef="PSI-MS" name="modification specificity N-term"/>
</SpecificityRules>
<cvParam accession="UNIMOD:29" name="SMA" cvRef="UNIMOD"/>
</SearchModification>
</ModificationParams>
<Enzymes independent="0">
<Enzyme id="ENZ_0" cTermGain="OH" nTermGain="H" missedCleavages="1" semiSpecific="0">
<SiteRegexp><![CDATA[(?<=[KR])(?!P)]]></SiteRegexp>
<EnzymeName>
<userParam name="Enzyme" value="CNBr+Trypsin"/>
</EnzymeName>
</Enzyme>
<Enzyme id="ENZ_1" cTermGain="OH" nTermGain="H" missedCleavages="1" semiSpecific="0">
<EnzymeName>
<userParam name="Enzyme" value="CNBr+Trypsin"/>
</EnzymeName>
</Enzyme>
</Enzymes>
<MassTable id="MT" msLevel="1 2">
<Residue code="A" mass="71.037114"/>
<Residue code="C" mass="103.009185"/>
<Residue code="D" mass="115.026943"/>
<Residue code="E" mass="129.042593"/>
<Residue code="F" mass="147.068414"/>
<Residue code="G" mass="57.021464"/>
<Residue code="H" mass="137.058912"/>
<Residue code="I" mass="113.084064"/>
<Residue code="K" mass="128.094963"/>
<Residue code="L" mass="113.084064"/>
<Residue code="M" mass="131.040485"/>
<Residue code="N" mass="114.042927"/>
<Residue code="P" mass="97.052764"/>
<Residue code="Q" mass="128.058578"/>
<Residue code="R" mass="156.101111"/>
<Residue code="S" mass="87.032028"/>
<Residue code="T" mass="101.047679"/>
<Residue code="U" mass="150.95363"/>
<Residue code="V" mass="99.068414"/>
<Residue code="W" mass="186.079313"/>
<Residue code="Y" mass="163.063329"/>
<AmbiguousResidue code="B">
<cvParam accession="MS:1001360" name="alternate single letter codes" cvRef="PSI-MS" value="D N"/>
</AmbiguousResidue>
<AmbiguousResidue code="Z">
<cvParam accession="MS:1001360" name="alternate single letter codes" cvRef="PSI-MS" value="E Q"/>
</AmbiguousResidue>
<AmbiguousResidue code="X">
<cvParam accession="MS:1001360" name="alternate single letter codes" cvRef="PSI-MS"
value="A C D E F G H I K L M N O P Q R S T U V W Y"/>
</AmbiguousResidue>
</MassTable>
<FragmentTolerance>
<cvParam accession="MS:1001412" name="search tolerance plus value" value="0.5" cvRef="PSI-MS"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
<cvParam accession="MS:1001413" name="search tolerance minus value" value="0.5" cvRef="PSI-MS"
unitAccession="UO:0000221" unitName="dalton" unitCvRef="UO"/>
</FragmentTolerance>
<ParentTolerance>
<cvParam accession="MS:1001412" name="search tolerance plus value" value="0.1" cvRef="PSI-MS"
unitAccession="UO:0000187" unitName="percent" unitCvRef="UO"/>
<cvParam accession="MS:1001413" name="search tolerance minus value" value="0.1" cvRef="PSI-MS"
unitAccession="UO:0000187" unitName="percent" unitCvRef="UO"/>
</ParentTolerance>
<Threshold>
<cvParam accession="MS:1001316" name="Mascot:SigThreshold" cvRef="PSI-MS" value="0.05"/>
</Threshold>
<DatabaseFilters>
<Filter>
<FilterType>
<cvParam accession="MS:1001020" name="DB filter taxonomy" cvRef="PSI-MS"/>
</FilterType>
<Include>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="33208"/>
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS"
value="Metazoa"/>
</Include>
</Filter>
</DatabaseFilters>
</SpectrumIdentificationProtocol>
<ProteinDetectionProtocol id="PDP_MascotParser_1" analysisSoftware_ref="AS_mascot_parser">
<AnalysisParams>
<cvParam accession="MS:1001316" name="Mascot:SigThreshold" cvRef="PSI-MS" value="0.05"/>
<cvParam accession="MS:1001317" name="Mascot:MaxProteinHits" cvRef="PSI-MS" value="Auto"/>
<cvParam accession="MS:1001318" name="Mascot:ProteinScoringMethod" cvRef="PSI-MS" value="Standard"/>
<cvParam accession="MS:1001319" name="Mascot:MinMSMSThreshold" cvRef="PSI-MS" value="0"/>
<cvParam accession="MS:1001320" name="Mascot:ShowHomologousProteinsWithSamePeptides" cvRef="PSI-MS" value="1"/>
<cvParam accession="MS:1001321" name="Mascot:ShowHomologousProteinsWithSubsetOfPeptides" cvRef="PSI-MS" value="1"/>
<cvParam accession="MS:1001322" name="Mascot:RequireBoldRed" cvRef="PSI-MS" value="0"/>
<cvParam accession="MS:1001323" name="Mascot:UseUnigeneClustering" cvRef="PSI-MS" value="false"/>
<cvParam accession="MS:1001324" name="Mascot:IncludeErrorTolerantMatches" cvRef="PSI-MS" value="1"/>
<cvParam accession="MS:1001325" name="Mascot:ShowDecoyMatches" cvRef="PSI-MS" value="0"/>
</AnalysisParams>
<Threshold>
<cvParam accession="MS:1001494" name="no threshold" cvRef="PSI-MS"/>
</Threshold>
</ProteinDetectionProtocol>
</AnalysisProtocolCollection>
<DataCollection>
<Inputs>
<SourceFile location="file:///../data/F001350.dat" id="SF_1">
<FileFormat>
<cvParam accession="MS:1001199" name="Mascot DAT file" cvRef="PSI-MS"/>
</FileFormat>
</SourceFile>
<SearchDatabase location="file:///C:/inetpub/mascot/sequence/SwissProt/current/SwissProt_51.6.fasta"
id="SDB_SwissProt" name="SwissProt" numDatabaseSequences="257964" numResidues="93947433"
releaseDate="2011-03-01T21:32:52" version="SwissProt_51.6.fasta">
<FileFormat>
<cvParam accession="MS:1001348" name="FASTA format" cvRef="PSI-MS"/>
</FileFormat>
<DatabaseName>
<userParam name="SwissProt_51.6.fasta"/>
</DatabaseName>
<cvParam accession="MS:1001073" name="database type amino acid" cvRef="PSI-MS"/>
</SearchDatabase>
<SpectraData location="file:///dyckall.asc" id="SD_1">
<FileFormat>
<cvParam accession="MS:1001062" name="Mascot MGF file" cvRef="PSI-MS"/>
</FileFormat>
<SpectrumIDFormat>
<cvParam accession="MS:1001528" name="Mascot query number" cvRef="PSI-MS"/>
</SpectrumIDFormat>
</SpectraData>
</Inputs>
<AnalysisData>
<SpectrumIdentificationList id="SIL_1" numSequencesSearched="71412">
<FragmentationTable>
<Measure id="m_mz">
<cvParam cvRef="PSI-MS" accession="MS:1001225" name="product ion m/z" unitName="m/z" unitCvRef="PSI-MS" unitAccession="MS:1000040"/>
</Measure>
<Measure id="m_intensity">
<cvParam cvRef="PSI-MS" accession="MS:1001226" name="product ion intensity" unitAccession="MS:1000131" unitCvRef="UO" unitName="number of counts"/>
</Measure>
<Measure id="m_error">
<cvParam cvRef="PSI-MS" accession="MS:1001227" name="product ion m/z error"
unitAccession="MS:1000040" unitName="m/z" unitCvRef="PSI-MS"/>
</Measure>
</FragmentationTable>
<SpectrumIdentificationResult id="SIR_1" spectrumID="query=1" spectraData_ref="SD_1">
<SpectrumIdentificationItem id="SII_1_1" calculatedMassToCharge="671.869886" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_1" rank="1"
passThreshold="true" massTable_ref="MT" sample_ref="sample1">
<PeptideEvidenceRef peptideEvidence_ref="PE_1_1_HSP70_ECHGR_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_1_1_HSP70_ONCMY_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_1_1_HSP7C_ICTPU_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_1_1_HSP7C_ORYLA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_1_1_HSP7D_MANSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="1 2 3 4 8" charge="1">
<FragmentArray values="214.8 286.1 342.8 444.1 814.1 " measure_ref="m_mz"/>
<FragmentArray values="18 83 48 75 277" measure_ref="m_intensity"/>
<FragmentArray values="-0.3026 -0.0397 -0.3612 -0.1089 -0.3305" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="8" charge="2">
<FragmentArray values="408.2 " measure_ref="m_mz"/>
<FragmentArray values="187" measure_ref="m_intensity"/>
<FragmentArray values="0.4811" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="1 2 3 4 5 7 8 9 10 11" charge="1">
<FragmentArray
values="242.8 314.2 371.127841 472.096295 584.997427 729.2 842.9 956.1 1056 1169.1 "
measure_ref="m_mz"/>
<FragmentArray values="417 1308 1663 29390 39060 626 4893 2241 492 11230"
measure_ref="m_intensity"/>
<FragmentArray
values="-0.2975 0.0653 -0.0283 -0.1075 -0.2904 -0.1414 0.4746 -0.3684 0.4632 0.4792"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="11" charge="2">
<FragmentArray values="584.997427 " measure_ref="m_mz"/>
<FragmentArray values="39060" measure_ref="m_intensity"/>
<FragmentArray values="0.1834" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="11 10 9 8 7 6 5 4 3 2" charge="1">
<FragmentArray
values="1100.3 1029.3 972.292156 871.2 758.2 671.2 614.4 501.4 387.2 288.2 "
measure_ref="m_mz"/>
<FragmentArray values="1290 1846 1874 25390 73560 65440 1403 10430 656 2137"
measure_ref="m_intensity"/>
<FragmentArray
values="-0.3422 -0.3051 -0.2915 -0.3360 -0.2519 -0.2199 0.0016 0.0856 -0.0714 -0.0030"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="11 8 7" charge="2">
<FragmentArray values="551.3 436.4 380.1 " measure_ref="m_mz"/>
<FragmentArray values="800 11 46" measure_ref="m_intensity"/>
<FragmentArray values="0.4752 0.1284 0.3704" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="6" charge="1">
<FragmentArray values="654.180103 " measure_ref="m_mz"/>
<FragmentArray values="30070" measure_ref="m_intensity"/>
<FragmentArray values="-0.2132" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="11 8 7 4" charge="2">
<FragmentArray values="542 428.2 371.127841 242.8 " measure_ref="m_mz"/>
<FragmentArray values="399 283 1663 417" measure_ref="m_intensity"/>
<FragmentArray values="-0.3115 0.4416 -0.0885 0.1525" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 5 2 6 3 6 4 5 4 7 4 8 4 9 5 8" charge="1">
<FragmentArray values="342.8 429.9 359.1 214.8 359.1 472.096295 586.2 371.127841 "
measure_ref="m_mz"/>
<FragmentArray values="48 57 28 18 28 29390 5258 1663" measure_ref="m_intensity"/>
<FragmentArray values="-0.3976 -0.3296 -0.0925 -0.3390 -0.0925 -0.1803 -0.1195 -0.1011"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 5 3 7 3 8 4 8 5 8 5 11 8 11" charge="1">
<FragmentArray values="315.2 388.1 501.4 444.1 342.8 669.901495 412.4 "
measure_ref="m_mz"/>
<FragmentArray values="44 63 10430 75 48 6420 31" measure_ref="m_intensity"/>
<FragmentArray values="-0.0027 -0.1191 0.0969 -0.1817 -0.4340 0.4721 0.1082"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="62.72"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="0.000863428353297988"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_2" calculatedMassToCharge="671.8679555" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_2" rank="2"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="1 2 6 7" charge="1">
<FragmentArray values="214.8 286.1 730 843.6 " measure_ref="m_mz"/>
<FragmentArray values="18 83 214 194" measure_ref="m_intensity"/>
<FragmentArray values="-0.3026 -0.0397 -0.3804 0.1355" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="6 8" charge="2">
<FragmentArray values="366 473.2 " measure_ref="m_mz"/>
<FragmentArray values="36 1342" measure_ref="m_intensity"/>
<FragmentArray values="0.3062 0.4403" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="1 2 5 6 7 8" charge="1">
<FragmentArray values="242.8 314.2 671.2 758.2 871.2 972.292156 " measure_ref="m_mz"/>
<FragmentArray values="417 1308 65440 73560 25390 1874" measure_ref="m_intensity"/>
<FragmentArray values="-0.2975 0.0653 -0.1433 -0.1753 -0.2594 -0.2149"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="6 7" charge="2">
<FragmentArray values="380.1 436.4 " measure_ref="m_mz"/>
<FragmentArray values="46 11" measure_ref="m_intensity"/>
<FragmentArray values="0.4087 0.1667" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="9 8 4 3 2" charge="1">
<FragmentArray values="1100.3 1029.3 584.997427 472.096295 371.127841 "
measure_ref="m_mz"/>
<FragmentArray values="1290 1846 39060 29390 1663" measure_ref="m_intensity"/>
<FragmentArray values="-0.3384 -0.3013 -0.3632 -0.1803 -0.1011" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="9" charge="2">
<FragmentArray values="551.3 " measure_ref="m_mz"/>
<FragmentArray values="800" measure_ref="m_intensity"/>
<FragmentArray values="0.4772" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="5 4 3" charge="1">
<FragmentArray values="655 568.1 454.9 " measure_ref="m_mz"/>
<FragmentArray values="1672 5122 64" measure_ref="m_intensity"/>
<FragmentArray values="-0.3661 -0.2341 -0.3500" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="9" charge="2">
<FragmentArray values="542 " measure_ref="m_mz"/>
<FragmentArray values="399" measure_ref="m_intensity"/>
<FragmentArray values="-0.3096" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="5 7 7 8" charge="1">
<FragmentArray values="314.2 214.8 " measure_ref="m_mz"/>
<FragmentArray values="1308 18" measure_ref="m_intensity"/>
<FragmentArray values="-0.0074 -0.3390" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 4 5 7 5 8 6 9" charge="1">
<FragmentArray values="288.2 286.1 387.2 371.127841 " measure_ref="m_mz"/>
<FragmentArray values="2137 83 656 1663" measure_ref="m_intensity"/>
<FragmentArray values="0.0260 -0.1125 -0.0602 -0.1011" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="23.54"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="7.14868739040114"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_3" calculatedMassToCharge="671.881101" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_3" rank="3"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 5" charge="1">
<FragmentArray values="286.1 444.1 " measure_ref="m_mz"/>
<FragmentArray values="83 75" measure_ref="m_intensity"/>
<FragmentArray values="-0.0510 -0.1201" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="314.2 " measure_ref="m_mz"/>
<FragmentArray values="1308" measure_ref="m_intensity"/>
<FragmentArray values="0.0415" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="3 5 6 10 11" charge="1">
<FragmentArray values="314.2 472.096295 584.997427 1056 1169.1 " measure_ref="m_mz"/>
<FragmentArray values="1308 29390 39060 492 11230" measure_ref="m_intensity"/>
<FragmentArray values="0.0541 -0.1187 -0.3017 0.4408 0.4567" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="9 11" charge="2">
<FragmentArray values="472.096295 584.997427 " measure_ref="m_mz"/>
<FragmentArray values="29390 39060" measure_ref="m_intensity"/>
<FragmentArray values="0.3551 0.1721" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="5 6 7" charge="1">
<FragmentArray values="454.9 568.1 655 " measure_ref="m_mz"/>
<FragmentArray values="64 5122 1672" measure_ref="m_intensity"/>
<FragmentArray values="-0.2885 -0.1726 -0.3046" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="9 7 6 5 2" charge="1">
<FragmentArray values="1029.3 871.2 758.2 671.2 288.2 " measure_ref="m_mz"/>
<FragmentArray values="1846 25390 73560 65440 2137" measure_ref="m_intensity"/>
<FragmentArray values="-0.3164 -0.3472 -0.2631 -0.2311 -0.0030" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="8 7 6" charge="2">
<FragmentArray values="472.096295 436.4 380.1 " measure_ref="m_mz"/>
<FragmentArray values="29390 11 46" measure_ref="m_intensity"/>
<FragmentArray values="0.3005 0.1228 0.3648" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="5" charge="1">
<FragmentArray values="654.180103 " measure_ref="m_mz"/>
<FragmentArray values="30070" measure_ref="m_intensity"/>
<FragmentArray values="-0.2245" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="7 6" charge="2">
<FragmentArray values="428.2 371.127841 " measure_ref="m_mz"/>
<FragmentArray values="283 1663" measure_ref="m_intensity"/>
<FragmentArray values="0.4360 -0.0941" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 3 3 5 4 7 5 8 5 9 5 10" charge="1">
<FragmentArray values="242.8 287.1 359.1 428.2 542 655 " measure_ref="m_mz"/>
<FragmentArray values="417 23 28 283 399 1672" measure_ref="m_intensity"/>
<FragmentArray values="-0.3088 -0.0350 -0.0925 -0.0616 -0.3045 -0.3886"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 3 6 11 8 9" charge="1">
<FragmentArray values="214.8 669.901495 242.8 " measure_ref="m_mz"/>
<FragmentArray values="18 6420 417" measure_ref="m_intensity"/>
<FragmentArray values="-0.3139 0.4609 -0.3564" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="21.74"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="10.8199762112957"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_4" calculatedMassToCharge="671.3778585" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_4" rank="4"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3" charge="1">
<FragmentArray values="242.8 " measure_ref="m_mz"/>
<FragmentArray values="417" measure_ref="m_intensity"/>
<FragmentArray values="-0.3452" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7 8" charge="2">
<FragmentArray values="314.2 371.127841 " measure_ref="m_mz"/>
<FragmentArray values="1308 1663" measure_ref="m_intensity"/>
<FragmentArray values="0.0233 0.4091" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="5" charge="1">
<FragmentArray values="426.4 " measure_ref="m_mz"/>
<FragmentArray values="75" measure_ref="m_intensity"/>
<FragmentArray values="0.2017" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="9" charge="2">
<FragmentArray values="426.4 " measure_ref="m_mz"/>
<FragmentArray values="75" measure_ref="m_intensity"/>
<FragmentArray values="0.1653" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="7 11 12" charge="1">
<FragmentArray values="655 1055 1167.994665 " measure_ref="m_mz"/>
<FragmentArray values="1672 12270 17250" measure_ref="m_intensity"/>
<FragmentArray values="-0.3410 0.4472 0.3578" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 5 6" charge="1">
<FragmentArray values="253.9 454.1 567 " measure_ref="m_mz"/>
<FragmentArray values="44 5162 54690" measure_ref="m_intensity"/>
<FragmentArray values="-0.2135 -0.0932 -0.2773" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="8" charge="2">
<FragmentArray values="376.1 " measure_ref="m_mz"/>
<FragmentArray values="14" measure_ref="m_intensity"/>
<FragmentArray values="-0.1029" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="8 7 2" charge="1">
<FragmentArray values="871.2 758.2 288.2 " measure_ref="m_mz"/>
<FragmentArray values="25390 73560 2137" measure_ref="m_intensity"/>
<FragmentArray values="-0.3360 -0.2519 -0.0030" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="9 8 7" charge="2">
<FragmentArray values="472.096295 436.4 380.1 " measure_ref="m_mz"/>
<FragmentArray values="29390 11 46" measure_ref="m_intensity"/>
<FragmentArray values="0.3061 0.1284 0.3704" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10 6" charge="1">
<FragmentArray values="1055 669.901495 " measure_ref="m_mz"/>
<FragmentArray values="12270 6420" measure_ref="m_intensity"/>
<FragmentArray values="0.4109 -0.4868" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="8 7 4" charge="2">
<FragmentArray values="428.2 371.127841 214.8 " measure_ref="m_mz"/>
<FragmentArray values="283 1663 18" measure_ref="m_intensity"/>
<FragmentArray values="0.4416 -0.0885 -0.3264" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="4 6 5 10 5 11 6 9 8 9 9 11" charge="1">
<FragmentArray values="314.2 568.1 655 426.4 242.1 287.1 " measure_ref="m_mz"/>
<FragmentArray values="1308 5122 1672 75 19 23" measure_ref="m_intensity"/>
<FragmentArray values="0.0290 -0.2453 -0.3774 0.1289 -0.0499 -0.0350"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="3 7 4 6 6 12" charge="1">
<FragmentArray values="428.2 286.1 669.901495 " measure_ref="m_mz"/>
<FragmentArray values="283 83 6420" measure_ref="m_intensity"/>
<FragmentArray values="-0.0504 -0.0761 0.4721" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="18.48"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="22.9206170903222"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_5" calculatedMassToCharge="671.875501" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_5" rank="5"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 7 8" charge="1">
<FragmentArray values="359.1 730 843.6 " measure_ref="m_mz"/>
<FragmentArray values="28 214 194" measure_ref="m_intensity"/>
<FragmentArray values="-0.0925 -0.3842 0.1317" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7 9" charge="2">
<FragmentArray values="366 473.2 " measure_ref="m_mz"/>
<FragmentArray values="36 1342" measure_ref="m_intensity"/>
<FragmentArray values="0.3042 0.4384" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="2 3 7 8 9 11" charge="1">
<FragmentArray values="286.1 387.2 758.2 871.2 972.292156 1169.1 " measure_ref="m_mz"/>
<FragmentArray values="83 656 73560 25390 1874 11230" measure_ref="m_intensity"/>
<FragmentArray values="-0.0397 0.0126 -0.1791 -0.2632 -0.2187 0.4679"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="7 8 11" charge="2">
<FragmentArray values="380.1 436.4 584.997427 " measure_ref="m_mz"/>
<FragmentArray values="46 11 39060" measure_ref="m_intensity"/>
<FragmentArray values="0.4068 0.1648 0.1778" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="9 10" charge="1">
<FragmentArray values="955 1055 " measure_ref="m_mz"/>
<FragmentArray values="51 12270" measure_ref="m_intensity"/>
<FragmentArray values="-0.4843 0.4472" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="7 8" charge="2">
<FragmentArray values="371.127841 428.2 " measure_ref="m_mz"/>
<FragmentArray values="1663 283" measure_ref="m_intensity"/>
<FragmentArray values="-0.0521 0.4780" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="10 9 5 4 3" charge="1">
<FragmentArray values="1057.2 956.1 584.997427 472.096295 371.127841 "
measure_ref="m_mz"/>
<FragmentArray values="416 2241 39060 29390 1663" measure_ref="m_intensity"/>
<FragmentArray values="-0.4113 -0.4636 -0.3744 -0.1915 -0.1123" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="6" charge="2">
<FragmentArray values="371.127841 " measure_ref="m_mz"/>
<FragmentArray values="1663" measure_ref="m_intensity"/>
<FragmentArray values="-0.1123" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="5 4" charge="1">
<FragmentArray values="568.1 454.9 " measure_ref="m_mz"/>
<FragmentArray values="5122 64" measure_ref="m_intensity"/>
<FragmentArray values="-0.2453 -0.3613" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="8" charge="2">
<FragmentArray values="426.4 " measure_ref="m_mz"/>
<FragmentArray values="75" measure_ref="m_intensity"/>
<FragmentArray values="-0.3561" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 5 3 7 3 8 4 9 6 9 7 9 7 11 8 9 8 10 8 11" charge="1">
<FragmentArray values="347.5 473.2 586.2 586.2 428.2 371.127841 567 214.8 314.2 410.9 "
measure_ref="m_mz"/>
<FragmentArray values="19 1342 5258 5258 283 1663 54690 18 1308 22"
measure_ref="m_intensity"/>
<FragmentArray
values="0.3439 -0.0467 -0.1307 -0.1307 -0.0616 -0.1123 -0.3613 -0.3390 -0.0074 -0.3602"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 6 3 6 7 8 7 9 8 10" charge="1">
<FragmentArray values="376.1 289 242.1 342.8 286.1 " measure_ref="m_mz"/>
<FragmentArray values="14 60 19 48 83" measure_ref="m_intensity"/>
<FragmentArray values="-0.0827 -0.1506 -0.0975 -0.4452 -0.1125" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="18.48"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="22.9206170903222"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_6" calculatedMassToCharge="671.9006325" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_6" rank="6"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="2 3 4 7 8 10 11" charge="1">
<FragmentArray values="214.8 342.8 472.096295 758.2 871.2 1056 1169.1 "
measure_ref="m_mz"/>
<FragmentArray values="18 48 29390 73560 25390 492 11230" measure_ref="m_intensity"/>
<FragmentArray values="-0.3390 -0.4340 -0.1803 -0.2043 -0.2884 0.3905 0.4064"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7 8 9 11" charge="2">
<FragmentArray values="380.1 436.4 472.096295 584.997427 " measure_ref="m_mz"/>
<FragmentArray values="46 11 29390 39060" measure_ref="m_intensity"/>
<FragmentArray values="0.3942 0.1522 0.3299 0.1470" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="3 4" charge="1">
<FragmentArray values="325.8 454.9 " measure_ref="m_mz"/>
<FragmentArray values="17 64" measure_ref="m_intensity"/>
<FragmentArray values="-0.4074 -0.3500" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="6 7 8" charge="2">
<FragmentArray values="314.2 371.127841 428.2 " measure_ref="m_mz"/>
<FragmentArray values="1308 1663 283" measure_ref="m_intensity"/>
<FragmentArray values="0.0290 -0.0647 0.4655" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2 3 4 11" charge="1">
<FragmentArray values="242.8 371.127841 500.7 1196.9 " measure_ref="m_mz"/>
<FragmentArray values="417 1663 143 96" measure_ref="m_intensity"/>
<FragmentArray values="-0.3339 -0.1011 0.4285 0.2115" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="5 7 10 11" charge="2">
<FragmentArray values="286.1 394 542 599.1 " measure_ref="m_mz"/>
<FragmentArray values="83 115 399 1504" measure_ref="m_intensity"/>
<FragmentArray values="-0.0579 0.2968 -0.3059 0.2521" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="6 7" charge="1">
<FragmentArray values="655 769.3 " measure_ref="m_mz"/>
<FragmentArray values="1672 111" measure_ref="m_intensity"/>
<FragmentArray values="-0.3297 -0.0727" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="4" charge="2">
<FragmentArray values="242.1 " measure_ref="m_mz"/>
<FragmentArray values="19" measure_ref="m_intensity"/>
<FragmentArray values="-0.0261" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="10 9 8 6 4" charge="1">
<FragmentArray values="1100.3 972.292156 843.6 671.2 444.1 " measure_ref="m_mz"/>
<FragmentArray values="1290 1874 194 65440 75" measure_ref="m_intensity"/>
<FragmentArray values="-0.3674 -0.2803 0.0702 -0.2450 -0.2180" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10 7" charge="2">
<FragmentArray values="551.3 387.2 " measure_ref="m_mz"/>
<FragmentArray values="800 656" measure_ref="m_intensity"/>
<FragmentArray values="0.4627 0.4500" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="6 2" charge="1">
<FragmentArray values="654.180103 242.8 " measure_ref="m_mz"/>
<FragmentArray values="30070 417" measure_ref="m_intensity"/>
<FragmentArray values="-0.2384 -0.3703" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="10 7" charge="2">
<FragmentArray values="542 377.992647 " measure_ref="m_mz"/>
<FragmentArray values="399 1088" measure_ref="m_intensity"/>
<FragmentArray values="-0.3241 -0.2441" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 4 3 6 5 7 7 10 8 11" charge="1">
<FragmentArray values="387.2 429.9 287.1 412.4 410.9 " measure_ref="m_mz"/>
<FragmentArray values="656 57 23 31 22" measure_ref="m_intensity"/>
<FragmentArray values="0.0126 -0.3296 -0.0350 0.1446 -0.3966" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 4 2 5 4 7 4 8 5 11" charge="1">
<FragmentArray values="359.1 429.9 388.1 501.4 669.901495 " measure_ref="m_mz"/>
<FragmentArray values="28 57 63 10430 6420" measure_ref="m_intensity"/>
<FragmentArray values="-0.0925 -0.3296 -0.0827 0.1333 0.4721" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="16.84"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="33.4369230656729"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_7" calculatedMassToCharge="671.8460745" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_7" rank="7"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="1 2" charge="1">
<FragmentArray values="214.8 286.1 " measure_ref="m_mz"/>
<FragmentArray values="18 83" measure_ref="m_intensity"/>
<FragmentArray values="-0.3026 -0.0397" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="407.3 " measure_ref="m_mz"/>
<FragmentArray values="11" measure_ref="m_intensity"/>
<FragmentArray values="0.0969" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="1 2 4 5 6 7 8 10" charge="1">
<FragmentArray values="242.8 314.2 542 671.2 728.8 841.2 956.1 1168.5 "
measure_ref="m_mz"/>
<FragmentArray values="417 1308 399 65440 1397 215 2241 42" measure_ref="m_intensity"/>
<FragmentArray values="-0.2975 0.0653 -0.2457 -0.0883 0.4903 -0.1938 -0.3207 -0.0732"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="10" charge="2">
<FragmentArray values="584.997427 " measure_ref="m_mz"/>
<FragmentArray values="39060" measure_ref="m_intensity"/>
<FragmentArray values="0.2072" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="10 9 7 4 3" charge="1">
<FragmentArray values="1100.3 1029.3 801.8 502.4 387.2 " measure_ref="m_mz"/>
<FragmentArray values="1290 1846 171 556 656" measure_ref="m_intensity"/>
<FragmentArray values="-0.2946 -0.2575 0.3535 0.1016 -0.0714" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10 4" charge="2">
<FragmentArray values="551.3 252.1 " measure_ref="m_mz"/>
<FragmentArray values="800 20" measure_ref="m_intensity"/>
<FragmentArray values="0.4991 0.4472" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="6" charge="1">
<FragmentArray values="655 " measure_ref="m_mz"/>
<FragmentArray values="1672" measure_ref="m_intensity"/>
<FragmentArray values="-0.3774" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="10 4" charge="2">
<FragmentArray values="542 242.8 " measure_ref="m_mz"/>
<FragmentArray values="399 417" measure_ref="m_intensity"/>
<FragmentArray values="-0.2877 -0.3395" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 7 6 8" charge="1">
<FragmentArray values="599.1 286.1 " measure_ref="m_mz"/>
<FragmentArray values="1504 83" measure_ref="m_intensity"/>
<FragmentArray values="-0.2035 -0.0397" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="3 6 3 7 4 6 5 8 5 9 5 10 6 9 7 9" charge="1">
<FragmentArray values="387.2 500.7 288.2 387.2 500.7 599.1 371.127841 314.2 "
measure_ref="m_mz"/>
<FragmentArray values="656 143 2137 656 143 1504 1663 1308" measure_ref="m_intensity"/>
<FragmentArray values="0.0126 0.4285 0.0810 0.0126 0.4285 -0.2399 -0.1011 -0.0074"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="16.3"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="37.8639838250474"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_8" calculatedMassToCharge="671.377866" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_8" rank="8"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="5 6 7 8 9 10" charge="1">
<FragmentArray values="472.096295 586.2 841.9 955 1055 1167.994665 "
measure_ref="m_mz"/>
<FragmentArray values="29390 5258 19170 51 12270 17250" measure_ref="m_intensity"/>
<FragmentArray values="-0.1551 -0.0943 0.4474 -0.4956 0.4360 0.3466"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="3 5" charge="1">
<FragmentArray values="242.1 454.9 " measure_ref="m_mz"/>
<FragmentArray values="19 64" measure_ref="m_intensity"/>
<FragmentArray values="-0.0135 -0.3249" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="412.4 " measure_ref="m_mz"/>
<FragmentArray values="31" measure_ref="m_intensity"/>
<FragmentArray values="-0.3167" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="3 5 6 9" charge="1">
<FragmentArray values="287.1 500.7 614.4 1082.4 " measure_ref="m_mz"/>
<FragmentArray values="23 143 1403 126" measure_ref="m_intensity"/>
<FragmentArray values="-0.0350 0.4537 0.1107 -0.1589" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="9" charge="2">
<FragmentArray values="542 " measure_ref="m_mz"/>
<FragmentArray values="399" measure_ref="m_intensity"/>
<FragmentArray values="0.2169" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="5 7" charge="2">
<FragmentArray values="242.1 426.4 " measure_ref="m_mz"/>
<FragmentArray values="19 75" measure_ref="m_intensity"/>
<FragmentArray values="-0.0135 -0.3141" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="8 7 6 5 4 3" charge="1">
<FragmentArray values="1056 956.1 842.9 728.8 473.2 359.1 " measure_ref="m_mz"/>
<FragmentArray values="492 2241 4893 1397 1342 28" measure_ref="m_intensity"/>
<FragmentArray values="0.3792 -0.4524 0.3906 0.3335 -0.1082 -0.1653"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="6 2" charge="1">
<FragmentArray values="825.2 242.8 " measure_ref="m_mz"/>
<FragmentArray values="76 417" measure_ref="m_intensity"/>
<FragmentArray values="-0.2829 -0.3703" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="3 7" charge="1">
<FragmentArray values="654.180103 " measure_ref="m_mz"/>
<FragmentArray values="30070" measure_ref="m_intensity"/>
<FragmentArray values="-0.1768" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="3 6" charge="1">
<FragmentArray values="371.127841 " measure_ref="m_mz"/>
<FragmentArray values="1663" measure_ref="m_intensity"/>
<FragmentArray values="-0.0759" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="14.96"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="51.5497194355875"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_9" calculatedMassToCharge="671.8553825" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_9" rank="9"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="6 7 9 10" charge="1">
<FragmentArray values="730 843.6 1056 1169.1 " measure_ref="m_mz"/>
<FragmentArray values="214 194 492 11230" measure_ref="m_intensity"/>
<FragmentArray values="-0.3552 0.1607 0.4810 0.4969" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="5 6 10" charge="2">
<FragmentArray values="315.2 366 584.997427 " measure_ref="m_mz"/>
<FragmentArray values="44 36 39060" measure_ref="m_intensity"/>
<FragmentArray values="0.0426 0.3187 0.1923" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="3" charge="1">
<FragmentArray values="428.2 " measure_ref="m_mz"/>
<FragmentArray values="283" measure_ref="m_intensity"/>
<FragmentArray values="0.0402" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="3" charge="2">
<FragmentArray values="214.8 " measure_ref="m_mz"/>
<FragmentArray values="18" measure_ref="m_intensity"/>
<FragmentArray values="0.2164" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="1 3 4 6 7 10" charge="1">
<FragmentArray values="242.1 473.2 586.2 758.2 871.2 1196.9 " measure_ref="m_mz"/>
<FragmentArray values="19 1342 5258 73560 25390 96" measure_ref="m_intensity"/>
<FragmentArray values="-0.0135 0.0187 -0.0654 -0.1502 -0.2342 0.3020"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="6 7 9 10" charge="2">
<FragmentArray values="380.1 436.4 542 599.1 " measure_ref="m_mz"/>
<FragmentArray values="46 11 399 1504" measure_ref="m_intensity"/>
<FragmentArray values="0.4213 0.1793 -0.2606 0.2974" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="2" charge="1">
<FragmentArray values="353.3 " measure_ref="m_mz"/>
<FragmentArray values="136" measure_ref="m_intensity"/>
<FragmentArray values="0.1544" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="6 7" charge="2">
<FragmentArray values="371.127841 428.2 " measure_ref="m_mz"/>
<FragmentArray values="1663 283" measure_ref="m_intensity"/>
<FragmentArray values="-0.0376 0.4925" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="10 9 7 5 4" charge="1">
<FragmentArray values="1101.262914 973.515686 757.3 584.997427 472.096295 "
measure_ref="m_mz"/>
<FragmentArray values="302 255 182 39060 29390" measure_ref="m_intensity"/>
<FragmentArray values="-0.3343 -0.0230 -0.1454 -0.3632 -0.1803" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10 7" charge="2">
<FragmentArray values="551.3 379.1 " measure_ref="m_mz"/>
<FragmentArray values="800 231" measure_ref="m_intensity"/>
<FragmentArray values="-0.0023 -0.1264" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="9 5 4 2" charge="1">
<FragmentArray values="956.1 568.1 454.9 242.8 " measure_ref="m_mz"/>
<FragmentArray values="2241 5122 64 417" measure_ref="m_intensity"/>
<FragmentArray values="-0.4121 -0.2341 -0.3500 -0.3703" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="371.127841 " measure_ref="m_mz"/>
<FragmentArray values="1663" measure_ref="m_intensity"/>
<FragmentArray values="0.4148" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="3 5 3 7 3 8 4 6 5 7 6 7 7 9 8 10" charge="1">
<FragmentArray values="288.2 502.4 599.1 286.1 286.1 214.8 325.8 325.8 "
measure_ref="m_mz"/>
<FragmentArray values="2137 556 1504 83 83 18 17 17" measure_ref="m_intensity"/>
<FragmentArray values="0.0624 0.1306 -0.2221 -0.0761 -0.0761 -0.3390 -0.3710 -0.3710"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 5 4 7 7 10" charge="1">
<FragmentArray values="388.1 371.127841 410.9 " measure_ref="m_mz"/>
<FragmentArray values="63 1663 22" measure_ref="m_intensity"/>
<FragmentArray values="-0.1013 -0.1374 -0.3602" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="14.47"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="57.7067088182996"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_1_10" calculatedMassToCharge="671.39607" chargeState="2"
experimentalMassToCharge="671.9" peptide_ref="peptide_1_10" rank="10"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 4 5 7 8" charge="1">
<FragmentArray values="288.2 359.1 472.096295 728.8 841.9 " measure_ref="m_mz"/>
<FragmentArray values="2137 28 29390 1397 19170" measure_ref="m_intensity"/>
<FragmentArray values="0.0446 -0.0925 -0.1803 0.3699 0.3858" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="8" charge="2">
<FragmentArray values="412.4 " measure_ref="m_mz"/>
<FragmentArray values="31" measure_ref="m_intensity"/>
<FragmentArray values="-0.3475" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2 4 5 10 11" charge="1">
<FragmentArray values="214.8 387.2 500.7 1055 1167.994665 " measure_ref="m_mz"/>
<FragmentArray values="18 656 143 12270 17250" measure_ref="m_intensity"/>
<FragmentArray values="-0.3026 0.0126 0.4285 0.4109 0.3215" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="6 7" charge="2">
<FragmentArray values="314.2 379.1 " measure_ref="m_mz"/>
<FragmentArray values="1308 231" measure_ref="m_intensity"/>
<FragmentArray values="-0.4869 0.3838" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="8 9" charge="2">
<FragmentArray values="426.4 454.9 " measure_ref="m_mz"/>
<FragmentArray values="75 64" measure_ref="m_intensity"/>
<FragmentArray values="-0.3449 -0.3556" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="8 7 5 4 2" charge="1">
<FragmentArray values="956.1 842.9 586.2 473.2 288.2 " measure_ref="m_mz"/>
<FragmentArray values="2241 4893 5258 1342 2137" measure_ref="m_intensity"/>
<FragmentArray values="0.4953 0.3793 -0.1671 -0.0831 -0.0030" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="11 7" charge="1">
<FragmentArray values="1225.2 825.2 " measure_ref="m_mz"/>
<FragmentArray values="58 76" measure_ref="m_intensity"/>
<FragmentArray values="-0.4899 -0.2941" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="6" charge="2">
<FragmentArray values="349.5 " measure_ref="m_mz"/>
<FragmentArray values="23" measure_ref="m_intensity"/>
<FragmentArray values="0.2968" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 4 3 5 3 7 3 8 5 6 7 8 8 11 10 11" charge="1">
<FragmentArray values="288.2 286.1 542 655 242.1 242.1 412.4 242.1 "
measure_ref="m_mz"/>
<FragmentArray values="2137 83 399 1672 19 19 31 19" measure_ref="m_intensity"/>
<FragmentArray values="0.0810 -0.0761 -0.3297 -0.4137 -0.0863 -0.0499 0.1446 -0.0499"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 6 5 8" charge="1">
<FragmentArray values="501.4 454.9 " measure_ref="m_mz"/>
<FragmentArray values="10430 64" measure_ref="m_intensity"/>
<FragmentArray values="0.0969 -0.4340" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="14.02"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="64.0068280929386"/>
</SpectrumIdentificationItem>
<cvParam accession="MS:1001371" name="Mascot:identity threshold" cvRef="PSI-MS" value="45"/>
<cvParam accession="MS:1001370" name="Mascot:homology threshold" cvRef="PSI-MS" value="39"/>
<cvParam accession="MS:1001030" name="number of peptide seqs compared to each spectrum"
cvRef="PSI-MS" value="32304"/>
<cvParam accession="MS:1000796" name="spectrum title" cvRef="PSI-MS"
value="dp210198c 21-Jan-98 DERIVED SPECTRUM #9"/>
</SpectrumIdentificationResult>
<SpectrumIdentificationResult id="SIR_2" spectrumID="query=2" spectraData_ref="SD_1">
<SpectrumIdentificationItem id="SII_2_1" calculatedMassToCharge="807.885938" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_1" rank="1"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70A_BOVIN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70A_MOUSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70B_BOSMU_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70B_BOVIN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70B_MOUSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70B_PIG_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70L_HUMAN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70L_MOUSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HS70L_RAT_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP70_BRUMA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP70_CHICK_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP70_ECHGR_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP70_HYDMA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP70_ONCTS_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP70_PLEWA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP70_XENLA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP71_CANFA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP71_CERAE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP71_HUMAN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP71_ORYLA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP71_RAT_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP72_HUMAN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP72_MOUSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP72_PARLI_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP72_RAT_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP73_BOVIN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP76_HUMAN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP76_PIG_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP76_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP77_HUMAN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7A_CAEEL_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_BOVIN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_BRARE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_CRIGR_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_HUMAN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_MOUSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_ORYLA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_PONPY_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_RAT_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="2 3" charge="1">
<FragmentArray values="302.1 398.9 " measure_ref="m_mz"/>
<FragmentArray values="11 10" measure_ref="m_intensity"/>
<FragmentArray values="-0.0710 -0.3238" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="1 2 4 5 6 7 9 10 11" charge="1">
<FragmentArray values="229.3 329.9 514.2 677 776.2 847 1095.1 1210.147832 1311.941758 "
measure_ref="m_mz"/>
<FragmentArray values="8 2053 125 1635 12720 6381 488 738 91"
measure_ref="m_intensity"/>
<FragmentArray
values="0.1817 -0.2660 -0.0508 -0.3141 -0.1825 -0.4196 -0.4357 -0.4148 0.3314"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="12 11 10 9 8 7 6 5 4 3 2" charge="1">
<FragmentArray
values="1386.3 1285.3 1188.3 1101.6 938.154605 839.195244 768.2 621.3 520.23394 405 304.3 "
measure_ref="m_mz"/>
<FragmentArray values="186 11250 128 165 3681 9126 4104 2611 934 200 9"
measure_ref="m_intensity"/>
<FragmentArray
values="-0.3536 -0.3059 -0.2531 0.0789 -0.3032 -0.1941 -0.1523 0.0162 -0.0022 -0.2092 0.1385"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="12 11" charge="2">
<FragmentArray values="693.9 643.337386 " measure_ref="m_mz"/>
<FragmentArray values="1666 3191" measure_ref="m_intensity"/>
<FragmentArray values="0.0696 0.0308" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="11" charge="1">
<FragmentArray values="1268.7 " measure_ref="m_mz"/>
<FragmentArray values="47" measure_ref="m_intensity"/>
<FragmentArray values="0.1206" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="6" charge="2">
<FragmentArray values="376.1 " measure_ref="m_mz"/>
<FragmentArray values="10" measure_ref="m_intensity"/>
<FragmentArray values="-0.0665" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 4 3 6 4 7 9 12" charge="1">
<FragmentArray values="286 447 421.3 447 " measure_ref="m_mz"/>
<FragmentArray values="32 39 11 39" measure_ref="m_intensity"/>
<FragmentArray values="-0.1397 -0.2238 0.0918 -0.1722" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 5 2 6 4 7 8 12" charge="1">
<FragmentArray values="421.3 520.23394 393.1 565.9 " measure_ref="m_mz"/>
<FragmentArray values="11 934 14 30" measure_ref="m_intensity"/>
<FragmentArray values="0.0918 -0.0426 -0.1132 -0.3457" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="40.95"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="0.107475636472937"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_2" calculatedMassToCharge="807.8859305" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_2" rank="2"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_2_HSP7A_DROME_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_2_HSP7A_DROSI_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="2 3" charge="1">
<FragmentArray values="302.1 398.9 " measure_ref="m_mz"/>
<FragmentArray values="11 10" measure_ref="m_intensity"/>
<FragmentArray values="-0.0710 -0.3238" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="1 2 4 5 6 7 9 11" charge="1">
<FragmentArray values="229.3 329.9 514.2 677 776.2 847 1095.1 1311.941758 "
measure_ref="m_mz"/>
<FragmentArray values="8 2053 125 1635 12720 6381 488 91" measure_ref="m_intensity"/>
<FragmentArray values="0.1817 -0.2660 -0.0508 -0.3141 -0.1825 -0.4196 -0.4357 0.3314"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="12 11 10 9 8 7 6 5 4 2" charge="1">
<FragmentArray
values="1386.3 1285.3 1188.3 1101.6 938.154605 839.195244 768.2 621.3 520.23394 304.3 "
measure_ref="m_mz"/>
<FragmentArray values="186 11250 128 165 3681 9126 4104 2611 934 9"
measure_ref="m_intensity"/>
<FragmentArray
values="-0.3536 -0.3059 -0.2531 0.0789 -0.3032 -0.1941 -0.1523 0.0162 -0.0022 0.1385"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="12 11" charge="2">
<FragmentArray values="693.9 643.337386 " measure_ref="m_mz"/>
<FragmentArray values="1666 3191" measure_ref="m_intensity"/>
<FragmentArray values="0.0696 0.0308" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="11" charge="1">
<FragmentArray values="1268.7 " measure_ref="m_mz"/>
<FragmentArray values="47" measure_ref="m_intensity"/>
<FragmentArray values="0.1206" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="6" charge="2">
<FragmentArray values="376.1 " measure_ref="m_mz"/>
<FragmentArray values="10" measure_ref="m_intensity"/>
<FragmentArray values="-0.0665" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 4 3 6 4 7 9 12" charge="1">
<FragmentArray values="286 447 421.3 447 " measure_ref="m_mz"/>
<FragmentArray values="32 39 11 39" measure_ref="m_intensity"/>
<FragmentArray values="-0.1397 -0.2238 0.0918 -0.1722" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 5 2 6 4 7 6 10 7 10 8 12" charge="1">
<FragmentArray values="421.3 520.23394 393.1 520.23394 421.3 565.9 "
measure_ref="m_mz"/>
<FragmentArray values="11 934 14 934 11 30" measure_ref="m_intensity"/>
<FragmentArray values="0.0918 -0.0426 -0.1132 -0.0426 0.0918 -0.3457"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="28.76"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="1.77954930676659"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_3" calculatedMassToCharge="808.3759055" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_3" rank="3"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="2 12" charge="1">
<FragmentArray values="329.9 1441.3 " measure_ref="m_mz"/>
<FragmentArray values="2053 179" measure_ref="m_intensity"/>
<FragmentArray values="-0.2660 -0.3441" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="9" charge="2">
<FragmentArray values="520.23394 " measure_ref="m_mz"/>
<FragmentArray values="934" measure_ref="m_intensity"/>
<FragmentArray values="0.4934" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="1" charge="1">
<FragmentArray values="229.3 " measure_ref="m_mz"/>
<FragmentArray values="8" measure_ref="m_intensity"/>
<FragmentArray values="0.1817" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="12" charge="1">
<FragmentArray values="1452.6 " measure_ref="m_mz"/>
<FragmentArray values="40" measure_ref="m_intensity"/>
<FragmentArray values="-0.0125" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="5 7" charge="2">
<FragmentArray values="312.2 405 " measure_ref="m_mz"/>
<FragmentArray values="489 200" measure_ref="m_intensity"/>
<FragmentArray values="0.0628 -0.1692" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="12 10 7 6 3" charge="1">
<FragmentArray values="1387.3 1144.9 847 790 405 " measure_ref="m_mz"/>
<FragmentArray values="188 27 6381 25250 200" measure_ref="m_intensity"/>
<FragmentArray values="-0.3336 0.3519 -0.4156 -0.3941 -0.1980" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="12 5" charge="2">
<FragmentArray values="693.9 331.2 " measure_ref="m_mz"/>
<FragmentArray values="1666 82" measure_ref="m_intensity"/>
<FragmentArray values="-0.4204 -0.4532" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="9" charge="1">
<FragmentArray values="1030.2 " measure_ref="m_mz"/>
<FragmentArray values="45" measure_ref="m_intensity"/>
<FragmentArray values="-0.2687" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="11" charge="2">
<FragmentArray values="621.3 " measure_ref="m_mz"/>
<FragmentArray values="2611" measure_ref="m_intensity"/>
<FragmentArray values="0.0141" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="5 9 5 10 8 11 8 12" charge="1">
<FragmentArray values="514.9 643.337386 514.9 644.2 " measure_ref="m_mz"/>
<FragmentArray values="15 3191 15 194" measure_ref="m_intensity"/>
<FragmentArray values="-0.3460 0.0328 -0.3460 -0.0886" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 4 5 7 6 10 7 11 8 9 9 10 10 11" charge="1">
<FragmentArray values="313.1 230.3 544 544 230.3 230.3 230.3 " measure_ref="m_mz"/>
<FragmentArray values="29 9 19 19 9 9 9" measure_ref="m_intensity"/>
<FragmentArray values="-0.0506 0.1865 -0.2726 -0.2726 0.1501 0.1865 0.1865"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="8.55"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="186.771250133037"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_4" calculatedMassToCharge="808.3945595" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_4" rank="4"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="7 9 12" charge="1">
<FragmentArray values="798.9 938.154605 1285.3 " measure_ref="m_mz"/>
<FragmentArray values="25530 3681 11250" measure_ref="m_intensity"/>
<FragmentArray values="0.4644 -0.3396 -0.3787" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="10 12" charge="2">
<FragmentArray values="520.23394 643.337386 " measure_ref="m_mz"/>
<FragmentArray values="934 3191" measure_ref="m_intensity"/>
<FragmentArray values="-0.0406 -0.0056" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="5 6 12" charge="1">
<FragmentArray values="565.1 693.9 1268.7 " measure_ref="m_mz"/>
<FragmentArray values="86 1666 47" measure_ref="m_intensity"/>
<FragmentArray values="-0.2344 -0.4770 0.0479" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="3" charge="1">
<FragmentArray values="452 " measure_ref="m_mz"/>
<FragmentArray values="19" measure_ref="m_intensity"/>
<FragmentArray values="-0.2867" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="405 " measure_ref="m_mz"/>
<FragmentArray values="200" measure_ref="m_intensity"/>
<FragmentArray values="-0.2056" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="9 3" charge="1">
<FragmentArray values="935.3 421.3 " measure_ref="m_mz"/>
<FragmentArray values="264 11" measure_ref="m_intensity"/>
<FragmentArray values="-0.1581 0.0442" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10 6" charge="2">
<FragmentArray values="518.9 331.2 " measure_ref="m_mz"/>
<FragmentArray values="22 82" measure_ref="m_intensity"/>
<FragmentArray values="0.1435 -0.4847" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="3 4 3 9 4 9 5 8 5 10 9 11" charge="1">
<FragmentArray values="230.3 643.337386 514.9 331.2 514.9 284.2 " measure_ref="m_mz"/>
<FragmentArray values="9 3191 15 82 15 9" measure_ref="m_intensity"/>
<FragmentArray values="0.1501 0.0328 -0.3096 0.0752 -0.3096 0.0395"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 6 6 12 8 11" charge="1">
<FragmentArray values="501 676.7 313.1 " measure_ref="m_mz"/>
<FragmentArray values="17 124 29" measure_ref="m_intensity"/>
<FragmentArray values="-0.3031 0.3699 -0.0870" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="8.05"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="209.560789382315"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_5" calculatedMassToCharge="808.3945595" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_5" rank="5"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="7 9 12" charge="1">
<FragmentArray values="798.9 938.154605 1285.3 " measure_ref="m_mz"/>
<FragmentArray values="25530 3681 11250" measure_ref="m_intensity"/>
<FragmentArray values="0.4644 -0.3396 -0.3787" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="10 12" charge="2">
<FragmentArray values="520.23394 643.337386 " measure_ref="m_mz"/>
<FragmentArray values="934 3191" measure_ref="m_intensity"/>
<FragmentArray values="-0.0406 -0.0056" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="5 6 12" charge="1">
<FragmentArray values="565.1 693.9 1268.7 " measure_ref="m_mz"/>
<FragmentArray values="86 1666 47" measure_ref="m_intensity"/>
<FragmentArray values="-0.2344 -0.4770 0.0479" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="3" charge="1">
<FragmentArray values="452 " measure_ref="m_mz"/>
<FragmentArray values="19" measure_ref="m_intensity"/>
<FragmentArray values="-0.2867" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="405 " measure_ref="m_mz"/>
<FragmentArray values="200" measure_ref="m_intensity"/>
<FragmentArray values="-0.2056" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="9 3" charge="1">
<FragmentArray values="935.3 421.3 " measure_ref="m_mz"/>
<FragmentArray values="264 11" measure_ref="m_intensity"/>
<FragmentArray values="-0.1581 0.0442" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10 6" charge="2">
<FragmentArray values="518.9 331.2 " measure_ref="m_mz"/>
<FragmentArray values="22 82" measure_ref="m_intensity"/>
<FragmentArray values="0.1435 -0.4847" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="12" charge="1">
<FragmentArray values="1387.3 " measure_ref="m_mz"/>
<FragmentArray values="188" measure_ref="m_intensity"/>
<FragmentArray values="-0.4216" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="12" charge="2">
<FragmentArray values="693.9 " measure_ref="m_mz"/>
<FragmentArray values="1666" measure_ref="m_intensity"/>
<FragmentArray values="-0.4644" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="4 9 5 8 5 10 9 11" charge="1">
<FragmentArray values="514.9 331.2 514.9 284.2 " measure_ref="m_mz"/>
<FragmentArray values="15 82 15 9" measure_ref="m_intensity"/>
<FragmentArray values="-0.3096 0.0752 -0.3096 0.0395" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="3 6 3 8 6 12 8 11" charge="1">
<FragmentArray values="514.9 659.1 676.7 313.1 " measure_ref="m_mz"/>
<FragmentArray values="15 1952 124 29" measure_ref="m_intensity"/>
<FragmentArray values="-0.3824 -0.2359 0.3699 -0.0870" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="8.05"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="209.560789382315"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_6" calculatedMassToCharge="808.4034325" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_6" rank="6"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="8 11 14" charge="1">
<FragmentArray values="839.195244 1094.8 1441.3 " measure_ref="m_mz"/>
<FragmentArray values="9126 701 179" measure_ref="m_intensity"/>
<FragmentArray values="-0.2305 0.2523 -0.3992" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="6 12 13" charge="2">
<FragmentArray values="312.2 621.3 678.016479 " measure_ref="m_mz"/>
<FragmentArray values="489 2611 267" measure_ref="m_intensity"/>
<FragmentArray values="0.0208 0.0048 0.1793" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="11" charge="1">
<FragmentArray values="1077.1 " measure_ref="m_mz"/>
<FragmentArray values="45" measure_ref="m_intensity"/>
<FragmentArray values="-0.4211" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2" charge="1">
<FragmentArray values="313.1 " measure_ref="m_mz"/>
<FragmentArray values="29" measure_ref="m_intensity"/>
<FragmentArray values="-0.0870" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 14" charge="1">
<FragmentArray values="393.1 1452.6 " measure_ref="m_mz"/>
<FragmentArray values="14 40" measure_ref="m_intensity"/>
<FragmentArray values="-0.1132 -0.0675" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="5" charge="1">
<FragmentArray values="565.1 " measure_ref="m_mz"/>
<FragmentArray values="86" measure_ref="m_intensity"/>
<FragmentArray values="-0.2014" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="13 8 3" charge="1">
<FragmentArray values="1286.3 847 329.9 " measure_ref="m_mz"/>
<FragmentArray values="4207 6381 2053" measure_ref="m_intensity"/>
<FragmentArray values="-0.2933 -0.3866 -0.3023" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="13" charge="2">
<FragmentArray values="643.337386 " measure_ref="m_mz"/>
<FragmentArray values="3191" measure_ref="m_intensity"/>
<FragmentArray values="-0.4629" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="5 7 6 8 7 9 9 14 11 13" charge="1">
<FragmentArray values="286 314.1 314.1 603.2 332 " measure_ref="m_mz"/>
<FragmentArray values="32 17 17 19 14" measure_ref="m_intensity"/>
<FragmentArray values="-0.1397 -0.0347 -0.0347 -0.0807 -0.1639" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="6 8 6 9 7 9 8 13 11 13" charge="1">
<FragmentArray values="286 383.2 286 603.2 304.3 " measure_ref="m_mz"/>
<FragmentArray values="32 10 32 19 9" measure_ref="m_intensity"/>
<FragmentArray values="-0.1397 0.0075 -0.1397 -0.0807 0.1311" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="7.69"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="227.672211290367"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_7" calculatedMassToCharge="808.4034325" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_7" rank="7"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="8 11 14" charge="1">
<FragmentArray values="839.195244 1094.8 1441.3 " measure_ref="m_mz"/>
<FragmentArray values="9126 701 179" measure_ref="m_intensity"/>
<FragmentArray values="-0.2305 0.2523 -0.3992" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="6 12 13" charge="2">
<FragmentArray values="312.2 621.3 678.016479 " measure_ref="m_mz"/>
<FragmentArray values="489 2611 267" measure_ref="m_intensity"/>
<FragmentArray values="0.0208 0.0048 0.1793" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="11" charge="1">
<FragmentArray values="1077.1 " measure_ref="m_mz"/>
<FragmentArray values="45" measure_ref="m_intensity"/>
<FragmentArray values="-0.4211" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2" charge="1">
<FragmentArray values="313.1 " measure_ref="m_mz"/>
<FragmentArray values="29" measure_ref="m_intensity"/>
<FragmentArray values="-0.0870" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 14" charge="1">
<FragmentArray values="393.1 1452.6 " measure_ref="m_mz"/>
<FragmentArray values="14 40" measure_ref="m_intensity"/>
<FragmentArray values="-0.1132 -0.0675" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="5" charge="1">
<FragmentArray values="565.1 " measure_ref="m_mz"/>
<FragmentArray values="86" measure_ref="m_intensity"/>
<FragmentArray values="-0.2014" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="13 8 3" charge="1">
<FragmentArray values="1286.3 847 329.9 " measure_ref="m_mz"/>
<FragmentArray values="4207 6381 2053" measure_ref="m_intensity"/>
<FragmentArray values="-0.2933 -0.3866 -0.3023" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="13" charge="2">
<FragmentArray values="643.337386 " measure_ref="m_mz"/>
<FragmentArray values="3191" measure_ref="m_intensity"/>
<FragmentArray values="-0.4629" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="5 7 6 8 7 9 9 14 11 13" charge="1">
<FragmentArray values="286 314.1 314.1 603.2 332 " measure_ref="m_mz"/>
<FragmentArray values="32 17 17 19 14" measure_ref="m_intensity"/>
<FragmentArray values="-0.1397 -0.0347 -0.0347 -0.0807 -0.1639" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="6 8 6 9 7 9 8 13 11 13" charge="1">
<FragmentArray values="286 383.2 286 603.2 304.3 " measure_ref="m_mz"/>
<FragmentArray values="32 10 32 19 9" measure_ref="m_intensity"/>
<FragmentArray values="-0.1397 0.0075 -0.1397 -0.0807 0.1311" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="7.69"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="227.672211290367"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_8" calculatedMassToCharge="807.927938" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_8" rank="8"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 10" charge="1">
<FragmentArray values="398.9 1170.1 " measure_ref="m_mz"/>
<FragmentArray values="10 28" measure_ref="m_intensity"/>
<FragmentArray values="-0.3602 0.4687" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="5 6 11" charge="1">
<FragmentArray values="677 840.2 1284.7 " measure_ref="m_mz"/>
<FragmentArray values="1635 1926 137" measure_ref="m_intensity"/>
<FragmentArray values="-0.3981 -0.2614 0.0417" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="13" charge="1">
<FragmentArray values="1451.5 " measure_ref="m_mz"/>
<FragmentArray values="103" measure_ref="m_intensity"/>
<FragmentArray values="-0.2165" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="12" charge="2">
<FragmentArray values="678.016479 " measure_ref="m_mz"/>
<FragmentArray values="267" measure_ref="m_intensity"/>
<FragmentArray values="0.1810" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="13 12 11 9 3" charge="1">
<FragmentArray values="1389 1287.3 1188.3 938.154605 331.2 " measure_ref="m_mz"/>
<FragmentArray values="52 419 128 3681 82" measure_ref="m_intensity"/>
<FragmentArray values="0.2831 -0.3692 -0.3008 -0.3032 0.0024" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="13 12" charge="2">
<FragmentArray values="694.831325 644.2 " measure_ref="m_mz"/>
<FragmentArray values="166 194" measure_ref="m_intensity"/>
<FragmentArray values="-0.0307 -0.1382" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="3" charge="1">
<FragmentArray values="314.1 " measure_ref="m_mz"/>
<FragmentArray values="17" measure_ref="m_intensity"/>
<FragmentArray values="-0.0710" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 4 4 7 5 9 6 10 6 11 6 12" charge="1">
<FragmentArray values="314.1 501 559 521.4 608.2 694.831325 " measure_ref="m_mz"/>
<FragmentArray values="17 17 13 40 12 166" measure_ref="m_intensity"/>
<FragmentArray values="-0.1074 -0.2456 -0.2259 0.1646 -0.0675 -0.4682"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 4 4 9 7 10 8 11 8 13" charge="1">
<FragmentArray values="286 644.2 329.9 329.9 514.2 " measure_ref="m_mz"/>
<FragmentArray values="32 194 2053 2053 125" measure_ref="m_intensity"/>
<FragmentArray values="-0.2125 -0.1151 -0.2772 -0.2772 -0.0620" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="6.11"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="327.574453912944"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_9" calculatedMassToCharge="807.8794075" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_9" rank="9"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="9" charge="2">
<FragmentArray values="514.2 " measure_ref="m_mz"/>
<FragmentArray values="125" measure_ref="m_intensity"/>
<FragmentArray values="-0.0607" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="10" charge="1">
<FragmentArray values="1097.1 " measure_ref="m_mz"/>
<FragmentArray values="66" measure_ref="m_intensity"/>
<FragmentArray values="-0.4197" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="5 7" charge="2">
<FragmentArray values="284.2 376.1 " measure_ref="m_mz"/>
<FragmentArray values="9 10" measure_ref="m_intensity"/>
<FragmentArray values="-0.4185 0.4288" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="4" charge="2">
<FragmentArray values="229.3 " measure_ref="m_mz"/>
<FragmentArray values="8" measure_ref="m_intensity"/>
<FragmentArray values="0.2214" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="6 11" charge="1">
<FragmentArray values="694.831325 1212.1 " measure_ref="m_mz"/>
<FragmentArray values="166 29" measure_ref="m_intensity"/>
<FragmentArray values="-0.4616 -0.4466" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="9" charge="2">
<FragmentArray values="520.23394 " measure_ref="m_mz"/>
<FragmentArray values="934" measure_ref="m_intensity"/>
<FragmentArray values="0.4890" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="11 9 8 7 5 4" charge="1">
<FragmentArray values="1310.7 1094.8 938.154605 839.195244 643.337386 496.1 "
measure_ref="m_mz"/>
<FragmentArray values="95 701 3681 9126 3191 75" measure_ref="m_intensity"/>
<FragmentArray values="0.0148 0.1895 -0.3548 -0.2458 0.0176 -0.1514"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="9" charge="1">
<FragmentArray values="1077.1 " measure_ref="m_mz"/>
<FragmentArray values="45" measure_ref="m_intensity"/>
<FragmentArray values="-0.4840" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="5" charge="2">
<FragmentArray values="314.1 " measure_ref="m_mz"/>
<FragmentArray values="17" measure_ref="m_intensity"/>
<FragmentArray values="0.4497" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="5 8" charge="1">
<FragmentArray values="452 " measure_ref="m_mz"/>
<FragmentArray values="19" measure_ref="m_intensity"/>
<FragmentArray values="-0.2980" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="6"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="335.977369646564"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_2_10" calculatedMassToCharge="808.400495" chargeState="2"
experimentalMassToCharge="808.3" peptide_ref="peptide_2_10" rank="10"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="12" charge="1">
<FragmentArray values="1441.3 " measure_ref="m_mz"/>
<FragmentArray values="179" measure_ref="m_intensity"/>
<FragmentArray values="-0.3933" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="11" charge="1">
<FragmentArray values="1311.941758 " measure_ref="m_mz"/>
<FragmentArray values="91" measure_ref="m_intensity"/>
<FragmentArray values="0.3591" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="1 2 6 9 10" charge="1">
<FragmentArray values="229.3 376.1 790 1188.3 1285.3 " measure_ref="m_mz"/>
<FragmentArray values="8 10 25250 128 11250" measure_ref="m_intensity"/>
<FragmentArray values="0.1817 -0.0867 -0.3440 -0.2143 -0.2670" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="10" charge="2">
<FragmentArray values="643.337386 " measure_ref="m_mz"/>
<FragmentArray values="3191" measure_ref="m_intensity"/>
<FragmentArray values="0.0502" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="10 12" charge="1">
<FragmentArray values="1268.7 1452.6 " measure_ref="m_mz"/>
<FragmentArray values="47 40" measure_ref="m_intensity"/>
<FragmentArray values="0.1595 -0.0616" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="12 5 3" charge="1">
<FragmentArray values="1387.3 565.1 331.2 " measure_ref="m_mz"/>
<FragmentArray values="188 86 82" measure_ref="m_intensity"/>
<FragmentArray values="-0.3827 -0.2457 -0.0340" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="12 11 9" charge="2">
<FragmentArray values="693.9 621.3 514.9 " measure_ref="m_mz"/>
<FragmentArray values="1666 2611 15" measure_ref="m_intensity"/>
<FragmentArray values="-0.4450 0.4892 0.1291" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="3" charge="1">
<FragmentArray values="314.1 " measure_ref="m_mz"/>
<FragmentArray values="17" measure_ref="m_intensity"/>
<FragmentArray values="-0.1074" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="7 6" charge="2">
<FragmentArray values="405 331.2 " measure_ref="m_mz"/>
<FragmentArray values="200 82" measure_ref="m_intensity"/>
<FragmentArray values="-0.2189 -0.4847" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="3 8 4 5 4 7 7 9 7 10" charge="1">
<FragmentArray values="676.7 229.3 447 398.9 496.1 " measure_ref="m_mz"/>
<FragmentArray values="124 8 39 10 75" measure_ref="m_intensity"/>
<FragmentArray values="0.4241 0.1995 -0.2061 -0.2775 -0.1303" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 4" charge="1">
<FragmentArray values="332 " measure_ref="m_mz"/>
<FragmentArray values="14" measure_ref="m_intensity"/>
<FragmentArray values="-0.1605" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="5.3"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="394.738990112762"/>
</SpectrumIdentificationItem>
<cvParam accession="MS:1001371" name="Mascot:identity threshold" cvRef="PSI-MS" value="44"/>
<cvParam accession="MS:1001030" name="number of peptide seqs compared to each spectrum"
cvRef="PSI-MS" value="26751"/>
<cvParam accession="MS:1000796" name="spectrum title" cvRef="PSI-MS"
value="dp210198b 21-Jan-98 DERIVED SPECTRUM #9"/>
</SpectrumIdentificationResult>
<SpectrumIdentificationResult id="SIR_3" spectrumID="query=3" spectraData_ref="SD_1">
<SpectrumIdentificationItem id="SII_3_1" calculatedMassToCharge="973.9674505" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_1" rank="1"
passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="PE_3_1_HSP7A_DROME_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_3_1_HSP7A_DROSI_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_3_1_HSP7D_MANSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3" charge="1">
<FragmentArray values="440.8 " measure_ref="m_mz"/>
<FragmentArray values="21" measure_ref="m_intensity"/>
<FragmentArray values="-0.4456" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7 8" charge="1">
<FragmentArray values="853.2 967.6 " measure_ref="m_mz"/>
<FragmentArray values="669 219" measure_ref="m_intensity"/>
<FragmentArray values="-0.1873 0.1698" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2 3 4 5 6 9 10 11 12 13 14" charge="1">
<FragmentArray
values="370.2 469.07424 540.2 687.1 801.07892 1126.4 1227.925714 1341.05302 1488.1 1603.151795 1673.3 "
measure_ref="m_mz"/>
<FragmentArray values="128 1184 556 3179 6442 159 35 149 108 1170 1007"
measure_ref="m_intensity"/>
<FragmentArray
values="0.0279 -0.1663 -0.0776 -0.2130 -0.2770 -0.0946 0.3835 0.4267 0.4053 0.4301 -0.4588"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="11 13 14" charge="2">
<FragmentArray values="671.1 802.1 837.2 " measure_ref="m_mz"/>
<FragmentArray values="26 363 43" measure_ref="m_intensity"/>
<FragmentArray values="0.2832 0.2355 -0.1830" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 6 11 13 14" charge="1">
<FragmentArray values="452.2 783.9 1323.1 1585.4 1656.7 " measure_ref="m_mz"/>
<FragmentArray values="5 23 59 18 19" measure_ref="m_intensity"/>
<FragmentArray values="-0.0140 -0.4294 -0.4998 -0.2951 -0.0322" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="7 9" charge="2">
<FragmentArray values="440.8 555.7 " measure_ref="m_mz"/>
<FragmentArray values="21 6" measure_ref="m_intensity"/>
<FragmentArray values="-0.3947 0.4623" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="13 12 11 10 9 6 5 4 3 2" charge="1">
<FragmentArray
values="1577.3 1479.112649 1407.3 1260.2 1146.095295 821.064 720 607.2 460.2 345.1 "
measure_ref="m_mz"/>
<FragmentArray values="188 672 1063 3411 6801 150 55 979 108 237"
measure_ref="m_intensity"/>
<FragmentArray
values="-0.4628 0.4182 -0.3573 -0.4219 -0.4837 -0.3763 -0.3927 -0.1086 -0.0402 -0.1132"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="14" charge="2">
<FragmentArray values="853.2 " measure_ref="m_mz"/>
<FragmentArray values="669" measure_ref="m_intensity"/>
<FragmentArray values="-0.2143" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="460.2 " measure_ref="m_mz"/>
<FragmentArray values="108" measure_ref="m_intensity"/>
<FragmentArray values="0.4680" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 6 5 10 7 11 7 12" charge="1">
<FragmentArray values="560.3 688.1 540.2 687.1 " measure_ref="m_mz"/>
<FragmentArray values="9 152 556 3179" measure_ref="m_intensity"/>
<FragmentArray values="0.0503 -0.1719 -0.0776 -0.2461" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="5 8 5 10 6 8 7 9" charge="1">
<FragmentArray values="444.7 660.2 297.9 297.9 " measure_ref="m_mz"/>
<FragmentArray values="10 19 10 10" measure_ref="m_intensity"/>
<FragmentArray values="-0.4864 -0.0770 -0.2510 -0.2510" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="45.5"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="0.0432804974839626"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_2" calculatedMassToCharge="973.967458" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_2" rank="2"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_3_2_HS70L_HUMAN_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_3_2_HS70L_MOUSE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_3_2_HS70L_RAT_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_3_2_HSP70_XENLA_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 9" charge="1">
<FragmentArray values="440.8 1112.5 " measure_ref="m_mz"/>
<FragmentArray values="21 61" measure_ref="m_intensity"/>
<FragmentArray values="-0.4456 -0.0153" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="10" charge="2">
<FragmentArray values="607.2 " measure_ref="m_mz"/>
<FragmentArray values="979" measure_ref="m_intensity"/>
<FragmentArray values="-0.0851" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7" charge="1">
<FragmentArray values="853.2 " measure_ref="m_mz"/>
<FragmentArray values="669" measure_ref="m_intensity"/>
<FragmentArray values="-0.1873" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2 3 4 5 6 10 11 12 13 14" charge="1">
<FragmentArray
values="370.2 469.07424 540.2 687.1 801.07892 1241.230769 1341.05302 1488.1 1603.151795 1673.3 "
measure_ref="m_mz"/>
<FragmentArray values="128 1184 556 3179 6442 26 149 108 1170 1007"
measure_ref="m_intensity"/>
<FragmentArray
values="0.0279 -0.1663 -0.0776 -0.2130 -0.2770 -0.3271 0.4267 0.4053 0.4301 -0.4588"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="11 13 14" charge="2">
<FragmentArray values="671.1 802.1 837.2 " measure_ref="m_mz"/>
<FragmentArray values="26 363 43" measure_ref="m_intensity"/>
<FragmentArray values="0.2832 0.2355 -0.1830" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 6 11 13 14" charge="1">
<FragmentArray values="452.2 783.9 1323.1 1585.4 1656.7 " measure_ref="m_mz"/>
<FragmentArray values="5 23 59 18 19" measure_ref="m_intensity"/>
<FragmentArray values="-0.0140 -0.4294 -0.4998 -0.2951 -0.0322" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="440.8 " measure_ref="m_mz"/>
<FragmentArray values="21" measure_ref="m_intensity"/>
<FragmentArray values="-0.3947" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="13 12 11 10 9 5 4 3 2" charge="1">
<FragmentArray
values="1577.3 1479.112649 1407.3 1260.2 1146.095295 706.8 607.2 460.2 345.1 "
measure_ref="m_mz"/>
<FragmentArray values="188 672 1063 3411 6801 19 979 108 237"
measure_ref="m_intensity"/>
<FragmentArray
values="-0.4628 0.4182 -0.3573 -0.4219 -0.4837 0.4230 -0.1086 -0.0402 -0.1132"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="14" charge="2">
<FragmentArray values="853.2 " measure_ref="m_mz"/>
<FragmentArray values="669" measure_ref="m_intensity"/>
<FragmentArray values="-0.2143" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="5" charge="2">
<FragmentArray values="345.1 " measure_ref="m_mz"/>
<FragmentArray values="237" measure_ref="m_intensity"/>
<FragmentArray values="-0.0789" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 6 6 10 7 10 7 11 7 12" charge="1">
<FragmentArray values="560.3 555.7 440.8 540.2 687.1 " measure_ref="m_mz"/>
<FragmentArray values="9 6 21 556 3179" measure_ref="m_intensity"/>
<FragmentArray values="0.0503 0.4478 -0.4092 -0.0776 -0.2461" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="30.95"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="1.23393488953434"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_3" calculatedMassToCharge="973.9856465" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_3" rank="3"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 9" charge="1">
<FragmentArray values="440.8 1112.5 " measure_ref="m_mz"/>
<FragmentArray values="21 61" measure_ref="m_intensity"/>
<FragmentArray values="-0.4456 -0.0517" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="10" charge="2">
<FragmentArray values="607.2 " measure_ref="m_mz"/>
<FragmentArray values="979" measure_ref="m_intensity"/>
<FragmentArray values="-0.1033" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7" charge="1">
<FragmentArray values="853.2 " measure_ref="m_mz"/>
<FragmentArray values="669" measure_ref="m_intensity"/>
<FragmentArray values="-0.1873" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2 3 4 5 6 10 11 12 13 14" charge="1">
<FragmentArray
values="370.2 469.07424 540.2 687.1 801.07892 1241.230769 1341.05302 1488.1 1603.151795 1673.3 "
measure_ref="m_mz"/>
<FragmentArray values="128 1184 556 3179 6442 26 149 108 1170 1007"
measure_ref="m_intensity"/>
<FragmentArray
values="0.0279 -0.1663 -0.0776 -0.2130 -0.2770 -0.3635 0.3903 0.3689 0.3937 -0.4952"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="11 13 14" charge="2">
<FragmentArray values="671.1 802.1 837.2 " measure_ref="m_mz"/>
<FragmentArray values="26 363 43" measure_ref="m_intensity"/>
<FragmentArray values="0.2650 0.2173 -0.2012" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 6 13 14" charge="1">
<FragmentArray values="452.2 783.9 1585.4 1656.7 " measure_ref="m_mz"/>
<FragmentArray values="5 23 18 19" measure_ref="m_intensity"/>
<FragmentArray values="-0.0140 -0.4294 -0.3315 -0.0686" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="7" charge="2">
<FragmentArray values="440.8 " measure_ref="m_mz"/>
<FragmentArray values="21" measure_ref="m_intensity"/>
<FragmentArray values="-0.3947" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="13 12 11 10 5 4 3 2" charge="1">
<FragmentArray values="1577.3 1479.112649 1407.3 1260.2 706.8 607.2 460.2 345.1 "
measure_ref="m_mz"/>
<FragmentArray values="188 672 1063 3411 19 979 108 237" measure_ref="m_intensity"/>
<FragmentArray values="-0.4992 0.3819 -0.3937 -0.4583 0.4230 -0.1086 -0.0402 -0.1132"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="14" charge="2">
<FragmentArray values="853.2 " measure_ref="m_mz"/>
<FragmentArray values="669" measure_ref="m_intensity"/>
<FragmentArray values="-0.2325" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10" charge="1">
<FragmentArray values="1244.1 " measure_ref="m_mz"/>
<FragmentArray values="30" measure_ref="m_intensity"/>
<FragmentArray values="0.4683" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="5" charge="2">
<FragmentArray values="345.1 " measure_ref="m_mz"/>
<FragmentArray values="237" measure_ref="m_intensity"/>
<FragmentArray values="-0.0789" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 6 6 10 7 10 7 11 7 12" charge="1">
<FragmentArray values="560.3 555.7 440.8 540.2 687.1 " measure_ref="m_mz"/>
<FragmentArray values="9 6 21 556 3179" measure_ref="m_intensity"/>
<FragmentArray values="0.0503 0.4115 -0.4456 -0.1140 -0.2824" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="25.64"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="4.19075473216917"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_4" calculatedMassToCharge="974.4776585" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_4" rank="4"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_3_4_HSP7D_DROME_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 8 12" charge="1">
<FragmentArray values="440.8 971.9 1461.1 " measure_ref="m_mz"/>
<FragmentArray values="21 16170 30" measure_ref="m_intensity"/>
<FragmentArray values="-0.4456 0.4385 0.3798" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7 8" charge="1">
<FragmentArray values="853.2 954.6 " measure_ref="m_mz"/>
<FragmentArray values="669 290" measure_ref="m_intensity"/>
<FragmentArray values="-0.1873 0.1651" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2 3 4 5 6 12" charge="1">
<FragmentArray values="370.2 469.07424 540.2 687.1 801.07892 1488.8 "
measure_ref="m_mz"/>
<FragmentArray values="128 1184 556 3179 6442 38" measure_ref="m_intensity"/>
<FragmentArray values="0.0279 -0.1663 -0.0776 -0.2130 -0.2770 0.0849"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="11 13" charge="2">
<FragmentArray values="671.1 802.1 " measure_ref="m_mz"/>
<FragmentArray values="26 363" measure_ref="m_intensity"/>
<FragmentArray values="-0.2270 -0.2747" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 6 9" charge="1">
<FragmentArray values="452.2 783.9 1110.4 " measure_ref="m_mz"/>
<FragmentArray values="5 23 79" measure_ref="m_intensity"/>
<FragmentArray values="-0.0140 -0.4294 -0.0884" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="7 9 12 13" charge="2">
<FragmentArray values="440.8 555.7 736.6 794 " measure_ref="m_mz"/>
<FragmentArray values="21 6 17 17" measure_ref="m_intensity"/>
<FragmentArray values="-0.3947 -0.0479 0.2521 0.1386" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="9 6 5 4 3 2" charge="1">
<FragmentArray values="1147.2 821.064 720 607.2 460.2 345.1 " measure_ref="m_mz"/>
<FragmentArray values="1165 150 55 979 108 237" measure_ref="m_intensity"/>
<FragmentArray values="-0.3994 -0.3763 -0.3927 -0.1086 -0.0402 -0.1132"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="14" charge="2">
<FragmentArray values="853.8 " measure_ref="m_mz"/>
<FragmentArray values="120" measure_ref="m_intensity"/>
<FragmentArray values="-0.1245" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="2 6 5 8 6 9 7 9 7 12 8 11" charge="1">
<FragmentArray values="560.3 460.2 440.8 326.7 688.1 444.7 " measure_ref="m_mz"/>
<FragmentArray values="9 108 21 8 152 10" measure_ref="m_intensity"/>
<FragmentArray values="0.0503 0.0140 -0.4092 -0.4663 -0.2665 0.4547"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="5 9 7 12" charge="1">
<FragmentArray values="560.3 660.2 " measure_ref="m_mz"/>
<FragmentArray values="9 19" measure_ref="m_intensity"/>
<FragmentArray values="0.0503 -0.1715" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="21.56"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="10.7224059132111"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_5" calculatedMassToCharge="973.9856465" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_5" rank="5"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="3 8 10" charge="1">
<FragmentArray values="440.8 1125.9 1341.05302 " measure_ref="m_mz"/>
<FragmentArray values="21 142 149" measure_ref="m_intensity"/>
<FragmentArray values="-0.4456 0.3279 0.3903" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="10 11 12" charge="2">
<FragmentArray values="671.1 720 794 " measure_ref="m_mz"/>
<FragmentArray values="26 55 17" measure_ref="m_intensity"/>
<FragmentArray values="0.2650 -0.3692 0.0966" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7" charge="1">
<FragmentArray values="853.2 " measure_ref="m_mz"/>
<FragmentArray values="669" measure_ref="m_intensity"/>
<FragmentArray values="-0.1873" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="2 3 4 5 6" charge="1">
<FragmentArray values="370.2 469.07424 540.2 687.1 801.07892 " measure_ref="m_mz"/>
<FragmentArray values="128 1184 556 3179 6442" measure_ref="m_intensity"/>
<FragmentArray values="0.0279 -0.1663 -0.0776 -0.2130 -0.2770" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="3 6 14" charge="1">
<FragmentArray values="452.2 783.9 1783.4 " measure_ref="m_mz"/>
<FragmentArray values="5 23 7" measure_ref="m_intensity"/>
<FragmentArray values="-0.0140 -0.4294 -0.4320" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="7 13" charge="2">
<FragmentArray values="440.8 857.3 " measure_ref="m_mz"/>
<FragmentArray values="21 74" measure_ref="m_intensity"/>
<FragmentArray values="-0.3947 0.3989" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="13 12 11 10 7 6" charge="1">
<FragmentArray values="1577.3 1479.112649 1407.3 1260.2 794 679.9 " measure_ref="m_mz"/>
<FragmentArray values="188 672 1063 3411 17 17" measure_ref="m_intensity"/>
<FragmentArray values="-0.4992 0.3819 -0.3937 -0.4583 -0.4043 -0.4614"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="14" charge="2">
<FragmentArray values="853.2 " measure_ref="m_mz"/>
<FragmentArray values="669" measure_ref="m_intensity"/>
<FragmentArray values="-0.2325" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="10" charge="1">
<FragmentArray values="1244.1 " measure_ref="m_mz"/>
<FragmentArray values="30" measure_ref="m_intensity"/>
<FragmentArray values="0.4683" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 6 8 9" charge="1">
<FragmentArray values="560.3 370.2 " measure_ref="m_mz"/>
<FragmentArray values="9 128" measure_ref="m_intensity"/>
<FragmentArray values="0.0503 -0.0085" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="7 10" charge="1">
<FragmentArray values="540.2 " measure_ref="m_mz"/>
<FragmentArray values="556" measure_ref="m_intensity"/>
<FragmentArray values="-0.1140" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="13.21"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="73.3317829092433"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_6" calculatedMassToCharge="973.987333" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_6" rank="6"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="6" charge="1">
<FragmentArray values="687.1 " measure_ref="m_mz"/>
<FragmentArray values="3179" measure_ref="m_intensity"/>
<FragmentArray values="-0.2130" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="2 3 7 10 11 13" charge="1">
<FragmentArray values="346.4 460.2 802.1 1146.095295 1259.7 1488.1 "
measure_ref="m_mz"/>
<FragmentArray values="12 108 363 6801 36 108" measure_ref="m_intensity"/>
<FragmentArray values="0.2569 0.0140 -0.2400 -0.4255 0.0951 0.3841"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="8 12 14" charge="2">
<FragmentArray values="452.2 687.1 801.07892 " measure_ref="m_mz"/>
<FragmentArray values="5 3179 6442" measure_ref="m_intensity"/>
<FragmentArray values="0.0025 0.2519 0.1753" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="4 9 16" charge="1">
<FragmentArray values="540.2 973 1783.4 " measure_ref="m_mz"/>
<FragmentArray values="556 19300 7" measure_ref="m_intensity"/>
<FragmentArray values="-0.0123 -0.3931 -0.4353" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="15 14 10 7 6 4" charge="1">
<FragmentArray values="1602 1488.1 1146.095295 801.07892 688.1 460.2 "
measure_ref="m_mz"/>
<FragmentArray values="3005 108 6801 6442 152 108" measure_ref="m_intensity"/>
<FragmentArray values="0.1684 0.3114 0.4606 -0.3750 -0.2698 -0.0588"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="15 6" charge="2">
<FragmentArray values="801.07892 345.1 " measure_ref="m_mz"/>
<FragmentArray values="6442 237" measure_ref="m_intensity"/>
<FragmentArray values="-0.3405 0.4115" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="15 10 6" charge="1">
<FragmentArray values="1584.6 1128.3 671.1 " measure_ref="m_mz"/>
<FragmentArray values="29 50 26" measure_ref="m_intensity"/>
<FragmentArray values="-0.2050 -0.3082 -0.2433" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="13 11" charge="2">
<FragmentArray values="687.1 608.4 " measure_ref="m_mz"/>
<FragmentArray values="3179 54" measure_ref="m_intensity"/>
<FragmentArray values="-0.2583 0.0763" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="3 6 4 8 4 10 8 10 9 12 10 13" charge="1">
<FragmentArray values="370.2 444.7 687.1 345.1 470.26087 498.8 " measure_ref="m_mz"/>
<FragmentArray values="128 10 3179 237 23 10" measure_ref="m_intensity"/>
<FragmentArray values="0.0279 0.4911 -0.2420 -0.0881 -0.0477 0.4965"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="6 12 10 13 11 15 13 15" charge="1">
<FragmentArray values="687.1 470.26087 524.2 297.9 " measure_ref="m_mz"/>
<FragmentArray values="3179 23 11 10" measure_ref="m_intensity"/>
<FragmentArray values="-0.3148 -0.0477 -0.1443 -0.2761" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="9.73"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="163.415122593617"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_7" calculatedMassToCharge="973.4346975" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_7" rank="7"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="10" charge="1">
<FragmentArray values="1111.8 " measure_ref="m_mz"/>
<FragmentArray values="127" measure_ref="m_intensity"/>
<FragmentArray values="0.2622" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="8" charge="2">
<FragmentArray values="444.7 " measure_ref="m_mz"/>
<FragmentArray values="10" measure_ref="m_intensity"/>
<FragmentArray values="0.4729" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="13" charge="2">
<FragmentArray values="706.8 " measure_ref="m_mz"/>
<FragmentArray values="19" measure_ref="m_intensity"/>
<FragmentArray values="0.4978" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001235" name="frag: a ion - NH3"/>
</IonType>
<IonType index="4 6 11 15" charge="1">
<FragmentArray values="345.1 687.1 1227 1672.9 " measure_ref="m_mz"/>
<FragmentArray values="237 3179 146 2476" measure_ref="m_intensity"/>
<FragmentArray values="-0.0405 -0.2308 0.4352 0.2067" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="12 15" charge="2">
<FragmentArray values="671.1 837.2 " measure_ref="m_mz"/>
<FragmentArray values="26 43" measure_ref="m_intensity"/>
<FragmentArray values="-0.1995 0.3497" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="7" charge="1">
<FragmentArray values="783.1 " measure_ref="m_mz"/>
<FragmentArray values="22" measure_ref="m_intensity"/>
<FragmentArray values="-0.2883" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="13" charge="2">
<FragmentArray values="720 " measure_ref="m_mz"/>
<FragmentArray values="55" measure_ref="m_intensity"/>
<FragmentArray values="-0.2997" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="12 10 9 5 2" charge="1">
<FragmentArray values="1602 1259.7 1146.095295 720 375.2 " measure_ref="m_mz"/>
<FragmentArray values="3005 36 6801 55 7" measure_ref="m_intensity"/>
<FragmentArray values="0.2711 0.1614 -0.3593 -0.3046 -0.0238" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="12" charge="2">
<FragmentArray values="801.07892 " measure_ref="m_mz"/>
<FragmentArray values="6442" measure_ref="m_intensity"/>
<FragmentArray values="-0.2892" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="12" charge="1">
<FragmentArray values="1584.6 " measure_ref="m_mz"/>
<FragmentArray values="29" measure_ref="m_intensity"/>
<FragmentArray values="-0.1024" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="13" charge="2">
<FragmentArray values="857.3 " measure_ref="m_mz"/>
<FragmentArray values="74" measure_ref="m_intensity"/>
<FragmentArray values="-0.0761" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 5 7 11 10 15 12 14" charge="1">
<FragmentArray values="345.1 540.2 671.1 346.4 " measure_ref="m_mz"/>
<FragmentArray values="237 556 26 12" measure_ref="m_intensity"/>
<FragmentArray values="-0.0405 -0.0413 -0.1267 0.3119" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 6 4 6 6 10" charge="1">
<FragmentArray values="572.2 444.7 679.9 " measure_ref="m_mz"/>
<FragmentArray values="8 10 17" measure_ref="m_intensity"/>
<FragmentArray values="-0.1039 0.4547 -0.4726" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="8.78"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="203.372507852169"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_8" calculatedMassToCharge="973.9989065" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_8" rank="8"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="5 6 7 10" charge="1">
<FragmentArray values="460.2 607.2 720 965.415264 " measure_ref="m_mz"/>
<FragmentArray values="108 979 55 31180" measure_ref="m_intensity"/>
<FragmentArray values="-0.0918 -0.1602 -0.4443 -0.1302" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="10 11" charge="2">
<FragmentArray values="483 540.7 " measure_ref="m_mz"/>
<FragmentArray values="4 29" measure_ref="m_intensity"/>
<FragmentArray values="-0.2764 -0.0898" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="15" charge="1">
<FragmentArray values="1602 " measure_ref="m_mz"/>
<FragmentArray values="3005" measure_ref="m_intensity"/>
<FragmentArray values="0.1855" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="7 9 10 12 13 15" charge="2">
<FragmentArray values="375.2 469.07424 496.9 619.2 687.1 801.07892 "
measure_ref="m_mz"/>
<FragmentArray values="7 1184 6 15 3179 6442" measure_ref="m_intensity"/>
<FragmentArray values="0.4767 0.3111 -0.3738 0.3652 -0.2642 -0.3319"
measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001224" name="frag: b ion"/>
</IonType>
<IonType index="14 15" charge="1">
<FragmentArray values="1488.1 1584.6 " measure_ref="m_mz"/>
<FragmentArray values="108 29" measure_ref="m_intensity"/>
<FragmentArray values="0.3649 -0.1879" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="16" charge="2">
<FragmentArray values="821.064 " measure_ref="m_mz"/>
<FragmentArray values="150" measure_ref="m_intensity"/>
<FragmentArray values="-0.3443" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001232" name="frag: b ion - NH3"/>
</IonType>
<IonType index="10 9 8 3" charge="1">
<FragmentArray values="1112.5 1011.9 954.6 346.4 " measure_ref="m_mz"/>
<FragmentArray values="61 126 290 12" measure_ref="m_intensity"/>
<FragmentArray values="-0.0266 0.4211 0.1426 0.2167" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001220" name="frag: y ion"/>
</IonType>
<IonType index="8" charge="2">
<FragmentArray values="469.07424 " measure_ref="m_mz"/>
<FragmentArray values="1184" measure_ref="m_intensity"/>
<FragmentArray values="-0.1448" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001233" name="frag: y ion - NH3"/>
</IonType>
<IonType index="2 5 3 6 4 7 9 13" charge="1">
<FragmentArray values="375.2 465.3 465.3 539.6 " measure_ref="m_mz"/>
<FragmentArray values="7 6 6 31" measure_ref="m_intensity"/>
<FragmentArray values="-0.0027 0.0504 0.0504 0.3428" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001365" name="frag: internal yb ion"/>
</IonType>
<IonType index="2 7 4 8" charge="1">
<FragmentArray values="607.2 524.2 " measure_ref="m_mz"/>
<FragmentArray values="979 11" measure_ref="m_intensity"/>
<FragmentArray values="-0.1602 -0.0867" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001366" name="frag: internal ya ion"/>
</IonType>
</Fragmentation>
<cvParam accession="MS:1001171" name="Mascot:score" cvRef="PSI-MS" value="8.45"/>
<cvParam accession="MS:1001172" name="Mascot:expectation value" cvRef="PSI-MS"
value="219.428100738757"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_3_9" calculatedMassToCharge="974.005521" chargeState="2"
experimentalMassToCharge="973.9" peptide_ref="peptide_3_9" rank="9"
passThreshold="false">
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7C_SAGOE_0"/>
<PeptideEvidenceRef peptideEvidence_ref="PE_2_1_HSP7D_DROME_0"/>
<Fragmentation>
<IonType index="6" charge="1">
<FragmentArray values="687.1 " measure_ref="m_mz"/>
<FragmentArray values="3179" measure_ref="m_intensity"/>
<FragmentArray values="-0.2494" measure_ref="m_error"/>
<cvParam cvRef="PSI-MS" accession="MS:1001229" name="frag: a ion"/>
</IonType>
<IonType index="7 10 11 13" ch