Permalink
Fetching contributors…
Cannot retrieve contributors at this time
5022 lines (5021 sloc) 524 KB
<?xml version="1.0" encoding="UTF-8"?>
<MzIdentML xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xsi:schemaLocation="http://psidev.info/psi/pi/mzIdentML/1.1 ../../schema/mzIdentML1.1.0.xsd"
xmlns="http://psidev.info/psi/pi/mzIdentML/1.1"
id=""
version="1.1.0"
creationDate="2011-05-26T13:26:26">
<cvList>
<cv id="PSI-MS" fullName="Proteomics Standards Initiative Mass Spectrometry Vocabularies" uri="http://psidev.cvs.sourceforge.net/viewvc/*checkout*/psidev/psi/psi-ms/mzML/controlledVocabulary/psi-ms.obo" version="2.32.0"></cv>
<cv id="UNIMOD" fullName="UNIMOD" uri="http://www.unimod.org/obo/unimod.obo"></cv>
<cv id="UO" fullName="UNIT-ONTOLOGY" uri="http://obo.cvs.sourceforge.net/*checkout*/obo/obo/ontology/phenotype/unit.obo"></cv>
</cvList>
<AnalysisSoftwareList>
<AnalysisSoftware id="AS_mascot_server" name="Mascot Server" version="2.3.02" uri="http://www.matrixscience.com/search_form_select.html" >
<ContactRole contact_ref="ORG_MSL">
<Role>
<cvParam accession="MS:1001267" name="software vendor" cvRef="PSI-MS"/>
</Role>
</ContactRole>
<SoftwareName>
<cvParam accession="MS:1001207" name="Mascot" cvRef="PSI-MS"/>
</SoftwareName>
<Customizations>
No customisations
</Customizations>
</AnalysisSoftware>
<AnalysisSoftware id="AS_mascot_parser" name="Mascot Parser" version="2.3.3.0" uri="http://www.matrixscience.com/msparser.html" >
<ContactRole contact_ref="ORG_MSL">
<Role>
<cvParam accession="MS:1001267" name="software vendor" cvRef="PSI-MS"/>
</Role>
</ContactRole>
<SoftwareName>
<cvParam accession="MS:1001478" name="Mascot Parser" cvRef="PSI-MS"/>
</SoftwareName>
<Customizations>
No customisations
</Customizations>
</AnalysisSoftware>
</AnalysisSoftwareList>
<Provider id="PROVIDER">
<ContactRole contact_ref="PERSON_DOC_OWNER">
<Role>
<cvParam accession="MS:1001271" name="researcher" cvRef="PSI-MS" />
</Role>
</ContactRole>
</Provider>
<AuditCollection>
<Person id="">
<Affiliation organization_ref="ORG_MSL"/>
</Person>
<Person id="PERSON_DOC_OWNER" firstName="" lastName="Johannes Griss" >
<Affiliation organization_ref="ORG_DOC_OWNER"/>
</Person>
<Organization id="ORG_MSL" name="Matrix Science Limited" />
<Organization id="ORG_DOC_OWNER" />
</AuditCollection>
<SequenceCollection>
<DBSequence id="DBSeq_1_HYEP_HUMAN" length="455" searchDatabase_ref="SDB_SwissProt" accession="HYEP_HUMAN" >
<Seq>MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Epoxide hydrolase 1 OS=Homo sapiens GN=EPHX1 PE=1 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_1_MATK_CERBE" length="503" searchDatabase_ref="SDB_SwissProt" accession="MATK_CERBE" >
<Seq>MEEFQGYLELDRSQQHDFLYPLIFREYIYALAHDHGLNRSILLDNVGYDNKSSFLIIKRLISRMYQQNHLIISPNDSNQKKIGGYNKNLYCQMISEGFAVIVEIPFSLRLVSSLEGTEIVKSYNLRSIHSIFPFLEDKFSHLNYVSDVLIPYPIHLEILVQTLRYWAKDPSYLHLLRLFLHDYYNLNSLITKNKSIFSKSNPRLFLLLYNSYVCEYESILLFLRNQSSHLQFTSSWIFFERIHFYEKIKYPVEEVFANDFPAILWFFKDPFMHYVRYQGKSILASKDTPLLMNKWKYYLVNLWQCHFYVWSQPGRIYINQLSKHSLDFLGYLSSIRPNLSVVRSQMLENSFIMDNARKKFDTLVPIIPLIGSLAKVKFCNALGHPISKSTWADSSDFDIIDRFVRICRNLSHYYSGSSKKKSLYQIKYILRLSCVKTLARKHKSTVRTFLKRLGSKLLEEFFTEEEQILSLIFPRASSTLTRFYRGRIWYLDIFCINDLVNHE</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Maturase K OS=Cercocarpus betuloides GN=matK PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Cercocarpus betuloides"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="140994"/>
</DBSequence>
<DBSequence id="DBSeq_1_TRUB_LACS1" length="302" searchDatabase_ref="SDB_SwissProt" accession="TRUB_LACS1" >
<Seq>MDGILPLYKERGMTSNDAVIKCRKIFKTRKIGHSGTLDPEVDGVLPICVGKATKVVNYLMDSGKVYKGEITLGFATTTEDLEGEVISKVKLSEPFSDEKINEILSSFIGDIIQVPPIYSAIKVNGKKLYEYARAGEKVDIPERRVHIEYFKQIFPSKFDKEKGQQTIYFEVGCGKGTYVRTLAVDVGKKLGVPAVMSDLTRLKSGGFQIGMAKSLSQLEKLAHENKLSESLYPIDYAVKDLPRYDLKLEQWRIVKNGGFLSVNTFKEDYDRVNLFYDDRIRCIYQYNKEKNRYQSERMIDLS</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="tRNA pseudouridine synthase B OS=Lactobacillus salivarius subsp. salivarius (strain UCC118) GN=truB PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Lactobacillus salivarius UCC118"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="362948"/>
</DBSequence>
<DBSequence id="DBSeq_1_KDSA_ENT38" length="284" searchDatabase_ref="SDB_SwissProt" accession="KDSA_ENT38" >
<Seq>MKQKVVSIGDINVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSINSYRGPGLEEGMKIFQELKQTFGVKVITDVHEASQAQPVAEVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFIEGGNDQIILCDRGANFGYDNLVVDMLGFSVMKKVSNNSPVIFDVTHALQCRDPFGAASSGRRGQVTELARAGMATGIAGLFIEAHPDPANAKCDGPSALPLDKLEPFLKQIKAIDDLVKSFDELDTSN</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="2-dehydro-3-deoxyphosphooctonate aldolase OS=Enterobacter sp. (strain 638) GN=kdsA PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Enterobacter sp. 638"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="399742"/>
</DBSequence>
<DBSequence id="DBSeq_1_APLP_LOCMI" length="3380" searchDatabase_ref="SDB_SwissProt" accession="APLP_LOCMI" >
<Seq>MGTPPHIWFLLILAISSGGLSAAVGGCNHQCTPQSSVFQYQKGQTYTYSFEGTTLTSLPGTQGEPVRLKLKATADLSVADDCNKVLRLRGVTVSGPDSKNYANLKDLEAHPVLANFKGSSINKQLCSEDGDNQSSLNIKRAILSLLQTPNTKSSTASEVDVFGICPTNVRHSQRGDVTVISKTRNLNRYASRENLIQETLSTRFTGQSDLHATPFLDADLHVEQQIKGGLIVSATSRESYLFRPFSNQGNGAKTIVETKLTLTSQNAQPAPPLASFTVPKSIVFEAPHALASVPGGSSAITAALHAAESSTKDGVTVDAAEKFRTLVSVLRQSSTTDILKVYNDVKAGAGFSNKHSARNLLLDALFRTSTGDAVEVIARLLKTKEITANHWYLSLAFIQHASLKSVVSISSLLDQKNLPTEAFLGIGSFIGRYCREHNCENVAEFDEVLNKFSKHLSGSTTSKAGENRAIAALKALGNIRHLNNALGEKVKQLALDKSLPPRVRVAALEVIQSDPCRKNIKQAALQILRDQVEDSELRIKAYLAVVECPCDNVVKTISNLLENEPIIQVGSFVVSHLKNLQASTDPSKAEAKEKLGQLKPKKIFSSDIRKYSQNYELSYAIDAINAGASVESNVIFSQSSYLPRSVSLNLTADVFGHSYNVFEIAARTENLDHIIESFLGPKGYIETEDDDKFVDEVEEKTKSLYNRITERFEKTFRQKRSVSKDAVDNIRQQAYKSLLPSQRDRSLDVDLSLKTFGSELAWFNYDGKHEQKSSERVVDEIFDAIDEGLKKSKKFNYDFEPHFTFLDSELSYPTNLGFPLKLAIDGSIAARLKLNGEVDVRSILRQPENAAFRLEFVPSAAVELTGKLLVDAYVVEGGLKLDYNVHSSTGINVAVHNLNDLGIDIKVGLPVKKQDIIDVKTDVLTTVKERGHPETSTPLHFNLKGNDYKQYRGCFDQLSPVSGLTFCGNVSVPWVSPTQAAAFYPLNGPSHLSVSIEADDVSEYHFRAEIKKDESAFKSAAVLFDTPGSSADRKVLLLVEKKEKPHQGITAHLKSGWKEIVAEGLLIDDNNEKSVSAKLVIESDEYSIKGGVKISGNPSRQVYKPILEYKAPAKDSGAKVKKSHKTSEGITVDGAVVVERTSDKGKYTFQDLSLKTPKGTFVINGQLDIVPRNYAFDLKLSVDKNELLLNGHLNYAEPKSIDVALEVTSPQFPDYGSGFQLINKRGDDYSDTKIILACGRDLKSDGSRLILEHFIKGKYETPDTFNLETKGEVLGTGHKIFGKFDIDSKPKHLEYDLKLGFDENEVTSDLVAKRDIKSPDDYELKFSAKILDNSIRIESSREVKPKDDSAFLNTLVVLSGKKYEFQVDVKLAAEDEYHTSLKAESNLKIEGKTSVRLITDFTTDAQTVNGHVKVSNEGEDFFELIYKLNRGSGNPSGNAKLFVKNYLDGAATFKYNNGVGSGTLQIDVLKLHRKIKATGDLTLSGSQRSAAIDLYWDADRDQSKQLLFKTENDVKEKSIDSKNTLKILDKLTTLNFKGSLSGAIDDGEVEGQGELILPVGTYLGVKFGRALHLTQADTKVGLHLQAEGRESASSTQPVWKSDFLLESALTRDSFVGEAKLLFETKGKDDLKLFLSGKSLPQGEKKLISGQFSGQGSLIGGRTSVIKLNSEIDETFIAYNLNSECNQGYRANIVGKINRGYSPVAVKQIENTLELLLPFDKLKQLKHTIIGTFSSQPESTPEFTVSNVIIWNNENTLKLTGEAAGDEKEGRTKWDLILPKEEPRTLETTWSNAGDNKKAGSLSFKWGGNKEAKVSTDIEFTSDNQPQILHLKATSPTEKFGIFDLALSLKKNADPADKIDFELTVTADQKKTDVKGSLGLAPGVPIIDVVAVQPSGTSKVFVDFLRKSDSELHGAIELQWVAFGGGHLTANGDIKLDIDDFYLKLDVDSPKFNFNKWHLEAGQRAAKGSKRIVFTAKSAEKVLFSGSTNFHSKAENNKISYSGNGQVRIGDKAHAFNFRSSRQNLIQDANKEIGVEYNLDFKIAGHGSLHNILKVTNKELHALGKQCSEGKPNCAVVEIKSKVSAADAKETTHDLVFLVDLKSVGVDTGVAFTAETVRRGFWLIDEQASLTLSHNGETTYKYKGYLKESGSGFTLTLPSRVIAAEVKLSSDVKPNHSKQQISASVWLDKTRLPNSFSSVSILLEEIEDKNTDKYVSQLRFTHPNLEKDLTVKGYVQIGLENKLFDSNLEIDIFKQKNQKISISSTVVEQKQNDVVKYLSTLDVKSKGHELDVTGRGEATVKPSLIALQSVLKYKKDKRIKEFKNFQFEVSTEKLLVHVKVPNHHLLHIDANTKINDKHASGDASVHIIGLPTSVIHIEGENKGFPVVKGTISSEGTPNKLELIADLSDGLLVEADFISESGKKELFYTFLSGKKDSRKPEFRWSVENIQSALEPHKNDIQEVLNKLKEISDEAGNEITKESSRLADSLKAGLPNFRRFVNTYETQLKALKEEIANDKVLKEISENWKEVIGDAAEVVSTLVNGILVTIDALLKTLNELAESVLDALKKSLPALKDSYKQAVDAIVGIAKSLTQSLVNILSSAAEILKKHEADIKEYLSVLADLANDVGKFVTKITGVIYEGVVEFSKPIKEKLDGLKFGVAIEFGKVVEQLQNLIVPQELLAFAQEIVSELKETTLTPEIQDLLQAIEKYLEKVSKKKDADVEKELKLIFEKAIDAVESVINFVVSEITGGDHTKDLYDINIPTVLPSFIQLPRVFSVRFSPLIYLVSNGVPCLSDLLASYRPSLRFDNIIPPYDATAILLNSHHFFTFDRRHLTFKGICSYILAQDVQDGNFTIIANIEGGSLKSIIVSDQATTFELASDKSLLVNGRPTEYPADEGEFHAWREYNRVGIQTKAGVKVTCETSIELCTFEINGFYFGKTRGLLGTINNEPWDDFTKPDGQVASKANEFGNAWKVDAQCANVDGVDHHEHSIKVEECEEVFSKASLLSPCSLFLDPAPYLEACSHIAHEATTKEEKQLAACRTAAAYVQACSVENVFVSVPPHCVHCSVNGDAAIDIGQSFSVKVPQKSADILIVLEQVTGNAETVKDFVSPIVSQLTQELSSRGISDVWISLLGYGAPGQEYPHLYTSSGGKLSYDGKQKNIQFGERKVLGPFPFDNFTESIDWLDEFTDQAFHLITTADTILDYPFRPGAAKSIIYVLDTSCETTLFLKHLPVKALKLKDAIGSPGIVLHLVTNVDSVQSKNIVGFDTNHAYYNQEGKKRVVSEVTGNEKAALKISETACGQIALATSGTVFNKNNLKQTKKFVAQHIADSLTNVELTQDCKCLPVEGIHTRAVCAVTGAREKEHLSVKGVKGTKGVKG</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Apolipophorins OS=Locusta migratoria PE=1 SV=2" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Locusta migratoria"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7004"/>
</DBSequence>
<DBSequence id="DBSeq_1_RPOB_CLOTH" length="1250" searchDatabase_ref="SDB_SwissProt" accession="RPOB_CLOTH" >
<Seq>MVHPVKLGRNVRMSYSKIDEVIDMPNLIEIQKNSYEQFLKEGFKEVFKDVNPITDYTGNLILEFVDYSLDEPPKYSVDECKERDATYAAPLKVKVRLINKETGEVKEQEIFMGDFPLMTETGTFIINGAERVIVSQLVRSPGIYYAMKIDKAGKQLFSNTVIPNRGAWLEYETDSNDVLSVRIDRTRKLPLTVLVRALGYGTDLEITELFGEDERILATIQKDSTKTEEEGLLEIYKRLRPGEPPTVESAKALLHGLFFDPKRYDLAKPGRFKFNKKLSIAARIHGFIAGENIKDPDTGEIIVAEGETISREKAETIQNAGVNTVILRVDGKNVKVIGNDMVDIKRYVDFDPKEIGINEKVKRDVLMEILEEYKGKGDDAIKKALQERIDDLIPKHITKEDIISSISYIIGLSYGIGSTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQDLDVVTPQALINIRPVAAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTYARVNEYGFIETPYRKVSKEEPGKVTNEIVYLTADEEDEYIIAQANEPLDEEGRFISNKVVCRYKEEFIEVDPSKIDFMDVSPKQIVSVATSMIPFLENDDANRALMGANMQRQAVPLIKTESPIVGTGIEYRAARDSGVVILAKNPGVVEKVTANEIIIRTKDGKRDTYKLLKYMRSNQGTCINQRPIVKKGEEVEAGDVIADGPSTDNGEIALGKNVLVGFMTWEGYNYEDAILISERLVKDDVFTSIHIEEYEAEARDTKLGPEDITREIPNVSEDALKDLNSEGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGESGIVVDVKIFTRENGDELAPGVNKLVRVYVAQKRKISVGDKMAGRHGNKGVISRILPVEDMPFLPDGTPLDIVLNPLGVPSRMNIGQVLEVHLGYAAKALGWKVATPVFDGATEEDIVQTLRKAGLAEDGKSILYDGRTGEPFENRVTVGYMYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENVPEPGIPECFKVLIKELQSLCLDVKVYSEEQEEIAIKESVEDDLEELNVNIEGREDEVNFNEFNDIGEEITDEDLEVEDFDLQDLNDDDINPDDTIDAELDDNLFDDDFDDTFDDDDL</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="DNA-directed RNA polymerase subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=rpoB PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Clostridium thermocellum ATCC 27405"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="203119"/>
</DBSequence>
<DBSequence id="DBSeq_1_RPOB_DECAR" length="1427" searchDatabase_ref="SDB_SwissProt" accession="RPOB_DECAR" >
<Seq>MTYSFTEKKRIRKSFAKRASVLDVPYLLATQLQSFKDFLQDEVAPEKRKNEGLQAAFTSIFPIVSHSGNARLEFVSYMLGEPAFDVTECQQRGLTFASSLRARVRLVIMDREAPDTVKEVKEQEVYMGEIPLMTTNGSFVINGTERVIVSQLHRSPGVFFEHDRGKTHSSGKLLFSARVIPYRGSWLDFEFDPKDTLFFRVDRRRKMPVTTLLKAIGMSSEEILDQFFDFDTFLLSKDKVEFTLVPERLRGEVARFDFVGPDGVLIVPKDKRITAKHIRDIGAAAIKQIVVPEDFLIGRVVAKNIVDKATGEVVANANDEITETLLAKLREAEITTVETLYTNELDRGAFISNTLRADETATRQAARVAIYRMMRPGEPPTEEAVEILFNGLFYSDERYDLSGVGRMKFNRRLARQDVIEYKLMVKGLASKAEAALKNLAEASGFALSAIQDLVSLMPFGARAMVENSTLSEVEALAAKLKPLGANVEVREQLTLSPRDIVEVIKILVELRNGRGEIDDIDHLGNRRVRSVGELAENQFRAGLVRVERAVKERLSQAESDNLMPHDLINAKPISAAIKEFFGSSQLSQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLALFAQVNSYGFIETAYRKVNNGQVTSDIEYLSAIEEGNYVVAQANASLDANGRLSDDLVTCREKGETILAEPGRVQYMDVAPGQIVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKPLVGTGIERTVAVDSGTAVVALRGGMVDYVDAARVVVRVNDDETIAGEVGVDIYNLVKYTRSNQNTNINQRPMVRVGDHIAKGDVVADGASTDKGELALGQNMLIAFMPWNGYNFEDSILISERVVAEDRYTSIHIEELTVVARDTKLGPEEITRDIASLGEAQLSRLDDSGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGIAGTVIDVQVFTREGIERDKRAQAIIDEHLRHYKLDLADQMRIVERDAFARVERLITGKKANGGPKKLAKGTVIDKVYLDSMDPHHWFDIRLADDEAAQQLEQVKDGLEQARKDFDIAFEGKRKKLTQGDELPPGVQKMVKVYVAVKRRLQPGDKMAGRHGNKGVVSRILPVEDMPHMEDGSPVDIVLNPLGVPSRMNVGQILEVHLGLAAKGLGHKIGAMLRAQSSAKEVRGFLDQIYNSSGKSENLDELNDVEVLEMAENLKGGVPFATPVFDGAKEEEIKAMLAMAGMPSSGQMTLFDGRTGEAFERKVTVGYMHYLKLHHLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVNGRTKVYENIVKGEHRIEAGMPESFNVLVKEIRSLAIDIDLERY</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="DNA-directed RNA polymerase subunit beta OS=Dechloromonas aromatica (strain RCB) GN=rpoB PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Dechloromonas aromatica RCB"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="159087"/>
</DBSequence>
<DBSequence id="DBSeq_1_PUR6_DEBOC" length="557" searchDatabase_ref="SDB_SwissProt" accession="PUR6_DEBOC" >
<Seq>MDNKIVGILGGGQLGRMIVEAANRLNIKTVVLDVPNSPAKQINSNEHVDGSFTDLKSIIQLAEKCDILTVEIEHVDVEALKYVKEKFGVEIYPLPDTIKLIQDKYLQKEHLIQHGISVTESVAVPSNDEQSLIEIGNKFNYPFMLKSRTLAYDGRGNYVVKTKESIPEALEFLKDRPLYAEKWCPFNKELAVMVVRSIEGEVFAYPTVETIHKNNICHVVYAPARVSDSIAVKASVLAKNAVKSFPGCGIFGVEMFLLPNNEILINEIAPRPHNSGHYTIDACVTSQFEAHVRAVVGLPMPKNFTSLSTTTTNAIMLNVLGDEESNKELEICRRALETPNASVYLYGKSTRPNRKMGHINIVSSSMEDCESRLDYIIGKSSKIPENLIPKEKPLVSIIMGSDSDLPVMSVGANILKRFGVPFELTIVSAHRTPHRMTQYAIEAPKRGLKVIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPVATVAINNSTNAALLAVRILGAYDYKWLNEMNQYMNNMENEVLAKAERLEEVGYEKY</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Phosphoribosylaminoimidazole carboxylase OS=Debaryomyces occidentalis GN=ADE2 PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Debaryomyces occidentalis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="27300"/>
</DBSequence>
<DBSequence id="DBSeq_1_FABD_BACSU" length="317" searchDatabase_ref="SDB_SwissProt" accession="FABD_BACSU" >
<Seq>MSKIAFLFPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGDAEELTLTYNAQPALLTTSIAVLEKFKESGITPDFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGEFMNEAVPAGEGAMAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVELASELAKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADVPVISNVSADVMTEKADIKEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAVSDPETIELAIQTLKEENDNA</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fabD PE=3 SV=2" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Bacillus subtilis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="1423"/>
</DBSequence>
<DBSequence id="DBSeq_1_PLEC1_HUMAN" length="4684" searchDatabase_ref="SDB_SwissProt" accession="PLEC1_HUMAN" >
<Seq>MVAGMLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGLVRETFAWCHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPLLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANELQLRWQEYRELVLLLLQWMRHHTAAFEERRFPSSFEEIEILWSQFLKFKEMELPAKEADKNRSKGIYQSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVTKLQMEAGLCEEQLNQADALLQSDVRLLAAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVAAPATQVAQVTLQSVQRRPELEDSTLRYLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLHQSIEEFRAKIERARSDEGQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHSFVAAATKELMWLNEKEEEEVGFDWSDRNTNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYSCDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVCDYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQLHVDMKSLLAWQSLRRDVQLIRSWSLATFRTLKPEEQRQALHSLELHYQAFLRDSQDAGGFGPEDRLMAEREYGSCSHHYQQLLQSLEQGAQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKEPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRGTQGAEEVLRAHEEQLKEAQAVPATLPELEATKASLKKLRAQAEAQQPTFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLGAWLQDARRRQEQIQAMPLADSQAVREQLRQEQALLEEIERHGEKVEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTHYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAEREAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQALEELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLERSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLAEKLAAIGEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASDSELERQKGLVEDTLRQRRQVEEEILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKEQAELEAARQRQLAAEEERRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSVLDQLRGEAEAARRAAEEAEEARVQAEREAAQSRRQVEEAERLKQSAEEQAQARAQAQAAAEKLRKEAEQEAARRAQAEQAALRQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAARQRSQVEEELFSVRVQMEELSKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAEETQGFQRTLEAERQRQLEMSAEAERLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLQQEAKLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAQQLREEQQRQQQQMEQERQRLVASMEEARRRQHEAEEGVRRKQEELQQLEQQRRQQEELLAEENQRLREQLQLLEEQHRAALAHSEEVTASQVAATKTLPNGRDALDGPAAEAEPEHSFDGLRRKVSAQRLQEAGILSAEELQRLAQGHTTVDELARREDVRHYLQGRSSIAGLLLKATNEKLSVYAALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGQQISLFQAMQKGLIVREHGIRLLEAQIATGGVIDPVHSHRVPVDVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLCLLPLTDKAAKGGELVYTDSEARDVFEKATVSAPFGKFQGKTVTIWEIINSEYFTAEQRRDLLRQFRTGRITVEKIIKIIITVVEEQEQKGRLCFEGLRSLVPAAELLESRVIDRELYQQLQRGERSVRDVAEVDTVRRALRGANVIAGVWLEEAGQKLSIYNALKKDLLPSDMAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPEFHEKLLSAEKAVTGYRDPYTGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVACARGCLDEETSRALSAPRADAKAYSDPSTGEPATYGELQQRCRPDQLTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILITIVEEVETLRQERLSFSGLRAPVPASELLASGVLSRAQFEQLKDGKTTVKDLSELGSVRTLLQGSGCLAGIYLEDTKEKVSIYEAMRRGLLRATTAALLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEQLLSAEKAVTGYRDPYSGSTISLFQAMQKGLVLRQHGIRLLEAQIATGGIIDPVHSHRVPVDVAYQRGYFSEEMNRVLADPSDDTKGFFDPNTHENLTYRQLLERCVEDPETGLRLLPLKGAEKAEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSTMSLWEVMQSDLIPEEQRAQLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQGLASYDYVRRRLTAEDLFEARIISLETYNLLREGTRSLREALEAESAWCYLYGTGSVAGVYLPGSRQTLSIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPTEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLRRCRRDDGTGQLLLPLSDARKLTFRGLRKQITMEELVRSQVMDEATALQLREGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAIAKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISPAVSRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTDAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSTKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGSSASLGGPESAVA</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Plectin-1 OS=Homo sapiens GN=PLEC1 PE=1 SV=3" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_1_CP2A6_HUMAN" length="494" searchDatabase_ref="SDB_SwissProt" accession="CP2A6_HUMAN" >
<Seq>MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=2" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_1_KPRS_PYRFU" length="279" searchDatabase_ref="SDB_SwissProt" accession="KPRS_PYRFU" >
<Seq>MLVIGSGAKHLEGEIKEKAPITNVEIKKFPDGEKYVRILEKGDKAIVVQSTYKPQDEFLIEALLLGDALRENGYRKLKIVIPYMAYSRQDRVTKEGEPISIRAVLKMLGLYYDELYVMDIHNPKTLEFFPGRAENILPSKEIAEYFSDKLGEGIILAPDKGALERAKAIAEILGLEYSHFEKKRISPTEVQMTPVNIDVKGKNVLIVDDIISTGGTMIKATEILRKLGAEKVFVAATHGVFAEGAIERLSKAVDELAVTNTIPTPVSKISIVPEILNLL</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Ribose-phosphate pyrophosphokinase OS=Pyrococcus furiosus GN=prs PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Pyrococcus furiosus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="2261"/>
</DBSequence>
<DBSequence id="DBSeq_1_PBPA_RICCN" length="790" searchDatabase_ref="SDB_SwissProt" accession="PBPA_RICCN" >
<Seq>MYKSLLFCLKIFVFLILVGCGITAYIIYHYSRDLPDYSQLARYYPPSVTRIYSRDGKLMEEYAFERRVFVPINSVPSSLIESFIAAEDKNFYNHPGVDLFGIVRAAFLNISNYLHHRRMEGASTITQQVVKNFLLTNEVSLERKIKEAILSYMISRVFTKDQILELYLNQTFFGRGAYGVAVAAQNYFNKSVEELTIAESAFIAALPKAPSELNPERNYARVKARRDYVITRMFEDGYITRDAAKEAMDSPIVLRKRAKEETVTADYYAAQVREEVIRMLNSKEVFYTGGLTIITSLDAKMQQLAENSLRKGLREFDRRCGFRKPIANISLDNWQGELKKLPTPPSLLEYKLAVVLDVADNHVEIGLIDGSKSKMPIAEMKWARSNFKSVKTLLKKGDVIVVEAIKEGYALRQIPEVNGAIMVMNPNTGQVLASVGGYDFSTSKFDRVTQALRQPGSLSKTFVYLAALENGVKPNQIFNDGPIEISQGPGMPSWRPKNYEGKFLGEITMRTGLEKSRNLITVRVATAVGLTKIVDIIKRFGINNEPKKVYSMVLGSIETTLSRMTNAYAIIANGGKKVEPHFVELIKDRNGKIIYRRDDRECLACNVSDSNLDTAILEIPKEYIYRVTDEASDYQITSFLTGAIDRGTGYAAKKLGKIIGGKTGTSNDSKDTWFVGFTPKIVVGSYVGYDTPKELGKRATGSNVVLPIFIDFMSNAYKDKPSLPFKVPDSIKLIAVDSATGKITPGGTVIEAFKVNNVQMLENEDMIDNQDNNDIFDYVPSKEDQSQEIY</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Penicillin-binding protein 1A OS=Rickettsia conorii GN=mrcA PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Rickettsia conorii"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="781"/>
</DBSequence>
<DBSequence id="DBSeq_1_RL3_AKKM8" length="211" searchDatabase_ref="SDB_SwissProt" accession="RL3_AKKM8" >
<Seq>MALGLIGKKVGMTRLFDQESGAMVPVTVIDVKGNTFAQIKTEDKDGYNAIQVAFDAQKESRVAKPQAGHFKKLGIQPTKLLKEFRVEASELPAEGAKDPGVDLFSAGQWVDVIGTSKGKGFQGAMRRHNFHGSPAAHGSMMHRRTGGVGGCSTPGRVWKNQKMPGQMGNAKRTVQNLKVVAVRPEDNVILISGAVPGARGSYLVIRPAKKK</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="50S ribosomal protein L3 OS=Akkermansia muciniphila (strain ATCC BAA-835) GN=rplC PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Akkermansia muciniphila ATCC BAA-835"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="349741"/>
</DBSequence>
<DBSequence id="DBSeq_1_SYE_STRSY" length="464" searchDatabase_ref="SDB_SwissProt" accession="SYE_STRSY" >
<Seq>MPVQHCLTYLFARHHGGTFLIRIEDTDRKRHVEDGERSQLENLRWLGIDWDESPETHENYRQSERLDIYQKYVDQLLAEGKAYKSYVTEEELAAERERQEAAGETPRYINEYLGMSEDEKTAYIAEREAAGIVPTVRLAVNEAGIYKWNDIVKGEIEFEGGNIGGDWVIQKRDGYPTYNFAVVIDDYLIKISHVIRGDDHIANTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRRKGYMPEAVFNFIGLLGWNPGGEEEIFSREQFIQLFDENRLSKSPAAFDQKKMDWMSNEYIKNADLETIFNLAKPFLEEAGRLTDKAEKLVELYKPQMSSADEIVGLTDLFFSDFPELTAEEKEVMAGETVPTVLNALKEKLEAMTDEDFQPDNIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREKSIQHIDNMLKSL</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Glutamyl-tRNA synthetase OS=Streptococcus suis (strain 05ZYH33) GN=gltX PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Streptococcus suis 05ZYH33"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="391295"/>
</DBSequence>
<DBSequence id="DBSeq_1_MATK_FRAVE" length="500" searchDatabase_ref="SDB_SwissProt" accession="MATK_FRAVE" >
<Seq>MEEFQGYFELYRSPQYDFLYPLIFREYIYALAHDRGLNRSILFDNVGYDKKSSLLIIKRLISRMYQQNHFLISVNDSNQNKFLGYNKNLYSQMISEGFAVIVEIPFSLRLVSSLEETESIKSYNLRSIHSIFPFFEDKFPHLNYASDVLIPYPIHLEILVQTLRYCVKDPSSLHLLRLFLHEYYSWNTLITPQKSIFAKSNQRLFLLLYNSYVYEYESILLFLRNQSNHLRLTSSGIFFERIRFYEKIKYPVEEVLFPATLWFFKDPFIQYVSHQGKLILASKDTPLLMNKWKYYLVNFWQCHFYVWSQPGRIHLNQLSKHSFDFLGYLSSIRPNISVVRSQLLENTYLMYNAMKKLNTLFPIIPMIGSLAKVKFCNTLGHPISKSSWADSSDSDIIDRFVRIVGNISHYYSGSSKKKSLYRIKYILRLSCVKTLARKHKSTVRTFLKRLGPKLLDEFFTEEEQIFSLLFPRASSTLKRFYRGPIWYLDILCINDTVNHE</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Maturase K OS=Fragaria vesca GN=matK PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Fragaria vesca"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="57918"/>
</DBSequence>
<DBSequence id="DBSeq_1_MATK_SPICA" length="502" searchDatabase_ref="SDB_SwissProt" accession="MATK_SPICA" >
<Seq>MEEYQGYFELDGYQQHDFLYPLIFREYIYALAHDHGLNRSVLLDNVGYDNKSSLLIIKRLISRMYQQNHLIISANDSNQNKFFGYNKNLYSQIISEGFAVIVEIPFSLRSVSSLETTETEIVKSYNLRSLHSLFPFLEDKFPHLNYVSDVLIPYPIHLEILVQTLRYWVKDPSSLHLLRLFLHEYYNYNWNSLITPNKFIKSNPRLFLLLYNSHVCEYESIFLFLRNQSSHLRLTSYGIFFEQIHFYEKIKYPVENDFTVAILWFFKDPFMHYVRYQGKSILASKDTPLLMNKWKYYLVNLWQCHSYVWSQPGRIYINQLSKHSLYFLGYFSSMRPNLSVVRSQMLENSFIMDNAMKKLDTLVPIIPLIVSLAKVKFCNALGHPISKSTWADSSDFDIIDRFVRICRNISHYYSGSSRKKSLYRIKYILRLSCVKTLARKHKSTVRTFLKRFGSKLLEEFFTEEEQIRSLIFPRASYTLNKFYRGRIWYFDIFYINDLVNHE</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Maturase K OS=Spiraea cantoniensis GN=matK PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Spiraea cantoniensis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="141007"/>
</DBSequence>
<DBSequence id="DBSeq_1_SYE_STREM" length="481" searchDatabase_ref="SDB_SwissProt" accession="SYE_STREM" >
<Seq>MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRHVEDGERSQLENLRWLGIDWDESPETHERYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQEAAGETPRYVNEYLGMSADEKAAYIAEREAAGIVPTVRLAVNEAGIYKWTDMVKGDIVFEGGNVGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPVFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEAEIFSREQLIALFDESRLSKSPAAFDQKKMDWMSNEYFKHADLGAVYALCKPFLEAAGRLTEKAEKLVELYQPQLSSADEIVPLTDLFFSDFPELTAKEKEVMAAETVPTVLKAFKEKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREQSIEHIANML</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Glutamyl-tRNA synthetase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gltX PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Streptococcus equi subsp. zooepidemicus MGCS10565"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="552526"/>
</DBSequence>
<DBSequence id="DBSeq_1_RMD6_YEAST" length="231" searchDatabase_ref="SDB_SwissProt" accession="RMD6_YEAST" >
<Seq>MSACPCNIVILPVEILKNSSKDTKYSLYTTINRGYDVPRLKYGIIVSPRVHSLETLFSDLGFDKNIEKSSLYLLLNDPTLAYPNFHEHFEQLKGETNKDLSLPTYYIPKVQFLTEAFDSEHTLATIGYKPNNKESYEITGFTSMGNGYGIKLFNYSVIHMMRSHKCKRVVADIIMEHDLLGYYEKKLGFVEVQRFKVLKEQHQVKVFDDKVDFTKDFHVIKMIKELGNHRL</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Sporulation protein RMD6 OS=Saccharomyces cerevisiae GN=RMD6 PE=2 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Saccharomyces cerevisiae"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="4932"/>
</DBSequence>
<DBSequence id="DBSeq_1_BRIX_AERPE" length="180" searchDatabase_ref="SDB_SwissProt" accession="BRIX_AERPE" >
<Seq>MTTSRRPSPRIRSFVKDLSATIPGAFRFTRGHYSMEELAREAIIRGADRIVVVGERRGNPGIIRVYAVEGPERPDNIVSFIVKGVSLSRERRWGLPSLRGGEVLVARPLDSGVAVEFADAFVIAFHARLKPPEAAGYVEAVIESLDARTVAVTFRYGGAPVGPMLRLGKPAEMVKRGRRV</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Probable brix domain-containing ribosomal biogenesis protein OS=Aeropyrum pernix GN=APE_1443.1 PE=1 SV=2" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Aeropyrum pernix"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="56636"/>
</DBSequence>
<DBSequence id="DBSeq_1_PP438_ARATH" length="521" searchDatabase_ref="SDB_SwissProt" accession="PP438_ARATH" >
<Seq>MPPSLPSLQLRRLLLRSFISSSSVNTLQSQPRIISSKPLFSPLPPSRSSIFSTFPSRFFSSETNAESESLDSNEIALSFSKELTGNPDAESQTISQRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNFSHTDETVSFFVDYFGRRKDFKGMLEIISKYKGIAGGKTLESAIDRLVRAGRPKQVTDFFEKMENDYGLKRDKESLTLVVKKLCEKGHASIAEKMVKNTANEIFPDENICDLLISGWCIAEKLDEATRLAGEMSRGGFEIGTKAYNMMLDCVCKLCRKKDPFKLQPEVEKVLLEMEFRGVPRNTETFNVLINNLCKIRRTEEAMTLFGRMGEWGCQPDAETYLVLIRSLYQAARIGEGDEMIDKMKSAGYGELLNKKEYYGFLKILCGIERLEHAMSVFKSMKANGCKPGIKTYDLLMGKMCANNQLTRANGLYKEAAKKGIAVSPKEYRVDPRFMKKKTKEVDSNVKKRETLPEKTARKKKRLKQINMSFVKKPHNKMRRRM</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Pentatricopeptide repeat-containing protein At5g60960, mitochondrial OS=Arabidopsis thaliana GN=At5g60960 PE=2 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Arabidopsis thaliana"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="3702"/>
</DBSequence>
<DBSequence id="DBSeq_1_HSLV_RHILO" length="177" searchDatabase_ref="SDB_SwissProt" accession="HSLV_RHILO" >
<Seq>MHATTIVTVRKGNKVVIAGDGQVSLGQTIMKGNARKVRRIGKGGNVIAGFAGATADAFTLLERLEAKLEQYPDQLTRACVELAKDWRTDRYLRRLEAMMLVADKSVSLALTGTGDVLEPEHGVMAIGSGGNYALAAARALMDTDKDAEEIARKAMQIASDICVYTNNNFVVETLDAA</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="ATP-dependent protease hslV OS=Rhizobium loti GN=hslV PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mesorhizobium loti"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="381"/>
</DBSequence>
<DBSequence id="DBSeq_1_METE_VIBHA" length="760" searchDatabase_ref="SDB_SwissProt" accession="METE_VIBHA" >
<Seq>MTTTTHILGYPRIGEKRELKFAQEKYWRGEIEQTELKQVGATLREKNWATQAEAGLSFATAGDFAWYDHVLTTTLLLGHTPKRHANGFPDLDTLFKVGRGQSQAGCGCSGAAASDMTKWFNTNYHYIVPEFSKDDSFEVSWPQLFEEVNDAIKLGHNVKPVLLGPLSYLYLGKEIEEDFDRLTLLPRLLTAYQAILSKLANQGVEWVQIDEPILSLELEEKWGDAFKLAYQVIRSDVKVLLTTYFDSVSDTLDKIVELPVDGLHIDLSASPEQLDEVVEKLPQGWVLSAGVVNGRNVWRSDLSAQRERLQPVKDKLGDNLWVASSCSLLHSPVDLDLEPALSDEVKSWFAFAKQKVTEVALLGRALDGDHNAILVCDTYSQPIKDRKTAAHVNKPHVQARLNSISASLTERSAPYAERAAHQAEVLGLPLLPTTTIGSFPQTSEIRVQRSAFRSGQLSTDDYHQALKGHIADAVRRQEALDLDVLVHGEAERNDMVEYFAENLAGFQTTKFGWVQSYGSRCVKPAIVVADIEREKPITVEWSTYAQSLTNKQMKGMLTGPVTILCWTFPREDITRKAIADQLALALRDEVSDLQQAGINIIQIDEPAIREGLPLKKRDHKAYLQWAVDAFKIAAASAKPETQIHTHMCYSEFNEIIDSVAALDADVITIETSRSNMELLKAFEDFNYPNEIGPGVYDIHSPNIPSEEWIEELIKKAAEKIPAQRLWVNPDCGLKTRNWSETEAALANLVSAAKKLRAELV</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio harveyi GN=metE PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Vibrio harveyi"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="669"/>
</DBSequence>
<DBSequence id="DBSeq_1_LEPA_LEGPA" length="610" searchDatabase_ref="SDB_SwissProt" accession="LEPA_LEGPA" >
<Seq>MLFARRLEQLKDLNRIRNFSIIAHIDHGKSTLADRFIQICGGLTEREMSSQVLDSMDIERERGITIKAQCVSLNYTAKDGKTYLLNFIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTLAVCYTAIDQSLTVLPVLNKIDLPQAEPERVISEIEDIIGLDAQDAIRVSAKSGLGVNDVLEALVANIPPPKGDVHAPLQALIIDSWFDSYLGVVSLVRIVNGAIRKGDKMRVMSTGRAYEVDQVGIFTPKRTKLDALYAGEVGYVVAGIKEIQGAPVGDTLTLDRNPADKVLPGFQRVKPQVYAGLFPVSSDDFEAFREALAKLSLNDASLFYEPESSEALGFGFRCGFLGMLHMEIIQERLEREYNLDLISTAPTVVYQIVTQKGETLLIDNPSHLPPTPQIKEMYEPIVRANILVPQDYLGPIITLCVERRGVQVSMTYSGRHVSVVYDIPMSEVVSDFFDRLKSVSRGYASLDYNFQRFQIADLVKMDILINSERVDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIARQTVKALRKNVTAKCYGGDVTRKRKLLEKQKAGKKRMKQVGHVEIPQEAFMAVFQTDKKK</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="GTP-binding protein lepA OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Legionella pneumophila str. Paris"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="297246"/>
</DBSequence>
<DBSequence id="DBSeq_1_PSTS_ECOLI" length="346" searchDatabase_ref="SDB_SwissProt" accession="PSTS_ECOLI" >
<Seq>MKVMRTTVATVVAATLSMSAFSVFAEASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Phosphate-binding protein pstS OS=Escherichia coli (strain K12) GN=pstS PE=1 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Escherichia coli K-12"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="83333"/>
</DBSequence>
<DBSequence id="DBSeq_1_PSTS_SHIFL" length="346" searchDatabase_ref="SDB_SwissProt" accession="PSTS_SHIFL" >
<Seq>MKVMRTTVATVVAATLSMSAFSVFAEASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Phosphate-binding protein pstS OS=Shigella flexneri GN=pstS PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Shigella flexneri"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="623"/>
</DBSequence>
<DBSequence id="DBSeq_1_VMTH_LAMBD" length="853" searchDatabase_ref="SDB_SwissProt" accession="VMTH_LAMBD" >
<Seq>MAEPVGDLVVDLSLDAARFDEQMARVRRHFSGTESDAKKTAAVVEQSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGMIPMFRGLAGAITLPMVGATSLAVATGALAYAWYQGNSTLSDFNKTLVLSGNQAGLTADRMLVLSRAGQAAGLTFNQTSESLSALVKAGVSGEAQIASISQSVARFSSASGVEVDKVAEAFGKLTTDPTSGLTAMARQFHNVSAEQIAYVAQLQRSGDEAGALQAANEAATKGFDDQTRRLKENMGTLETWADRTARAFKSMWDAVLDIGRPDTAQEMLIKAEAAYKKADDIWNLRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQQQSDTEASRLKYTEEAQKAYERLQTPLEKYTARQEELNKALKDGKILQADYNTLMAAAKKDYEATLKKPKQSSVKVSAGDRQEDSAHAALLTLQAELRTLEKHAGANEKISQQRRDLWKAESQFAVLEEAAQRRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQERLNALAQQADKFAQQQRAKRAAIDAKSRGLTDRQAEREATEQRLKEQYGDNPLALNNVMSEQKKTWAAEDQLRGNWMAGLKSGWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Minor tail protein H OS=Enterobacteria phage lambda GN=H PE=4 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Enterobacteria phage lambda"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="10710"/>
</DBSequence>
<DBSequence id="DBSeq_1_RRF_BORA1" length="186" searchDatabase_ref="SDB_SwissProt" accession="RRF_BORA1" >
<Seq>MSVADIRNSAESRMSKSLDTLKVNLSKIRTGRAHAGILDHVQVEYYGSPVPVGQVANLNLVDARTISVQPYEKHMAGPIERAIRDSDLGLNPVSLGDTIRVPMPALTEERRRDLTKVVRSEGEDAKVAVRNLRREANEALKKLVKDKIISEDDERRGQDEVQKLTDRAVADIDKMVTQKEAEIMTV</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Ribosome-recycling factor OS=Bordetella avium (strain 197N) GN=frr PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Bordetella avium 197N"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="360910"/>
</DBSequence>
<DBSequence id="DBSeq_1_PTH_SPHAL" length="189" searchDatabase_ref="SDB_SwissProt" accession="PTH_SPHAL" >
<Seq>MQLWVGLGNPGPKYAMHRHNVGFMAADVIAEIHDFPPPVKKFQGWLQDGRIGSTRILLLKPGTFMNESGRSVRAALDFYKLAATDVTVFYDELDLAPMKVKVKRGGGAAGHNGIRSMIQHIGDDFRRIRIGIGHPGHKDRVTGHVLGNYHKSEMEPLADLLGAIAAEAEWLAKGDDVRFQSDLALRLQG</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Peptidyl-tRNA hydrolase OS=Sphingopyxis alaskensis GN=pth PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Sphingopyxis alaskensis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="117207"/>
</DBSequence>
<DBSequence id="DBSeq_1_STAD_SOLTU" length="393" searchDatabase_ref="SDB_SwissProt" accession="STAD_SOLTU" >
<Seq>MALNINGVSLKSHKMLPFPCSSARSERVFMASTIHRPSVEVGSVKKAFTPPREVHVQVTHSMPPEKIEVFDSLRDWAAQNLLVHLKPVEKCWQPTDFLPDPASEGFDEQVKELRERCKEIPDDYFVVLIGDMITEEALPTYQTMINTLDGVRDETGATVTPWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMKQIEKTIQYLIGSGMDPRTENNPYLGFVYTSLRKGVTFVSHGNTARLAKEHGDMKLAQICGSIAADEKRHETAYTKIVEKLLEVDPDGAVLAIGDMMRKNISMPAHLMYDGRDDNLFEHFSAVAQRLGVYTAKDYADILEFHVGRWEVEKLTGLSSEGRRAQDYVCGLAPRIRKLEERAQARAKHAKSVPFSWIFGKEIKL</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Acyl-[acyl-carrier-protein] desaturase, chloroplastic OS=Solanum tuberosum PE=2 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Solanum tuberosum"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="4113"/>
</DBSequence>
<DBSequence id="DBSeq_1_TPL_CITFR" length="456" searchDatabase_ref="SDB_SwissProt" accession="TPL_CITFR" >
<Seq>MNYPAEPFRIKSVETVSMIPRDERLKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQEQGFENKSIAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRSMERGIISAGRNNVTGEHHRPKLETVRLTIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPKQLRFFTARFDYI</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Tyrosine phenol-lyase OS=Citrobacter freundii GN=tpl PE=1 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Citrobacter freundii"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="546"/>
</DBSequence>
<DBSequence id="DBSeq_1_TPL_ESCIN" length="456" searchDatabase_ref="SDB_SwissProt" accession="TPL_ESCIN" >
<Seq>MNYPAEPFRIKSVETVSMIPRDERLKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQEQGFENKSIAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRSMERGIISAGRNNVTGEHHRPKLETVRLTIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPKQLRFFTARFDYI</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Tyrosine phenol-lyase OS=Escherichia intermedia GN=tpl PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Citrobacter intermedius"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="66695"/>
</DBSequence>
<DBSequence id="DBSeq_1_RUVB_HAMD5" length="333" searchDatabase_ref="SDB_SwissProt" accession="RUVB_HAMD5" >
<Seq>MIEIDRLVSTDVLNENEALVDRAIRPKRLDEYVGQSHVRDQMQIFIQAAKQRGDALDHLLIFGPPGLGKTTLANIVAHEMGVNLRTTSGPVLEKAGDLAALLTHLEPRDALFIDEIHRLSPVVEEILYPAMEDYQLDIMIGEGPGARSIKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYSVPDLEHIVSRSARCLQLPLTKNGAHQLALRSRGTPRIINRLLRRVRDFAEVKGEGKINTEIAIKALEMLNVDKEGLDYMDSKLLLAIIEKFQGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFIQRTPRGRIATQHAYQHFICGG</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Holliday junction ATP-dependent DNA helicase ruvB OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=ruvB PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="572265"/>
</DBSequence>
<DBSequence id="DBSeq_1_RRF_ALCBS" length="185" searchDatabase_ref="SDB_SwissProt" accession="RRF_ALCBS" >
<Seq>MIDDIRSDAQSRMKKSLEALDTAMKRVRTGRAHPSLLDNITIEYYGAETPLNQMGNISVEEGRTLTISPFDKSLIPQIERAILMSDLGLNPSTSGTLIRLPLPPLTEETRRDLVKVVRAEAEQARVSIRNIRRDANSDLKELLKEKEISEDEQRRGEEQIQQLTDKMVAEVEGVLKEKEEELMTV</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Ribosome-recycling factor OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=frr PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Alcanivorax borkumensis SK2"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="393595"/>
</DBSequence>
<DBSequence id="DBSeq_1_FABP_CLOSI" length="133" searchDatabase_ref="SDB_SwissProt" accession="FABP_CLOSI" >
<Seq>MSAFIGSWKLCESQNFDEFLRELGVNFFIRKAASTSKPTITFDKFGDNGLKMKTETILKTTEQSFTFGEEFDETTIDGRQVKSTVTRDSDTQLTQVQKHDDGNTVIVRKIEGDMMVTTATFKNITSVRKYQRH</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Fatty acid-binding protein OS=Clonorchis sinensis PE=2 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Clonorchis sinensis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="79923"/>
</DBSequence>
<DBSequence id="DBSeq_1_EF2_ARCFU" length="728" searchDatabase_ref="SDB_SwissProt" accession="EF2_ARCFU" >
<Seq>MARAKKVDKIKELMWKPKFIRNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGQQLYLDFDEQEQERGITINAANVSMVHEYEGQDYLINLIDTPGHVDFGGDVTRAMRAVDGVIVVVDAVEGVMPQTETVLRQALKENVKPVLFVNKVDRLIKELELTPQQMQERLIKVITEVNKLIKAMRPDKYSEWKIDVANGSAAFGSALYNWAVSVPSQKKTGIGFKEVYEHIKEGKVKELAKKSPLYQVVLDMVIRHLPSPIEAQKERIAVIWKGDINSEVGKAMVNCDPKGPVALMITKIVVEPQAGEIAVGRLYSGTIRPGMELYIVDRKAKNRIQTVGLYMGPRRVEVDEIPAGNIVAVIGLKDAVAGSTCTTVENLTPFESIKHYSEPVVTMAIEAKNPRDLPKLIEVLRKLAKEDPTLHITLNEETGEHLISGMGELHLEVKVEKIRRDYKLDVITSPPIVVFRETVTGTSPVVEGKSPNKHNRFYIVVEPLPEKVIQMFKEGVVDMKMDKKERRRLLQEAGLTSEEAAGAEEYYEGNLFCDVTKGIQYLNETMELILEGFREAMRAGPIAREPCMGIKVKLVDCKLHEDAVHRGPAQVIPAVRSAIFAAILQAKPALLEPYQKIFITVPQDMMGAVTREIQGRRGQILEMKTEGDMVTIIAKAPVKEMFGFAGAIRGATSGKAIWSTEHAGFELVPQNLFQEFVMEVRKRKGLKLEMPKPEDFVGL</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Elongation factor 2 OS=Archaeoglobus fulgidus GN=fusA PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Archaeoglobus fulgidus"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="2234"/>
</DBSequence>
<DBSequence id="DBSeq_1_IF2P_METTP" length="602" searchDatabase_ref="SDB_SwissProt" accession="IF2P_METTP" >
<Seq>MRQRSKKGMRSKEEVSQLRTPIVCVMGHVDHGKTTLLDRIRGTTVAQYEAGAITQHIGATEIPLSVIQQFCGSGFKANLMVPGLLFIDTPGHHAFTSLRSRGGSLADLAILIVDINEGFQPQTIESINILKRFKTPFVVAANKIDRIPGWRPVENAPMEKSLAGQTERVVETLETKIYELVGELYKYGFDSNRYDRIADFTKTVGIIPVSAITGEGIPDLLLVLVGLAQRFLKQNLVIESSRPGMGTILEVKEERGLGTTLDVILYDGMISVGDTIVVGTPREPIITKVRALLKPRPLKEIRSEERFTPVKHVVAASGIKVSAPKLETALAGSTIRVVGEGEDPEAIAKEIRSEIEAVRIDTDTVGVILKADTIGSLEGLVGELRAKNIPIHVADVGPVTRRDVIRAAAIKDPLLSVILGFNVEILPDALSEIQKLDIPVFQSDVIYTLLESYEEWMEEKKMQMEQERLEAIVKPGCVRILPDCVFRQSKPAIVGVQVVGGTISHNVPLIREDGAVVGTIRGIQQRNENIPMATVGQEVAISIDGPTVGRQIHEGDLLYVNIPEKHARIIEQELKQKMSQDEIEVFEKFLEIKRKKDMFWGR</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Probable translation initiation factor IF-2 OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=infB PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Methanosaeta thermophila PT"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="349307"/>
</DBSequence>
<DBSequence id="DBSeq_1_AROA_STRP4" length="427" searchDatabase_ref="SDB_SwissProt" accession="AROA_STRP4" >
<Seq>MKLKTNIRHLHGSIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIEDKDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKGTKNLRPIHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDGKKITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSATLIVESSDLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGKSALHGARVNTFGDHRIGMMTAIAALLVADGEVELDRAEAINTSYPSFFDDLESLIHG</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="3-phosphoshikimate 1-carboxyvinyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=aroA PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Streptococcus pneumoniae G54"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="512566"/>
</DBSequence>
<DBSequence id="DBSeq_1_AROA_STRPN" length="427" searchDatabase_ref="SDB_SwissProt" accession="AROA_STRPN" >
<Seq>MKLKTNIRHLHGSIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIEDKDGVITIQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKGTKNLRPIHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLKQFGGHLSVDGKKITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSATLIVESSDLKGTEIGGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGKSALHGARVNTFGDHRIGMMTAIAALLVADGEVELDRAEAINTSYPSFFDDLESLIHG</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="3-phosphoshikimate 1-carboxyvinyltransferase OS=Streptococcus pneumoniae GN=aroA PE=1 SV=2" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Streptococcus pneumoniae"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="1313"/>
</DBSequence>
<DBSequence id="DBSeq_1_SYA_THET2" length="882" searchDatabase_ref="SDB_SwissProt" accession="SYA_THET2" >
<Seq>MRTAEIREKFLSFFEGKGHLRLPSFSLIPEDDPSLLFTSAGMAPLKPYFLGAKPIFGGREWRRVTTCQECLRVGDIENVGRTSRHNTYFEMLGNFSFGDYFKKEAILWAWEFLTEHLRLDPGRLWVTVFEDDDEAYEIWRDLVGVPEERIGRFGEDENYWPGGAITHGPNGPSGPCSEIFYDRGPAYGTPDETGPNTGSGDRFVEIWNLVFTQYDRQGPIPGPGILKPLPQKNIDTGMGLYRVAAILQDVEDFYRTDTFFPIIQEVARMSGRPYEGKTSVSHRVIADHVRAVVAALSDGATFSNTGRGYVIRRLLRRALRHGYLLGLSDPFLHRLAPLVAELLGDFYPEMRENLPAVEKQIRLEEERFLETLEGGLKRLDALLSGLKPGEVLPGKEAFRLYDTYGFPLDLTVEIAAERGYGVDTEGFQKAMEEQQSRSRAAMAFEREIFKKGAQVLEELYAERGATEFLGYNALEAEAEVLALLAGDQSLLEAGPGTEVQVVLDKTPFYAEGGGQIGDFGLLEWPGGRARVETTRKTERGIFLHKARVEEGVLRVGERVRAVVDPRRRDTERNHTATHLLHAALRAVLGPHVRQAGSLVAPDRLRFDFTHPEPLKPEELERVELLVNRWIMADFPVTWRYMPLEEARKEGAMALFGEKYGEVVRVVRVEGSPLEGLESKELCGGCHVRRTGEIGAFLIRSEEAVSAGVRRIEAVTGEEAIRFARGSLNRLKALAERLEVGEAALEERLEKLLAELKEKEREVESLKARLVQAALGGGGGASLEEKGGLRWTVAELPGLDAKALRQAADDLVARGADVALVLSGGQAVLKLSPKAQGMGLEAGALFRALAEKAGGRGGGKGALAQGGGLDPRKAREALPGLLP</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Alanyl-tRNA synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=alaS PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Thermus thermophilus HB27"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="262724"/>
</DBSequence>
<DBSequence id="DBSeq_1_YQB6_CAEEL" length="1100" searchDatabase_ref="SDB_SwissProt" accession="YQB6_CAEEL" >
<Seq>MESGDHLGNLFDDMVEEDNDEDSFEEPACEDSFDSQEASSKANEPQNDSFDEPIQSSVSKQSDDANGEDEINEEVIQEQKELDLNEEDFNLLTIEEVPLDVLTARIRRVFTEVTYRAEPAAIALFDVAHKIIFKSTMLDCKRNTVIDSIIEGLISIIVDERERDQGAEEAEHVLMIFIAKLAIKNKSMKCSDLLYKLILLVDRLYLHADSFVRCRIYRLIACLMEEANRYADVMREHGDDAFLSDEDPTESEVMIPSGVKNRWMGKLAKSLLDKSPEVRCKAVIALSLWDHDIECKTTCCDEVTVNDLLWKSVHDVDESVRVNAARRVHIANENDIDKCIDYVETSKDNRVKQAIIVRLASDVSLLSFSEKQRFRLVNLLNNSDSARVQDVIHQLLVESWMKVAGDEIISPSIFPFPDSDNNNIPKEFPSIILEYLDPLVDPTAVYVFMKFATVRFIQKSTVQQACGSLDVEKFMKDLLSMTIPDCERVGLMRRTTFRLIPKDNNDGNEDIRKIFSRIFISRCFVDVIFNFAKGRLDATHLRSRALTFFLPDVTTFVEHLEKFCDAYFHRNMSTDYTCKDLVLYNLLHLMNVATKYGDLHDDKMLYKHALKKILGNSSFVFSNDVKQLCDWMCDTAKQLMLSHEEVLNLEEAMKNDKVLEQMYLRSATMLLATCKHEEVESPTASMSSLFKTIIPALLGNKNEELQQLGLELIGFATSIDFENCEPYLKLTTLLIQRGDEVLTSTGVNTLIKVIKSQGFPKTANAIFQGEEQTEDDCQDALAKVFEKALVSLQGMALVQSVQDCLSMLSYGRYAWSKLMCAIIMLVFQKSNECLPLVKIFASYCKKSIRSDFNKMNLLLGFCRAVGIISKTGEDDSNIKLLEMTELVCECISSVHTIDGDEVIPQKKRKTDNEEELYPEIVLANRMVGRANSHPSSWIIRHVFTAMATSLRLECVPMKIVDTLHELLVDTYTVVRFNSNKTTQIAFKRFLTHCEKVITLHERMNALKLGVDFKKVKKEVICADEDPKSVSSSSSLGRKRGRKRENSEEEEKIDADDSFELFQYVPKSTRTRIRPTVNVEEDQNIKTEIEDSDDLEDSFEL</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Uncharacterized protein C30G12.6 OS=Caenorhabditis elegans GN=C30G12.6 PE=2 SV=2" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Caenorhabditis elegans"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="6239"/>
</DBSequence>
<DBSequence id="DBSeq_1_ATPD_STAHJ" length="179" searchDatabase_ref="SDB_SwissProt" accession="ATPD_STAHJ" >
<Seq>MANVANKYAKALFDVAIDKDRLDLMYDELSEVSEATKNYGEDLRAIDSNPNQPASERRKFVGIVFGDANYYLKNMLMILANNRHLVLINSIFKEFKSLYNEYHNEDSAIVESVYQLSDEELDRIKDLILKQTNLSQVHITTKINPELIGGFRVKVGTTVLDGSVKKDLEQIERKFRRVN</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="ATP synthase subunit delta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpH PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Staphylococcus haemolyticus JCSC1435"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="279808"/>
</DBSequence>
<DBSequence id="DBSeq_1_HIG2A_HUMAN" length="106" searchDatabase_ref="SDB_SwissProt" accession="HIG2A_HUMAN" >
<Seq>MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="HIG1 domain family member 2A OS=Homo sapiens GN=HIGD2A PE=1 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_1_MED27_DANRE" length="311" searchDatabase_ref="SDB_SwissProt" accession="MED27_DANRE" >
<Seq>MADVMNVGVNLEAFSQAINAIQALRSSVTRVFDFLKDGMKNKETLESREKVFITEFQENLQSVNRDLNELERLSTLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQMGTSAKRRPKVQPSTLALPTQYVDDVISRIGRMFPDMSIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTIVRGFHENIYTEDRKLDIWSKSNYQAFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQTPCQRCGKYLQEGLPPTWRDFRTLEAFHDTCRQ</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Mediator of RNA polymerase II transcription subunit 27 OS=Danio rerio GN=med27 PE=2 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Danio rerio"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="7955"/>
</DBSequence>
<DBSequence id="DBSeq_1_PSTB_MYCS2" length="258" searchDatabase_ref="SDB_SwissProt" accession="PSTB_MYCS2" >
<Seq>MAKRLDLKDVNIYYGAFHAVADVSLAVQPRSVTAFIGPSGCGKSTVLRTLNRMHEVIPGARVEGSVLLDGEDIYGPGVDPVGVRKTIGMVFQRPNPFPTMSIRDNVVAGLKLQGVRNKKTLDEVAERSLRGANLWNEVKDRLDKPGGGLSGGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIATLKLDYTIVIVTHNMQQAARVSDQTAFFNLEATGKPGRLIEIDDTEKIFSNPRQKATEDYISGRFG</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Phosphate import ATP-binding protein pstB OS=Mycobacterium smegmatis GN=pstB PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mycobacterium smegmatis str. MC2 155"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="246196"/>
</DBSequence>
<DBSequence id="DBSeq_1_PSTB_MYCSM" length="258" searchDatabase_ref="SDB_SwissProt" accession="PSTB_MYCSM" >
<Seq>MAKRLDLKDVNIYYGAFHAVADVSLAVQPRSVTAFIGPSGCGKSTVLRTLNRMHEVIPGARVEGSVLLDGEDIYGPGVDPVGVRKTIGMVFQRPNPFPTMSIRDNVVAGLKLQGVRNKKTLDEVAERSLRGANLWNEVKDRLDKPGGGLSGGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIATLKLDYTIVIVTHNMQQAARVSDQTAFFNLEATGKPGRLIEIDDTEKIFSNPRQKATEDYISGRFG</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Phosphate import ATP-binding protein pstB OS=Mycobacterium smegmatis GN=pstB PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Mycobacterium smegmatis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="1772"/>
</DBSequence>
<DBSequence id="DBSeq_1_SECA2_ALKMQ" length="795" searchDatabase_ref="SDB_SwissProt" accession="SECA2_ALKMQ" >
<Seq>MLKNISSVSKRFENFKNKEVYDIELYKKTVEEINNINYKNASDTELREISENLKNKVKEGIPLDEVLIQAFTLVKEVAGRVVGMTPYDVQKMAAIALHQGKVVEMQTGEGKTLSAVMPAYLNALSGKGVHILTFNDYLAERDFRWMGPIYKFLGLSCGFVKENMNLEERRKAYLKDITYVTARESGFDYLRDFLCTEVKDLVHRPFNYAILDEADSILIDEARIPLVIAGNVSEEGFNYDHLIEIVRSLKPNVDYEIDQHHHNVVLTEKGLIKIEKVSGCGNLYASENLQLLTRLNCVLHAEILLKKEIDYIVRKGKIEIIDEFTGRVADKRHWPDSLHEAVEAKEGLVSETKGRIMGSIALQYFLKLYPKLAGMTGTAISVMNELDRMYQLKVVLIPTNKPCIRKDYPDKIFTCKEIKEKTLILEIKNINATGQPILIGTSSVEESERIATTLNTEGIKCNVLNAKNDWEEAKIIAEAGKYGAVTVSTNMAGRGIDIKLGGEKELDRKKVVTKGGLYVIGTSRHESSRIDNQLRGRAGRQGDPGESKFFISLEDDLIKKYEIDKMIPQEYYTQKQSESLDNTMINRKINSGQRIVEGYNSDIRKQLWEYSYVIEEQRRIIHQKRHEILVDREPLSLLSNKCPVLYDRYLDLVGKDVLYKVEKQITLFHINKCWAEYLEYVSYIREGIHLVVIGKENPLHRFQSITIEAFNDMLDNIEKDIIETFIKANVTKDGVDIEKEKLKGPSSTWTYLISDSPNQFSRLPFIVKGVLFSLRSISNGIVRKVQETINVVIQK</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Protein translocase subunit secA 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=secA2 PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Alkaliphilus metalliredigens QYMF"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="293826"/>
</DBSequence>
<DBSequence id="DBSeq_1_APMAP_HUMAN" length="416" searchDatabase_ref="SDB_SwissProt" accession="APMAP_HUMAN" >
<Seq>MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Adipocyte plasma membrane-associated protein OS=Homo sapiens GN=APMAP PE=1 SV=2" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Homo sapiens"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="9606"/>
</DBSequence>
<DBSequence id="DBSeq_1_CA089_XENLA" length="249" searchDatabase_ref="SDB_SwissProt" accession="CA089_XENLA" >
<Seq>MSVTPVLDPEWQRSPEGLDYLSRVLRHNKRKFFGLIERPVLPPHLPADVAAYKVFVCGKSGVGKTSFIAKLSGLAVPSMHHETAGIQTTCMYWPVRPSGSARPVIFRFQFWDCGEGALRKFDHILPACKEKADAVLFLFSFTDRSSFEDVPALISRTLDQDEDVTRVVIGTKLDQYMHTDVTEDDLRDFQRTWQLPVMRVRSVNGPRMTDGRDLDGRAGLAECAPVLNGLAEILWHRDQVIAGLVGGAE</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Miro domain-containing protein C1orf89 homolog OS=Xenopus laevis PE=2 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Xenopus laevis"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="8355"/>
</DBSequence>
<DBSequence id="DBSeq_1_SECA_MESSB" length="910" searchDatabase_ref="SDB_SwissProt" accession="SECA_MESSB" >
<Seq>MVSLGGLARKIFGSSNERRVRALQPRAEQIGALEKEMQALSDEALRGKTDEFRKKLADGADLDDLLVPAFAVVREAARRVLGLRPFDVQLIGGMVLHQGAIAEMKTGEGKTLVATLPVYLNALTGKGVHVVTVNDYLARRDAEWMGRVYGFLGLTTGVIVHGLSDEERRAAYACDVTYATNNELGFDYLRDNMKYERAQMVQRGHAYAIVDEVDSILVDEARTPLIISGPLDDRSELYNTIDTFILKLEPADYEVDEKQRTATFTEEGTEKVENLLREANLFKGDSLYDVENVAIVHHLNNALKAHRLFQRDKDYIVRNDEVIIIDEFTGRMMPGRRYSDGLHQALEAKEHVKIQPENQTLASITFQNYFRMYGKLAGMTGTASTEAEEFGNIYGLDVVEIPTNLPVSRIDEDDEVYRTVEEKYRAIVREIKEAREKGQPILVGTTSIEKSEYLAERLRKDGLKDFEILNARHHEREAYIVSQAGKPGAITIATNMAGRGTDIQLGGNADMRIHQELGDMPAGPERDAKEKAIREDVQRLKEKALAAGGLYVLATERHESRRIDNQLRGRSGRQGDPGRSKFFLSLQDDLMRIFGSDRMDGMLQKLGLKEDEAIVHPWINKALEKAQKKVEARNFDIRKNLLKYDDVMNDQRKVVFEQRIELMDGENLSETVAEMRQDVIDDLVERHIPANAYAEQWDAKGLKEGVLQYLNLDLPIDEWVKEEGIAEDDIRERITEAANKAAAERAERFGPDIMTYVEKSIVLQTLDHLWREHLVNLDHLRSVIGFRGYAQRDPLNEYKSEAFELFQAMLGNLRQAVTAQLMRVELVREAAEAPPPPAPPAMQAHHLDATTGEDEFANGDTMTLARADARIVPAEQRDPNDPSTWGKVGRNEACPCGSGKKYKHCHGTFA</Seq>
<cvParam accession="MS:1001088" name="protein description" cvRef="PSI-MS" value="Protein translocase subunit secA OS=Mesorhizobium sp. (strain BNC1) GN=secA PE=3 SV=1" />
<cvParam accession="MS:1001469" name="taxonomy: scientific name" cvRef="PSI-MS" value="Chelativorans sp. BNC1"/>
<cvParam accession="MS:1001467" name="taxonomy: NCBI TaxID" cvRef="PSI-MS" value="266779"/>
</DBSequence>
<Peptide id="MKQK_000000">
<PeptideSequence>MKQK</PeptideSequence>
</Peptide>
<Peptide id="SLPPR_0000000">
<PeptideSequence>SLPPR</PeptideSequence>
</Peptide>
<Peptide id="AGFEVR_00000000">
<PeptideSequence>AGFEVR</PeptideSequence>
</Peptide>
<Peptide id="TFRQK_0000000">
<PeptideSequence>TFRQK</PeptideSequence>
</Peptide>
<Peptide id="QTFGVK_00000000">
<PeptideSequence>QTFGVK</PeptideSequence>
</Peptide>
<Peptide id="GNYVVK_00000000">
<PeptideSequence>GNYVVK</PeptideSequence>
</Peptide>
<Peptide id="YQSER_0000000">
<PeptideSequence>YQSER</PeptideSequence>
</Peptide>
<Peptide id="RDTYK_0000000">
<PeptideSequence>RDTYK</PeptideSequence>
</Peptide>
<Peptide id="LSYDGK_00000000">
<PeptideSequence>LSYDGK</PeptideSequence>
</Peptide>
<Peptide id="EENDNA_00000000">
<PeptideSequence>EENDNA</PeptideSequence>
</Peptide>
<Peptide id="STSEKSK_000000000">
<PeptideSequence>STSEKSK</PeptideSequence>
</Peptide>
<Peptide id="DFFLPK_00000000">
<PeptideSequence>DFFLPK</PeptideSequence>
</Peptide>
<Peptide id="ENGYRK_00000000">
<PeptideSequence>ENGYRK</PeptideSequence>
</Peptide>
<Peptide id="DYVITR_00000000">
<PeptideSequence>DYVITR</PeptideSequence>
</Peptide>
<Peptide id="GFQGAMR_000000000">
<PeptideSequence>GFQGAMR</PeptideSequence>
</Peptide>
<Peptide id="KIGGYNK_000000000">
<PeptideSequence>KIGGYNK</PeptideSequence>
</Peptide>
<Peptide id="LSFSGLR_000000000">
<PeptideSequence>LSFSGLR</PeptideSequence>
</Peptide>
<Peptide id="LDIYQK_00000000">
<PeptideSequence>LDIYQK</PeptideSequence>
</Peptide>
<Peptide id="SLYRIK_00000000">
<PeptideSequence>SLYRIK</PeptideSequence>
</Peptide>
<Peptide id="WTDMVK_00000000">
<PeptideSequence>WTDMVK</PeptideSequence>
</Peptide>
<Peptide id="NSSKDTK_000000000">
<PeptideSequence>NSSKDTK</PeptideSequence>
</Peptide>
<Peptide id="FVRICR_00000000">
<PeptideSequence>FVRICR</PeptideSequence>
</Peptide>
<Peptide id="FIEQEK_00000000">
<PeptideSequence>FIEQEK</PeptideSequence>
</Peptide>
<Peptide id="TVAVTFR_000000000">
<PeptideSequence>TVAVTFR</PeptideSequence>
</Peptide>
<Peptide id="MQEEEK_00000000">
<PeptideSequence>MQEEEK</PeptideSequence>
</Peptide>
<Peptide id="YKGIAGGK_0000000000">
<PeptideSequence>YKGIAGGK</PeptideSequence>
</Peptide>
<Peptide id="AAYIAER_000000000">
<PeptideSequence>AAYIAER</PeptideSequence>
</Peptide>
<Peptide id="ALMDTDK_000000000">
<PeptideSequence>ALMDTDK</PeptideSequence>
</Peptide>
<Peptide id="SAPYAER_000000000">
<PeptideSequence>SAPYAER</PeptideSequence>
</Peptide>
<Peptide id="MLFARR_00000000">
<PeptideSequence>MLFARR</PeptideSequence>
</Peptide>
<Peptide id="VISYWR_00000000">
<PeptideSequence>VISYWR</PeptideSequence>
</Peptide>
<Peptide id="NKSIFSK_000000000">
<PeptideSequence>NKSIFSK</PeptideSequence>
</Peptide>
<Peptide id="SILYDGR_000000000">
<PeptideSequence>SILYDGR</PeptideSequence>
</Peptide>
<Peptide id="TAYIAER_000000000">
<PeptideSequence>TAYIAER</PeptideSequence>
</Peptide>
<Peptide id="DAVYTVR_000000000">
<PeptideSequence>DAVYTVR</PeptideSequence>
</Peptide>
<Peptide id="TDRYLR_00000000">
<PeptideSequence>TDRYLR</PeptideSequence>
</Peptide>
<Peptide id="SLLFCLK_000000000">
<PeptideSequence>SLLFCLK</PeptideSequence>
</Peptide>
<Peptide id="WPIGLGGK_0000000000">
<PeptideSequence>WPIGLGGK</PeptideSequence>
</Peptide>
<Peptide id="GEFVFTK_000000000">
<PeptideSequence>GEFVFTK</PeptideSequence>
</Peptide>
<Peptide id="FEKTFR_00000000">
<PeptideSequence>FEKTFR</PeptideSequence>
</Peptide>
<Peptide id="FYEKIK_00000000">
<PeptideSequence>FYEKIK</PeptideSequence>
</Peptide>
<Peptide id="VAVRNLR_000000000">
<PeptideSequence>VAVRNLR</PeptideSequence>
</Peptide>
<Peptide id="AALDFYK_000000000">
<PeptideSequence>AALDFYK</PeptideSequence>
</Peptide>
<Peptide id="LQPVKDK_000000000">
<PeptideSequence>LQPVKDK</PeptideSequence>
</Peptide>
<Peptide id="FLGLTER_000000000">
<PeptideSequence>FLGLTER</PeptideSequence>
</Peptide>
<Peptide id="NEFDWK_00000000">
<PeptideSequence>NEFDWK</PeptideSequence>
</Peptide>
<Peptide id="GFDDQTR_000000000">
<PeptideSequence>GFDDQTR</PeptideSequence>
</Peptide>
<Peptide id="YRQSER_00000000">
<PeptideSequence>YRQSER</PeptideSequence>
</Peptide>
<Peptide id="IYSRDGK_000000000">
<PeptideSequence>IYSRDGK</PeptideSequence>
</Peptide>
<Peptide id="ELGNHRL_000000000">
<PeptideSequence>ELGNHRL</PeptideSequence>
</Peptide>
<Peptide id="GHIADAVR_0000000000">
<PeptideSequence>GHIADAVR</PeptideSequence>
</Peptide>
<Peptide id="FLSVLER_000000000">
<PeptideSequence>FLSVLER</PeptideSequence>
</Peptide>
<Peptide id="AQFEQLK_000000000">
<PeptideSequence>AQFEQLK</PeptideSequence>
</Peptide>
<Peptide id="VYVAQKR_000000000">
<PeptideSequence>VYVAQKR</PeptideSequence>
</Peptide>
<Peptide id="SPAAFDQK_0000000000">
<PeptideSequence>SPAAFDQK</PeptideSequence>
</Peptide>
<Peptide id="NIQFGER_000000000">
<PeptideSequence>NIQFGER</PeptideSequence>
</Peptide>
<Peptide id="NGKIIYR_000000000">
<PeptideSequence>NGKIIYR</PeptideSequence>
</Peptide>
<Peptide id="VQRSAFR_000000000">
<PeptideSequence>VQRSAFR</PeptideSequence>
</Peptide>
<Peptide id="QVEILNR_000000000">
<PeptideSequence>QVEILNR</PeptideSequence>
</Peptide>
<Peptide id="LALEAARK_0000000000">
<PeptideSequence>LALEAARK</PeptideSequence>
</Peptide>
<Peptide id="YLYLSGR_000000000">
<PeptideSequence>YLYLSGR</PeptideSequence>
</Peptide>
<Peptide id="VFYDATR_000000000">
<PeptideSequence>VFYDATR</PeptideSequence>
</Peptide>
<Peptide id="AENILPSK_0000000000">
<PeptideSequence>AENILPSK</PeptideSequence>
</Peptide>
<Peptide id="VFYSLMR_000000000">
<PeptideSequence>VFYSLMR</PeptideSequence>
</Peptide>
<Peptide id="GLLSAEVAR_00000000000">
<PeptideSequence>GLLSAEVAR</PeptideSequence>
</Peptide>
<Peptide id="CLQLPLTK_0000000000">
<PeptideSequence>CLQLPLTK</PeptideSequence>
</Peptide>
<Peptide id="IGIGHPGHK_00000000000">
<PeptideSequence>IGIGHPGHK</PeptideSequence>
</Peptide>
<Peptide id="DGILPLYK_0000000000">
<PeptideSequence>DGILPLYK</PeptideSequence>
</Peptide>
<Peptide id="VPVDVAYR_0000000000">
<PeptideSequence>VPVDVAYR</PeptideSequence>
</Peptide>
<Peptide id="RDANSDLK_0000000000">
<PeptideSequence>RDANSDLK</PeptideSequence>
</Peptide>
<Peptide id="EVDSNVKK_0000000000">
<PeptideSequence>EVDSNVKK</PeptideSequence>
</Peptide>
<Peptide id="ELEICRR_000000000">
<PeptideSequence>ELEICRR</PeptideSequence>
</Peptide>
<Peptide id="QVKSTVTR_0000000000">
<PeptideSequence>QVKSTVTR</PeptideSequence>
</Peptide>
<Peptide id="FGINNEPK_0000000000">
<PeptideSequence>FGINNEPK</PeptideSequence>
</Peptide>
<Peptide id="GDINSEVGK_00000000000">
<PeptideSequence>GDINSEVGK</PeptideSequence>
</Peptide>
<Peptide id="EIRSEER_000000000">
<PeptideSequence>EIRSEER</PeptideSequence>
</Peptide>
<Peptide id="GFNSVATAR_00000000000">
<PeptideSequence>GFNSVATAR</PeptideSequence>
</Peptide>
<Peptide id="SDAQSRMK_0000000000">
<PeptideSequence>SDAQSRMK</PeptideSequence>
</Peptide>
<Peptide id="AGISVGQYK_00000000000">
<PeptideSequence>AGISVGQYK</PeptideSequence>
</Peptide>
<Peptide id="ITERFEK_000000000">
<PeptideSequence>ITERFEK</PeptideSequence>
</Peptide>
<Peptide id="RDYVITR_000000000">
<PeptideSequence>RDYVITR</PeptideSequence>
</Peptide>
<Peptide id="GFQGAMRR_0000000000">
<PeptideSequence>GFQGAMRR</PeptideSequence>
</Peptide>
<Peptide id="DTPLLMNK_0000000000">
<PeptideSequence>DTPLLMNK</PeptideSequence>
</Peptide>
<Peptide id="CIYQYNK_000000000">
<PeptideSequence>CIYQYNK</PeptideSequence>
</Peptide>
<Peptide id="DKLLSAER_0000000000">
<PeptideSequence>DKLLSAER</PeptideSequence>
</Peptide>
<Peptide id="TTSGPVLEK_00000000000">
<PeptideSequence>TTSGPVLEK</PeptideSequence>
</Peptide>
<Peptide id="AAWKTNIK_0000000000">
<PeptideSequence>AAWKTNIK</PeptideSequence>
</Peptide>
<Peptide id="DAEELKVK_0000000000">
<PeptideSequence>DAEELKVK</PeptideSequence>
</Peptide>
<Peptide id="EVESLKAR_0000000000">
<PeptideSequence>EVESLKAR</PeptideSequence>
</Peptide>
<Peptide id="DAEEIARK_0000000000">
<PeptideSequence>DAEEIARK</PeptideSequence>
</Peptide>
<Peptide id="DKPSLPFK_0000000000">
<PeptideSequence>DKPSLPFK</PeptideSequence>
</Peptide>
<Peptide id="ELMWKPK_000000000">
<PeptideSequence>ELMWKPK</PeptideSequence>
</Peptide>
<Peptide id="KVISYWR_000000000">
<PeptideSequence>KVISYWR</PeptideSequence>
</Peptide>
<Peptide id="STVRTFLK_0000000000">
<PeptideSequence>STVRTFLK</PeptideSequence>
</Peptide>
<Peptide id="GLTFASSLR_00000000000">
<PeptideSequence>GLTFASSLR</PeptideSequence>
</Peptide>
<Peptide id="QNNLAYTK_0000000000">
<PeptideSequence>QNNLAYTK</PeptideSequence>
</Peptide>
<Peptide id="DLPPLRLK_0000000000">
<PeptideSequence>DLPPLRLK</PeptideSequence>
</Peptide>
<Peptide id="DAVYTVRK_0000000000">
<PeptideSequence>DAVYTVRK</PeptideSequence>
</Peptide>
<Peptide id="GKGFQGAMR_00000000000">
<PeptideSequence>GKGFQGAMR</PeptideSequence>
</Peptide>
<Peptide id="NEFDWKK_000000000">
<PeptideSequence>NEFDWKK</PeptideSequence>
</Peptide>
<Peptide id="SVSSSSSLGR_000000000000">
<PeptideSequence>SVSSSSSLGR</PeptideSequence>
</Peptide>
<Peptide id="NCFGEGLAR_00000000000">
<PeptideSequence>NCFGEGLAR</PeptideSequence>
</Peptide>
<Peptide id="QINMSFVK_0000000000">
<PeptideSequence>QINMSFVK</PeptideSequence>
</Peptide>
<Peptide id="SPDDYELK_0000000000">
<PeptideSequence>SPDDYELK</PeptideSequence>
</Peptide>
<Peptide id="LEEVGYEK_0000000000">
<PeptideSequence>LEEVGYEK</PeptideSequence>
</Peptide>
<Peptide id="TLEFFPGR_0000000000">
<PeptideSequence>TLEFFPGR</PeptideSequence>
</Peptide>
<Peptide id="FLGEITMR_0000000000">
<PeptideSequence>FLGEITMR</PeptideSequence>
</Peptide>
<Peptide id="GGGAAGHNGIR_0000000000000">
<PeptideSequence>GGGAAGHNGIR</PeptideSequence>
</Peptide>
<Peptide id="RMEEEER_000000000">
<PeptideSequence>RMEEEER</PeptideSequence>
</Peptide>
<Peptide id="GAFISNTLR_00000000000">
<PeptideSequence>GAFISNTLR</PeptideSequence>
</Peptide>
<Peptide id="TGEDDSNIK_00000000000">
<PeptideSequence>TGEDDSNIK</PeptideSequence>
</Peptide>
<Peptide id="ANVANKYAK_00000000000">
<PeptideSequence>ANVANKYAK</PeptideSequence>
</Peptide>
<Peptide id="IEVFDSLR_0000000000">
<PeptideSequence>IEVFDSLR</PeptideSequence>
</Peptide>
<Peptide id="QVRYLGDK_0000000000">
<PeptideSequence>QVRYLGDK</PeptideSequence>
</Peptide>
<Peptide id="NPESFKEK_0000000000">
<PeptideSequence>NPESFKEK</PeptideSequence>
</Peptide>
<Peptide id="AMEEQQSR_0000000000">
<PeptideSequence>AMEEQQSR</PeptideSequence>
</Peptide>
<Peptide id="VVAKNIVDK_00000000000">
<PeptideSequence>VVAKNIVDK</PeptideSequence>
</Peptide>
<Peptide id="FTHPNLEK_0000000000">
<PeptideSequence>FTHPNLEK</PeptideSequence>
</Peptide>
<Peptide id="SNYQAFQK_0000000000">
<PeptideSequence>SNYQAFQK</PeptideSequence>
</Peptide>
<Peptide id="FLSVLERQ_0000000000">
<PeptideSequence>FLSVLERQ</PeptideSequence>
</Peptide>
<Peptide id="ALMGANMQR_00000000000">
<PeptideSequence>ALMGANMQR</PeptideSequence>
</Peptide>
<Peptide id="ALFDVAIDK_00000000000">
<PeptideSequence>ALFDVAIDK</PeptideSequence>
</Peptide>
<Peptide id="SPAAFDQKK_00000000000">
<PeptideSequence>SPAAFDQKK</PeptideSequence>
</Peptide>
<Peptide id="NIQFGERK_0000000000">
<PeptideSequence>NIQFGERK</PeptideSequence>
</Peptide>
<Peptide id="DRPLYAEK_0000000000">
<PeptideSequence>DRPLYAEK</PeptideSequence>
</Peptide>
<Peptide id="ETLESREK_0000000000">
<PeptideSequence>ETLESREK</PeptideSequence>
</Peptide>
<Peptide id="IIPLLTDPK_00000000000">
<PeptideSequence>IIPLLTDPK</PeptideSequence>
</Peptide>
<Peptide id="MHEVIPGAR_00000000000">
<PeptideSequence>MHEVIPGAR</PeptideSequence>
</Peptide>
<Peptide id="FGDNGLKMK_00000000000">
<PeptideSequence>FGDNGLKMK</PeptideSequence>
</Peptide>
<Peptide id="DLPRYDLK_0000000000">
<PeptideSequence>DLPRYDLK</PeptideSequence>
</Peptide>
<Peptide id="TKEVDSNVK_00000000000">
<PeptideSequence>TKEVDSNVK</PeptideSequence>
</Peptide>
<Peptide id="GTVDARTAQK_000000000000">
<PeptideSequence>GTVDARTAQK</PeptideSequence>
</Peptide>
<Peptide id="LLRAIFGEK_00000000000">
<PeptideSequence>LLRAIFGEK</PeptideSequence>
</Peptide>
<Peptide id="DADVEKELK_00000000000">
<PeptideSequence>DADVEKELK</PeptideSequence>
</Peptide>
<Peptide id="FGINNEPKK_00000000000">
<PeptideSequence>FGINNEPKK</PeptideSequence>
</Peptide>
<Peptide id="GEIEQTELK_00000000000">
<PeptideSequence>GEIEQTELK</PeptideSequence>
</Peptide>
<Peptide id="KGFNSVATAR_000000000000">
<PeptideSequence>KGFNSVATAR</PeptideSequence>
</Peptide>
<Peptide id="LISLFQAMK_00000000000">
<PeptideSequence>LISLFQAMK</PeptideSequence>
</Peptide>
<Peptide id="VKTYEAIVK_00000000000">
<PeptideSequence>VKTYEAIVK</PeptideSequence>
</Peptide>
<Peptide id="SIFAKSNQR_00000000000">
<PeptideSequence>SIFAKSNQR</PeptideSequence>
</Peptide>
<Peptide id="YLEDGGLER_00000000000">
<PeptideSequence>YLEDGGLER</PeptideSequence>
</Peptide>
<Peptide id="LSEPFSDEK_00000000000">
<PeptideSequence>LSEPFSDEK</PeptideSequence>
</Peptide>
<Peptide id="IDFMDVSPK_00000000000">
<PeptideSequence>IDFMDVSPK</PeptideSequence>
</Peptide>
<Peptide id="VLEQMYLR_0000000000">
<PeptideSequence>VLEQMYLR</PeptideSequence>
</Peptide>
<Peptide id="SAGYGELLNK_000000000000">
<PeptideSequence>SAGYGELLNK</PeptideSequence>
</Peptide>
<Peptide id="ILVELRNGR_00000000000">
<PeptideSequence>ILVELRNGR</PeptideSequence>
</Peptide>
<Peptide id="FRDFFLPK_0000000000">
<PeptideSequence>FRDFFLPK</PeptideSequence>
</Peptide>
<Peptide id="DVELLYPVK_00000000000">
<PeptideSequence>DVELLYPVK</PeptideSequence>
</Peptide>
<Peptide id="ERAEQESAR_00000000000">
<PeptideSequence>ERAEQESAR</PeptideSequence>
</Peptide>
<Peptide id="RYDLAKPGR_00000000000">
<PeptideSequence>RYDLAKPGR</PeptideSequence>
</Peptide>
<Peptide id="KWDDEAIAK_00000000000">
<PeptideSequence>KWDDEAIAK</PeptideSequence>
</Peptide>
<Peptide id="VGTTVLDGSVK_0000000000000">
<PeptideSequence>VGTTVLDGSVK</PeptideSequence>
</Peptide>
<Peptide id="GKNLFMPIR_00000000000">
<PeptideSequence>GKNLFMPIR</PeptideSequence>
</Peptide>
<Peptide id="AEQQTQQDK_00000000000">
<PeptideSequence>AEQQTQQDK</PeptideSequence>
</Peptide>
<Peptide id="LTGLSSEGRR_000000000000">
<PeptideSequence>LTGLSSEGRR</PeptideSequence>
</Peptide>
<Peptide id="LIEIDDTEK_00000000000">
<PeptideSequence>LIEIDDTEK</PeptideSequence>
</Peptide>
<Peptide id="GDVTVISKTR_000000000000">
<PeptideSequence>GDVTVISKTR</PeptideSequence>
</Peptide>
<Peptide id="EGLVSETKGR_000000000000">
<PeptideSequence>EGLVSETKGR</PeptideSequence>
</Peptide>
<Peptide id="KLGFVEVQR_00000000000">
<PeptideSequence>KLGFVEVQR</PeptideSequence>
</Peptide>
<Peptide id="SKEEVSQLR_00000000000">
<PeptideSequence>SKEEVSQLR</PeptideSequence>
</Peptide>
<Peptide id="QELLRQFR_0000000000">
<PeptideSequence>QELLRQFR</PeptideSequence>
</Peptide>
<Peptide id="VEFTLVPER_00000000000">
<PeptideSequence>VEFTLVPER</PeptideSequence>
</Peptide>
<Peptide id="TWAAEDQLR_00000000000">
<PeptideSequence>TWAAEDQLR</PeptideSequence>
</Peptide>
<Peptide id="NGAVFVDIVR_000000000000">
<PeptideSequence>NGAVFVDIVR</PeptideSequence>
</Peptide>
<Peptide id="GLFEVNPWK_00000000000">
<PeptideSequence>GLFEVNPWK</PeptideSequence>
</Peptide>
<Peptide id="VVRSEGEDAK_000000000000">
<PeptideSequence>VVRSEGEDAK</PeptideSequence>
</Peptide>
<Peptide id="MPGQMGNAKR_000000000000">
<PeptideSequence>MPGQMGNAKR</PeptideSequence>
</Peptide>
<Peptide id="YQGKSILASK_000000000000">
<PeptideSequence>YQGKSILASK</PeptideSequence>
</Peptide>
<Peptide id="SVSSSSSLGRK_0000000000000">
<PeptideSequence>SVSSSSSLGRK</PeptideSequence>
</Peptide>
<Peptide id="SGVGKTSFIAK_0000000000000">
<PeptideSequence>SGVGKTSFIAK</PeptideSequence>
</Peptide>
<Peptide id="GLKFIYEPK_00000000000">
<PeptideSequence>GLKFIYEPK</PeptideSequence>
</Peptide>
<Peptide id="YILRLSCVK_00000000000">
<PeptideSequence>YILRLSCVK</PeptideSequence>
</Peptide>
<Peptide id="ELGVNFFIR_00000000000">
<PeptideSequence>ELGVNFFIR</PeptideSequence>
</Peptide>
<Peptide id="EDDSIRPFK_00000000000">
<PeptideSequence>EDDSIRPFK</PeptideSequence>
</Peptide>
<Peptide id="LHERLVAIR_00000000000">
<PeptideSequence>LHERLVAIR</PeptideSequence>
</Peptide>
<Peptide id="IGEGDEMIDK_000000000000">
<PeptideSequence>IGEGDEMIDK</PeptideSequence>
</Peptide>
<Peptide id="DMEAMAIGLR_000000000000">
<PeptideSequence>DMEAMAIGLR</PeptideSequence>
</Peptide>
<Peptide id="DQSKQLLFK_00000000000">
<PeptideSequence>DQSKQLLFK</PeptideSequence>
</Peptide>
<Peptide id="MLKNISSVSK_000000000000">
<PeptideSequence>MLKNISSVSK</PeptideSequence>
</Peptide>
<Peptide id="FLETLEGGLK_000000000000">
<PeptideSequence>FLETLEGGLK</PeptideSequence>
</Peptide>
<Peptide id="FQGWLQDGR_00000000000">
<PeptideSequence>FQGWLQDGR</PeptideSequence>
</Peptide>
<Peptide id="QIFPSKFDK_00000000000">
<PeptideSequence>QIFPSKFDK</PeptideSequence>
</Peptide>
<Peptide id="VEECQRFAK_00000000000">
<PeptideSequence>VEECQRFAK</PeptideSequence>
</Peptide>
<Peptide id="FATVRFIQK_00000000000">
<PeptideSequence>FATVRFIQK</PeptideSequence>
</Peptide>
<Peptide id="MANVANKYAK_000000000000">
<PeptideSequence>MANVANKYAK</PeptideSequence>
</Peptide>
<Peptide id="LKYTEEAQK_00000000000">
<PeptideSequence>LKYTEEAQK</PeptideSequence>
</Peptide>
<Peptide id="LLEYDTVTR_00000000000">
<PeptideSequence>LLEYDTVTR</PeptideSequence>
</Peptide>
<Peptide id="DPSYLHLLR_00000000000">
<PeptideSequence>DPSYLHLLR</PeptideSequence>
</Peptide>
<Peptide id="AGEKVDIPER_000000000000">
<PeptideSequence>AGEKVDIPER</PeptideSequence>
</Peptide>
<Peptide id="ERVAQLLER_00000000000">
<PeptideSequence>ERVAQLLER</PeptideSequence>
</Peptide>
<Peptide id="AGENRAIAALK_0000000000000">
<PeptideSequence>AGENRAIAALK</PeptideSequence>
</Peptide>
<Peptide id="QITLFHINK_00000000000">
<PeptideSequence>QITLFHINK</PeptideSequence>
</Peptide>
<Peptide id="LDYIIGKSSK_000000000000">
<PeptideSequence>LDYIIGKSSK</PeptideSequence>
</Peptide>
<Peptide id="VVNYLMDSGK_000000000000">
<PeptideSequence>VVNYLMDSGK</PeptideSequence>
</Peptide>
<Peptide id="YDLSGVGRMK_000000000000">
<PeptideSequence>YDLSGVGRMK</PeptideSequence>
</Peptide>
<Peptide id="DFIDSFLIR_00000000000">
<PeptideSequence>DFIDSFLIR</PeptideSequence>
</Peptide>
<Peptide id="MENDYGLKR_00000000000">
<PeptideSequence>MENDYGLKR</PeptideSequence>
</Peptide>
<Peptide id="FSSASGVEVDK_0000000000000">
<PeptideSequence>FSSASGVEVDK</PeptideSequence>
</Peptide>
<Peptide id="LGEGIILAPDK_0000000000000">
<PeptideSequence>LGEGIILAPDK</PeptideSequence>
</Peptide>
<Peptide id="HDDGNTVIVR_000000000000">
<PeptideSequence>HDDGNTVIVR</PeptideSequence>
</Peptide>
<Peptide id="HATTIVTVRK_000000000000">
<PeptideSequence>HATTIVTVRK</PeptideSequence>
</Peptide>
<Peptide id="QRELEQLGR_00000000000">
<PeptideSequence>QRELEQLGR</PeptideSequence>
</Peptide>
<Peptide id="YSVDECKER_00000000000">
<PeptideSequence>YSVDECKER</PeptideSequence>
</Peptide>
<Peptide id="LGKPAEMVKR_000000000000">
<PeptideSequence>LGKPAEMVKR</PeptideSequence>
</Peptide>
<Peptide id="KPEQGTEVLK_000000000000">
<PeptideSequence>KPEQGTEVLK</PeptideSequence>
</Peptide>
<Peptide id="NYTMSFLPR_00000000000">
<PeptideSequence>NYTMSFLPR</PeptideSequence>
</Peptide>
<Peptide id="VVRAEAEQAR_000000000000">
<PeptideSequence>VVRAEAEQAR</PeptideSequence>
</Peptide>
<Peptide id="DQVIAGLVGGAE_00000000000000">
<PeptideSequence>DQVIAGLVGGAE</PeptideSequence>
</Peptide>
<Peptide id="SSIFSTFPSR_000000000000">
<PeptideSequence>SSIFSTFPSR</PeptideSequence>
</Peptide>
<Peptide id="MHATTIVTVR_000000000000">
<PeptideSequence>MHATTIVTVR</PeptideSequence>
</Peptide>
<Peptide id="YDRIADFTK_00000000000">
<PeptideSequence>YDRIADFTK</PeptideSequence>
</Peptide>
<Peptide id="LEQLKDLNR_00000000000">
<PeptideSequence>LEQLKDLNR</PeptideSequence>
</Peptide>
<Peptide id="LISYSYMVR_00000000000">
<PeptideSequence>LISYSYMVR</PeptideSequence>
</Peptide>
<Peptide id="TEAEIALKEK_000000000000">
<PeptideSequence>TEAEIALKEK</PeptideSequence>
</Peptide>
<Peptide id="GETQLTPEEK_000000000000">
<PeptideSequence>GETQLTPEEK</PeptideSequence>
</Peptide>
<Peptide id="DKESLTLVVK_000000000000">
<PeptideSequence>DKESLTLVVK</PeptideSequence>
</Peptide>
<Peptide id="MFEDGYITR_00000000000">
<PeptideSequence>MFEDGYITR</PeptideSequence>
</Peptide>
<Peptide id="LETALAGSTIR_0000000000000">
<PeptideSequence>LETALAGSTIR</PeptideSequence>
</Peptide>
<Peptide id="EMSVYEAYR_00000000000">
<PeptideSequence>EMSVYEAYR</PeptideSequence>
</Peptide>
<Peptide id="ELQSLCLDVK_000000000000">
<PeptideSequence>ELQSLCLDVK</PeptideSequence>
</Peptide>
<Peptide id="DLSATIPGAFR_0000000000000">
<PeptideSequence>DLSATIPGAFR</PeptideSequence>
</Peptide>
<Peptide id="GNDGIAAFVQR_0000000000000">
<PeptideSequence>GNDGIAAFVQR</PeptideSequence>
</Peptide>
<Peptide id="ELYEQVPAAK_000000000000">
<PeptideSequence>ELYEQVPAAK</PeptideSequence>
</Peptide>
<Peptide id="ELIPTEEALR_000000000000">
<PeptideSequence>ELIPTEEALR</PeptideSequence>
</Peptide>
<Peptide id="GADRIVVVGER_0000000000000">
<PeptideSequence>GADRIVVVGER</PeptideSequence>
</Peptide>
<Peptide id="RVFTEVTYR_00000000000">
<PeptideSequence>RVFTEVTYR</PeptideSequence>
</Peptide>
<Peptide id="GHASIAEKMVK_0000000000000">
<PeptideSequence>GHASIAEKMVK</PeptideSequence>
</Peptide>
<Peptide id="KGDVIVVEAIK_0000000000000">
<PeptideSequence>KGDVIVVEAIK</PeptideSequence>
</Peptide>
<Peptide id="GYGVVFSNGER_0000000000000">
<PeptideSequence>GYGVVFSNGER</PeptideSequence>
</Peptide>
<Peptide id="GYIETEDDDK_000000000000">
<PeptideSequence>GYIETEDDDK</PeptideSequence>
</Peptide>
<Peptide id="IRIGIGHPGHK_0000000000000">
<PeptideSequence>IRIGIGHPGHK</PeptideSequence>
</Peptide>
<Peptide id="LEAIVKPGCVR_0000000000000">
<PeptideSequence>LEAIVKPGCVR</PeptideSequence>
</Peptide>
<Peptide id="GVQVSMTYSGR_0000000000000">
<PeptideSequence>GVQVSMTYSGR</PeptideSequence>
</Peptide>
<Peptide id="LYEYARAGEK_000000000000">
<PeptideSequence>LYEYARAGEK</PeptideSequence>
</Peptide>
<Peptide id="LREAIAELER_000000000000">
<PeptideSequence>LREAIAELER</PeptideSequence>
</Peptide>
<Peptide id="AARDSGVVILAK_00000000000000">
<PeptideSequence>AARDSGVVILAK</PeptideSequence>
</Peptide>
<Peptide id="VFDFLKDGMK_000000000000">
<PeptideSequence>VFDFLKDGMK</PeptideSequence>
</Peptide>
<Peptide id="QRQLAAEEER_000000000000">
<PeptideSequence>QRQLAAEEER</PeptideSequence>
</Peptide>
<Peptide id="SARCLQLPLTK_0000000000000">
<PeptideSequence>SARCLQLPLTK</PeptideSequence>
</Peptide>
<Peptide id="AEAEQARVSIR_0000000000000">
<PeptideSequence>AEAEQARVSIR</PeptideSequence>
</Peptide>
<Peptide id="DYPDKIFTCK_000000000000">
<PeptideSequence>DYPDKIFTCK</PeptideSequence>
</Peptide>
<Peptide id="LAEDEAFQRR_000000000000">
<PeptideSequence>LAEDEAFQRR</PeptideSequence>
</Peptide>
<Peptide id="ERDATYAAPLK_0000000000000">
<PeptideSequence>ERDATYAAPLK</PeptideSequence>
</Peptide>
<Peptide id="LARQDVIEYK_000000000000">
<PeptideSequence>LARQDVIEYK</PeptideSequence>
</Peptide>
<Peptide id="SLEALDTAMKR_0000000000000">
<PeptideSequence>SLEALDTAMKR</PeptideSequence>
</Peptide>
<Peptide id="RHFSGTESDAK_0000000000000">
<PeptideSequence>RHFSGTESDAK</PeptideSequence>
</Peptide>
<Peptide id="NYPAEPFRIK_000000000000">
<PeptideSequence>NYPAEPFRIK</PeptideSequence>
</Peptide>
<Peptide id="KFQGWLQDGR_000000000000">
<PeptideSequence>KFQGWLQDGR</PeptideSequence>
</Peptide>
<Peptide id="IQTVGLYMGPR_0000000000000">
<PeptideSequence>IQTVGLYMGPR</PeptideSequence>
</Peptide>
<Peptide id="NLSHYYSGSSK_0000000000000">
<PeptideSequence>NLSHYYSGSSK</PeptideSequence>
</Peptide>
<Peptide id="GWLYYEAGQR_000000000000">
<PeptideSequence>GWLYYEAGQR</PeptideSequence>
</Peptide>
<Peptide id="ENGDELAPGVNK_00000000000000">
<PeptideSequence>ENGDELAPGVNK</PeptideSequence>
</Peptide>
<Peptide id="FVNTYETQLK_000000000000">
<PeptideSequence>FVNTYETQLK</PeptideSequence>
</Peptide>
<Peptide id="VEEGVLRVGER_0000000000000">
<PeptideSequence>VEEGVLRVGER</PeptideSequence>
</Peptide>
<Peptide id="AQARAEEDAQR_0000000000000">
<PeptideSequence>AQARAEEDAQR</PeptideSequence>
</Peptide>
<Peptide id="DTKLGPEDITR_0000000000000">
<PeptideSequence>DTKLGPEDITR</PeptideSequence>
</Peptide>
<Peptide id="LENGEIETIAR_0000000000000">
<PeptideSequence>LENGEIETIAR</PeptideSequence>
</Peptide>
<Peptide id="ITEAANKAAAER_00000000000000">
<PeptideSequence>ITEAANKAAAER</PeptideSequence>
</Peptide>
<Peptide id="VEGSPLEGLESK_00000000000000">
<PeptideSequence>VEGSPLEGLESK</PeptideSequence>
</Peptide>
<Peptide id="DTPLLMNKWK_000000000000">
<PeptideSequence>DTPLLMNKWK</PeptideSequence>
</Peptide>
<Peptide id="DANSDLKELLK_0000000000000">
<PeptideSequence>DANSDLKELLK</PeptideSequence>
</Peptide>
<Peptide id="GVTFVSHGNTAR_00000000000000">
<PeptideSequence>GVTFVSHGNTAR</PeptideSequence>
</Peptide>
<Peptide id="VLKEISENWK_000000000000">
<PeptideSequence>VLKEISENWK</PeptideSequence>
</Peptide>
<Peptide id="GLFEVNPWKR_000000000000">
<PeptideSequence>GLFEVNPWKR</PeptideSequence>
</Peptide>
<Peptide id="EHLVNLDHLR_000000000000">
<PeptideSequence>EHLVNLDHLR</PeptideSequence>
</Peptide>
<Peptide id="MYKSLLFCLK_000000000000">
<PeptideSequence>MYKSLLFCLK</PeptideSequence>
</Peptide>
<Peptide id="LIACLMEEANR_0000000000000">
<PeptideSequence>LIACLMEEANR</PeptideSequence>
</Peptide>
<Peptide id="ALFDVAIDKDR_0000000000000">
<PeptideSequence>ALFDVAIDKDR</PeptideSequence>
</Peptide>
<Peptide id="EKEISEDEQR_000000000000">
<PeptideSequence>EKEISEDEQR</PeptideSequence>
</Peptide>
<Peptide id="SATLIVESSDLK_00000000000000">
<PeptideSequence>SATLIVESSDLK</PeptideSequence>
</Peptide>
<Peptide id="EMQALSDEALR_0000000000000">
<PeptideSequence>EMQALSDEALR</PeptideSequence>
</Peptide>
<Peptide id="FLETLEGGLKR_0000000000000">
<PeptideSequence>FLETLEGGLKR</PeptideSequence>
</Peptide>
<Peptide id="DSDTQLTQVQK_0000000000000">
<PeptideSequence>DSDTQLTQVQK</PeptideSequence>
</Peptide>
<Peptide id="ASYTLNKFYR_000000000000">
<PeptideSequence>ASYTLNKFYR</PeptideSequence>
</Peptide>
<Peptide id="LEQYPDQLTR_000000000000">
<PeptideSequence>LEQYPDQLTR</PeptideSequence>
</Peptide>
<Peptide id="FSTWTNTEFR_000000000000">
<PeptideSequence>FSTWTNTEFR</PeptideSequence>
</Peptide>
<Peptide id="QLFSNTVIPNR_0000000000000">
<PeptideSequence>QLFSNTVIPNR</PeptideSequence>
</Peptide>
<Peptide id="GEEQIQQLTDK_0000000000000">
<PeptideSequence>GEEQIQQLTDK</PeptideSequence>
</Peptide>
<Peptide id="KTAAVVEQSLSR_00000000000000">
<PeptideSequence>KTAAVVEQSLSR</PeptideSequence>
</Peptide>
<Peptide id="TLDEVAERSLR_0000000000000">
<PeptideSequence>TLDEVAERSLR</PeptideSequence>
</Peptide>
<Peptide id="NNVTGEHHRPK_0000000000000">
<PeptideSequence>NNVTGEHHRPK</PeptideSequence>
</Peptide>
<Peptide id="ANVTKDGVDIEK_00000000000000">
<PeptideSequence>ANVTKDGVDIEK</PeptideSequence>
</Peptide>
<Peptide id="GQDEVQKLTDR_0000000000000">
<PeptideSequence>GQDEVQKLTDR</PeptideSequence>
</Peptide>
<Peptide id="DQMQIFIQAAK_0000000000000">
<PeptideSequence>DQMQIFIQAAK</PeptideSequence>
</Peptide>
<Peptide id="KMGVSISGQTER_00000000000000">
<PeptideSequence>KMGVSISGQTER</PeptideSequence>
</Peptide>
<Peptide id="YGFDSNRYDR_000000000000">
<PeptideSequence>YGFDSNRYDR</PeptideSequence>
</Peptide>
<Peptide id="GARDEIQTQMR_0000000000000">
<PeptideSequence>GARDEIQTQMR</PeptideSequence>
</Peptide>
<Peptide id="SVADIRNSAESR_00000000000000">
<PeptideSequence>SVADIRNSAESR</PeptideSequence>
</Peptide>
<Peptide id="SLAIDIDLERY_0000000000000">
<PeptideSequence>SLAIDIDLERY</PeptideSequence>
</Peptide>
<Peptide id="DGVTVDAAEKFR_00000000000000">
<PeptideSequence>DGVTVDAAEKFR</PeptideSequence>
</Peptide>
<Peptide id="GNSQRSQLMMR_0000000000000">
<PeptideSequence>GNSQRSQLMMR</PeptideSequence>
</Peptide>
<Peptide id="MTQYAIEAPKR_0000000000000">
<PeptideSequence>MTQYAIEAPKR</PeptideSequence>
</Peptide>
<Peptide id="LEPADYEVDEK_0000000000000">
<PeptideSequence>LEPADYEVDEK</PeptideSequence>
</Peptide>
<Peptide id="LSALGPGGLSRER_000000000000000">
<PeptideSequence>LSALGPGGLSRER</PeptideSequence>
</Peptide>
<Peptide id="VSALGPGGLTRER_000000000000000">
<PeptideSequence>VSALGPGGLTRER</PeptideSequence>
</Peptide>
<Peptide id="DFRWMGPIYK_000000000000">
<PeptideSequence>DFRWMGPIYK</PeptideSequence>
</Peptide>
<Peptide id="AAMAFEREIFK_0000000000000">
<PeptideSequence>AAMAFEREIFK</PeptideSequence>
</Peptide>
<Peptide id="ERGMTSNDAVIK_00000000000000">
<PeptideSequence>ERGMTSNDAVIK</PeptideSequence>
</Peptide>
<Peptide id="RLTAEDLFEAR_0000000000000">
<PeptideSequence>RLTAEDLFEAR</PeptideSequence>
</Peptide>
<Peptide id="SSFEDVPALISR_00000000000000">
<PeptideSequence>SSFEDVPALISR</PeptideSequence>
</Peptide>
<Peptide id="ICEHYVTVTQK_0000000000000">
<PeptideSequence>ICEHYVTVTQK</PeptideSequence>
</Peptide>
<Peptide id="EQLIALFDESR_0000000000000">
<PeptideSequence>EQLIALFDESR</PeptideSequence>
</Peptide>
<Peptide id="AQGMGLEAGALFR_000000000000000">
<PeptideSequence>AQGMGLEAGALFR</PeptideSequence>
</Peptide>
<Peptide id="TLEAFHDTCRQ_0000000000000">
<PeptideSequence>TLEAFHDTCRQ</PeptideSequence>
</Peptide>
<Peptide id="SIIFGSLAEGETK_000000000000000">
<PeptideSequence>SIIFGSLAEGETK</PeptideSequence>
</Peptide>
<Peptide id="AGISVGQYKAAMR_000000000000000">
<PeptideSequence>AGISVGQYKAAMR</PeptideSequence>
</Peptide>
<Peptide id="ESGSGFTLTLPSR_000000000000000">
<PeptideSequence>ESGSGFTLTLPSR</PeptideSequence>
</Peptide>
<Peptide id="GNTFAQIKTEDK_00000000000000">
<PeptideSequence>GNTFAQIKTEDK</PeptideSequence>
</Peptide>
<Peptide id="NFSIIAHIDHGK_00000000000000">
<PeptideSequence>NFSIIAHIDHGK</PeptideSequence>
</Peptide>
<Peptide id="IDFELTVTADQK_00000000000000">
<PeptideSequence>IDFELTVTADQK</PeptideSequence>
</Peptide>
<Peptide id="MVTQKEAEIMTV_00000000000000">
<PeptideSequence>MVTQKEAEIMTV</PeptideSequence>
</Peptide>
<Peptide id="LAQGHTTVDELAR_000000000000000">
<PeptideSequence>LAQGHTTVDELAR</PeptideSequence>
</Peptide>
<Peptide id="ALQERIDDLIPK_00000000000000">
<PeptideSequence>ALQERIDDLIPK</PeptideSequence>
</Peptide>
<Peptide id="FSIATLRDFGVGK_000000000000000">
<PeptideSequence>FSIATLRDFGVGK</PeptideSequence>
</Peptide>
<Peptide id="LFDEADETLETK_00000000000000">
<PeptideSequence>LFDEADETLETK</PeptideSequence>
</Peptide>
<Peptide id="GGGKGALAQGGGLDPR_000000000000000000">
<PeptideSequence>GGGKGALAQGGGLDPR</PeptideSequence>
</Peptide>
<Peptide id="LFNYSVIHMMR_0000000000000">
<PeptideSequence>LFNYSVIHMMR</PeptideSequence>
</Peptide>
<Peptide id="AMRPDKYSEWK_0000000000000">
<PeptideSequence>AMRPDKYSEWK</PeptideSequence>
</Peptide>
<Peptide id="EALVDQAEEFSGR_000000000000000">
<PeptideSequence>EALVDQAEEFSGR</PeptideSequence>
</Peptide>
<Peptide id="TIQYLIGSGMDPR_000000000000000">
<PeptideSequence>TIQYLIGSGMDPR</PeptideSequence>
</Peptide>
<Peptide id="EDEAIVHPWINK_00000000000000">
<PeptideSequence>EDEAIVHPWINK</PeptideSequence>
</Peptide>
<Peptide id="IQEEAGFLIDALR_000000000000000">
<PeptideSequence>IQEEAGFLIDALR</PeptideSequence>
</Peptide>
<Peptide id="LAQICGSIAADEKR_0000000000000000">
<PeptideSequence>LAQICGSIAADEKR</PeptideSequence>
</Peptide>
<Peptide id="EKLIEQLYSPVR_00000000000000">
<PeptideSequence>EKLIEQLYSPVR</PeptideSequence>
</Peptide>
<Peptide id="SMIQHIGDDFRR_00000000000000">
<PeptideSequence>SMIQHIGDDFRR</PeptideSequence>
</Peptide>
<Peptide id="DTKYSLYTTINR_00000000000000">
<PeptideSequence>DTKYSLYTTINR</PeptideSequence>
</Peptide>
<Peptide id="HANGFPDLDTLFK_000000000000000">
<PeptideSequence>HANGFPDLDTLFK</PeptideSequence>
</Peptide>
<Peptide id="TVSNVISSIVFGDR_0000000000000000">
<PeptideSequence>TVSNVISSIVFGDR</PeptideSequence>
</Peptide>
<Peptide id="TLNRMHEVIPGAR_000000000000000">
<PeptideSequence>TLNRMHEVIPGAR</PeptideSequence>
</Peptide>
<Peptide id="SAAVLFDTPGSSADR_00000000000000000">
<PeptideSequence>SAAVLFDTPGSSADR</PeptideSequence>
</Peptide>
<Peptide id="LNCVLHAEILLKK_000000000000000">
<PeptideSequence>LNCVLHAEILLKK</PeptideSequence>
</Peptide>
<Peptide id="APVKEMFGFAGAIR_0000000000000000">
<PeptideSequence>APVKEMFGFAGAIR</PeptideSequence>
</Peptide>
<Peptide id="LSESLYPIDYAVK_000000000000000">
<PeptideSequence>LSESLYPIDYAVK</PeptideSequence>
</Peptide>
<Peptide id="EEEEVGFDWSDR_00000000000000">
<PeptideSequence>EEEEVGFDWSDR</PeptideSequence>
</Peptide>
<Peptide id="YGDLHDDKMLYK_00000000000000">
<PeptideSequence>YGDLHDDKMLYK</PeptideSequence>
</Peptide>
<Peptide id="YVDQLLAEGKAYK_000000000000000">
<PeptideSequence>YVDQLLAEGKAYK</PeptideSequence>
</Peptide>
<Peptide id="LDKPGGGLSGGQQQR_00000000000000000">
<PeptideSequence>LDKPGGGLSGGQQQR</PeptideSequence>
</Peptide>
<Peptide id="IFGSDRMDGMLQK_000000000000000">
<PeptideSequence>IFGSDRMDGMLQK</PeptideSequence>
</Peptide>
<Peptide id="GADVALVLSGGQAVLK_000000000000000000">
<PeptideSequence>GADVALVLSGGQAVLK</PeptideSequence>
</Peptide>
<Peptide id="AQCVSLNYTAKDGK_0000000000000000">
<PeptideSequence>AQCVSLNYTAKDGK</PeptideSequence>
</Peptide>
<Peptide id="VVNYLMDSGKVYK_000000000000000">
<PeptideSequence>VVNYLMDSGKVYK</PeptideSequence>
</Peptide>
<Peptide id="GENVPEPGIPECFK_0000000000000000">
<PeptideSequence>GENVPEPGIPECFK</PeptideSequence>
</Peptide>
<Peptide id="CFVDVIFNFAKGR_000000000000000">
<PeptideSequence>CFVDVIFNFAKGR</PeptideSequence>
</Peptide>
<Peptide id="TLVLSGNQAGLTADR_00000000000000000">
<PeptideSequence>TLVLSGNQAGLTADR</PeptideSequence>
</Peptide>
<Peptide id="TLNELAESVLDALK_0000000000000000">
<PeptideSequence>TLNELAESVLDALK</PeptideSequence>
</Peptide>
<Peptide id="GVELASELAKENGAK_00000000000000000">
<PeptideSequence>GVELASELAKENGAK</PeptideSequence>
</Peptide>
<Peptide id="DAAKEAMDSPIVLR_0000000000000000">
<PeptideSequence>DAAKEAMDSPIVLR</PeptideSequence>
</Peptide>
<Peptide id="AGRPKQVTDFFEK_000000000000000">
<PeptideSequence>AGRPKQVTDFFEK</PeptideSequence>
</Peptide>
<Peptide id="ILQADYNTLMAAAK_0000000000000000">
<PeptideSequence>ILQADYNTLMAAAK</PeptideSequence>
</Peptide>
<Peptide id="SVSSLETTETEIVK_0000000000000000">
<PeptideSequence>SVSSLETTETEIVK</PeptideSequence>
</Peptide>
<Peptide id="GTGGANIDPTFFLSR_00000000000000000">
<PeptideSequence>GTGGANIDPTFFLSR</PeptideSequence>
</Peptide>
<Peptide id="LAGEMSRGGFEIGTK_00000000000000000">
<PeptideSequence>LAGEMSRGGFEIGTK</PeptideSequence>
</Peptide>
<Peptide id="LPQGWVLSAGVVNGR_00000000000000000">
<PeptideSequence>LPQGWVLSAGVVNGR</PeptideSequence>
</Peptide>
<Peptide id="KQEELQQLEQQR_00000000000000">
<PeptideSequence>KQEELQQLEQQR</PeptideSequence>
</Peptide>
<Peptide id="VTPKGETQLTPEEK_0000000000000000">
<PeptideSequence>VTPKGETQLTPEEK</PeptideSequence>
</Peptide>
<Peptide id="FQFWDCGEGALRK_000000000000000">
<PeptideSequence>FQFWDCGEGALRK</PeptideSequence>
</Peptide>
<Peptide id="LILASKDTPLLMNK_0000000000000000">
<PeptideSequence>LILASKDTPLLMNK</PeptideSequence>
</Peptide>
<Peptide id="YSLVLELSDSGAFR_0000000000000000">
<PeptideSequence>YSLVLELSDSGAFR</PeptideSequence>
</Peptide>
<Peptide id="SELYNTIDTFILK_000000000000000">
<PeptideSequence>SELYNTIDTFILK</PeptideSequence>
</Peptide>
<Peptide id="LVQAALGGGGGASLEEK_0000000000000000000">
<PeptideSequence>LVQAALGGGGGASLEEK</PeptideSequence>
</Peptide>
<Peptide id="KTAAHVNKPHVQAR_0000000000000000">
<PeptideSequence>KTAAHVNKPHVQAR</PeptideSequence>
</Peptide>
<Peptide id="MIFKLFSQETVMK_000000000000000">
<PeptideSequence>MIFKLFSQETVMK</PeptideSequence>
</Peptide>
<Peptide id="AQRHISDLYEDLR_000000000000000">
<PeptideSequence>AQRHISDLYEDLR</PeptideSequence>
</Peptide>
<Peptide id="VNEYGFIETPYRK_000000000000000">
<PeptideSequence>VNEYGFIETPYRK</PeptideSequence>
</Peptide>
<Peptide id="MQEAGYNTFLLNSK_0000000000000000">
<PeptideSequence>MQEAGYNTFLLNSK</PeptideSequence>
</Peptide>
<Peptide id="EETVTADYYAAQVR_0000000000000000">
<PeptideSequence>EETVTADYYAAQVR</PeptideSequence>
</Peptide>
<Peptide id="SQMLENSFIMDNAR_0000000000000000">
<PeptideSequence>SQMLENSFIMDNAR</PeptideSequence>
</Peptide>
<Peptide id="AERFGPDIMTYVEK_0000000000000000">
<PeptideSequence>AERFGPDIMTYVEK</PeptideSequence>
</Peptide>
<Peptide id="EYIYALAHDHGLNR_0000000000000000">
<PeptideSequence>EYIYALAHDHGLNR</PeptideSequence>
</Peptide>
<Peptide id="SNQNTNINQRPMVR_0000000000000000">
<PeptideSequence>SNQNTNINQRPMVR</PeptideSequence>
</Peptide>
<Peptide id="EVMAGETVPTVLNALK_000000000000000000">
<PeptideSequence>EVMAGETVPTVLNALK</PeptideSequence>
</Peptide>
<Peptide id="AMGGKLEITEIDPVAK_000000000000000000">
<PeptideSequence>AMGGKLEITEIDPVAK</PeptideSequence>
</Peptide>
<Peptide id="EIVAEGLLIDDNNEK_00000000000000000">
<PeptideSequence>EIVAEGLLIDDNNEK</PeptideSequence>
</Peptide>
<Peptide id="DSDLGLNPVSLGDTIR_000000000000000000">
<PeptideSequence>DSDLGLNPVSLGDTIR</PeptideSequence>
</Peptide>
<Peptide id="FYKENLGQGWMTQK_0000000000000000">
<PeptideSequence>FYKENLGQGWMTQK</PeptideSequence>
</Peptide>
<Peptide id="LRSLESLHSFVAAATK_000000000000000000">
<PeptideSequence>LRSLESLHSFVAAATK</PeptideSequence>
</Peptide>
<Peptide id="ETVTGTSPVVEGKSPNK_0000000000000000000">
<PeptideSequence>ETVTGTSPVVEGKSPNK</PeptideSequence>
</Peptide>
<Peptide id="GQSQAGCGCSGAAASDMTK_000000000000000000000">
<PeptideSequence>GQSQAGCGCSGAAASDMTK</PeptideSequence>
</Peptide>
<Peptide id="SVGELAENQFRAGLVR_000000000000000000">
<PeptideSequence>SVGELAENQFRAGLVR</PeptideSequence>
</Peptide>
<Peptide id="ELTGNPDAESQTISQR_000000000000000000">
<PeptideSequence>ELTGNPDAESQTISQR</PeptideSequence>
</Peptide>
<Peptide id="LSPKAQGMGLEAGALFR_0000000000000000000">
<PeptideSequence>LSPKAQGMGLEAGALFR</PeptideSequence>
</Peptide>
<Peptide id="EIEEDFDRLTLLPR_0000000000000000">
<PeptideSequence>EIEEDFDRLTLLPR</PeptideSequence>
</Peptide>
<Peptide id="VDALAVIVHRDSAHSR_000000000000000000">
<PeptideSequence>VDALAVIVHRDSAHSR</PeptideSequence>
</Peptide>
<Peptide id="SSSVGSSSSYPISPAVSR_00000000000000000000">
<PeptideSequence>SSSVGSSSSYPISPAVSR</PeptideSequence>
</Peptide>
<Peptide id="DSTKTEEEGLLEIYK_00000000000000000">
<PeptideSequence>DSTKTEEEGLLEIYK</PeptideSequence>
</Peptide>
<Peptide id="AVDELAVTNTIPTPVSK_0000000000000000000">
<PeptideSequence>AVDELAVTNTIPTPVSK</PeptideSequence>
</Peptide>
<Peptide id="VEVDEIPAGNIVAVIGLK_00000000000000000000">
<PeptideSequence>VEVDEIPAGNIVAVIGLK</PeptideSequence>
</Peptide>
<Peptide id="EETLPLEDGWWGPGTR_000000000000000000">
<PeptideSequence>EETLPLEDGWWGPGTR</PeptideSequence>
</Peptide>
<Peptide id="LDLMYDELSEVSEATK_000000000000000000">
<PeptideSequence>LDLMYDELSEVSEATK</PeptideSequence>
</Peptide>
<Peptide id="CDGPSALPLDKLEPFLK_0000000000000000000">
<PeptideSequence>CDGPSALPLDKLEPFLK</PeptideSequence>
</Peptide>
<Peptide id="AVLGPHVRQAGSLVAPDR_00000000000000000000">
<PeptideSequence>AVLGPHVRQAGSLVAPDR</PeptideSequence>
</Peptide>
<Peptide id="MSACPCNIVILPVEILK_0000000000000000000">
<PeptideSequence>MSACPCNIVILPVEILK</PeptideSequence>
</Peptide>
<Peptide id="FLGLTERDVELLYPVK_000000000000000000">
<PeptideSequence>FLGLTERDVELLYPVK</PeptideSequence>
</Peptide>
<Peptide id="TVAVTFRYGGAPVGPMLR_00000000000000000000">
<PeptideSequence>TVAVTFRYGGAPVGPMLR</PeptideSequence>
</Peptide>
<Peptide id="NTETFNVLINNLCKIR_000000000000000000">
<PeptideSequence>NTETFNVLINNLCKIR</PeptideSequence>
</Peptide>
<Peptide id="EDEAIVHPWINKALEK_000000000000000000">
<PeptideSequence>EDEAIVHPWINKALEK</PeptideSequence>
</Peptide>
<Peptide id="LVSSLEGTEIVKSYNLR_0000000000000000000">
<PeptideSequence>LVSSLEGTEIVKSYNLR</PeptideSequence>
</Peptide>
<Peptide id="DTSLRVPHGESGIVVDVK_00000000000000000000">
<PeptideSequence>DTSLRVPHGESGIVVDVK</PeptideSequence>
</Peptide>
<Peptide id="TEIIRQQGLASYDYVR_000000000000000000">
<PeptideSequence>TEIIRQQGLASYDYVR</PeptideSequence>
</Peptide>
<Peptide id="TRIRPTVNVEEDQNIK_000000000000000000">
<PeptideSequence>TRIRPTVNVEEDQNIK</PeptideSequence>
</Peptide>
<Peptide id="GSTLDGVDSLHSIVQMPR_00000000000000000000">
<PeptideSequence>GSTLDGVDSLHSIVQMPR</PeptideSequence>
</Peptide>
<Peptide id="HIPANAYAEQWDAKGLK_0000000000000000000">
<PeptideSequence>HIPANAYAEQWDAKGLK</PeptideSequence>
</Peptide>
<Peptide id="DGYNAIQVAFDAQKESR_0000000000000000000">
<PeptideSequence>DGYNAIQVAFDAQKESR</PeptideSequence>
</Peptide>
<Peptide id="TLARPGPEPAPATDERDR_00000000000000000000">
<PeptideSequence>TLARPGPEPAPATDERDR</PeptideSequence>
</Peptide>
<Peptide id="DLLSMTIPDCERVGLMR_0000000000000000000">
<PeptideSequence>DLLSMTIPDCERVGLMR</PeptideSequence>
</Peptide>
<Peptide id="NLRPIHYELPIASAQVK_0000000000000000000">
<PeptideSequence>NLRPIHYELPIASAQVK</PeptideSequence>
</Peptide>
<Peptide id="QIEKTIQYLIGSGMDPR_0000000000000000000">
<PeptideSequence>QIEKTIQYLIGSGMDPR</PeptideSequence>
</Peptide>
<Peptide id="YEIDKMIPQEYYTQK_00000000000000000">
<PeptideSequence>YEIDKMIPQEYYTQK</PeptideSequence>
</Peptide>
<Peptide id="GAWLEYETDSNDVLSVR_0000000000000000000">
<PeptideSequence>GAWLEYETDSNDVLSVR</PeptideSequence>
</Peptide>
<Peptide id="AEPAAIALFDVAHKIIFK_00000000000000000000">
<PeptideSequence>AEPAAIALFDVAHKIIFK</PeptideSequence>
</Peptide>
<Peptide id="AENILPSKEIAEYFSDK_0000000000000000000">
<PeptideSequence>AENILPSKEIAEYFSDK</PeptideSequence>
</Peptide>
<Peptide id="KPIANISLDNWQGELKK_0000000000000000000">
<PeptideSequence>KPIANISLDNWQGELKK</PeptideSequence>
</Peptide>
<Peptide id="ESYEITGFTSMGNGYGIK_00000000000000000000">
<PeptideSequence>ESYEITGFTSMGNGYGIK</PeptideSequence>
</Peptide>
<Peptide id="WPIGLGGKGNDGIAAFVQR_000000000000000000000">
<PeptideSequence>WPIGLGGKGNDGIAAFVQR</PeptideSequence>
</Peptide>
<Peptide id="SSWADSSDSDIIDRFVR_0000000000000000000">
<PeptideSequence>SSWADSSDSDIIDRFVR</PeptideSequence>
</Peptide>
<Peptide id="DTERNHTATHLLHAALR_0000000000000000000">
<PeptideSequence>DTERNHTATHLLHAALR</PeptideSequence>
</Peptide>
<Peptide id="ISPTEVQMTPVNIDVKGK_00000000000000000000">
<PeptideSequence>ISPTEVQMTPVNIDVKGK</PeptideSequence>
</Peptide>
<Peptide id="TISVQPYEKHMAGPIER_0000000000000000000">
<PeptideSequence>TISVQPYEKHMAGPIER</PeptideSequence>
</Peptide>
<Peptide id="GGHFAAFEEPELLAQDIR_00000000000000000000">
<PeptideSequence>GGHFAAFEEPELLAQDIR</PeptideSequence>
</Peptide>
<Peptide id="QEELYSELQARETFEK_000000000000000000">
<PeptideSequence>QEELYSELQARETFEK</PeptideSequence>
</Peptide>
<Peptide id="SADILIVLEQVTGNAETVK_000000000000000000000">
<PeptideSequence>SADILIVLEQVTGNAETVK</PeptideSequence>
</Peptide>
<Peptide id="VSNNSPVIFDVTHALQCR_00000000000000000000">
<PeptideSequence>VSNNSPVIFDVTHALQCR</PeptideSequence>
</Peptide>
<Peptide id="GQQTIYFEVGCGKGTYVR_00000000000000000000">
<PeptideSequence>GQQTIYFEVGCGKGTYVR</PeptideSequence>
</Peptide>
<Peptide id="TLDPNSPRDFIDSFLIR_0000000000000000000">
<PeptideSequence>TLDPNSPRDFIDSFLIR</PeptideSequence>
</Peptide>
<Peptide id="SALMFAALQAKGESVIIEK_000000000000000000000">
<PeptideSequence>SALMFAALQAKGESVIIEK</PeptideSequence>
</Peptide>
<Peptide id="NQSNHLRLTSSGIFFER_0000000000000000000">
<PeptideSequence>NQSNHLRLTSSGIFFER</PeptideSequence>
</Peptide>
<Peptide id="DEAHDAGLNIAFKGDIDLK_000000000000000000000">
<PeptideSequence>DEAHDAGLNIAFKGDIDLK</PeptideSequence>
</Peptide>
<Peptide id="KEAILWAWEFLTEHLR_000000000000000000">
<PeptideSequence>KEAILWAWEFLTEHLR</PeptideSequence>
</Peptide>
<Peptide id="VGRGQSQAGCGCSGAAASDMTK_000000000000000000000000">
<PeptideSequence>VGRGQSQAGCGCSGAAASDMTK</PeptideSequence>
</Peptide>
<Peptide id="LQAEEVAQQKSLAQAEAEK_000000000000000000000">
<PeptideSequence>LQAEEVAQQKSLAQAEAEK</PeptideSequence>
</Peptide>
<Peptide id="YGGAPVGPMLRLGKPAEMVK_0000000000000000000000">
<PeptideSequence>YGGAPVGPMLRLGKPAEMVK</PeptideSequence>
</Peptide>
<Peptide id="ALEMLNVDKEGLDYMDSK_00000000000000000000">
<PeptideSequence>ALEMLNVDKEGLDYMDSK</PeptideSequence>
</Peptide>
<Peptide id="VLEQMYLRSATMLLATCK_00000000000000000000">
<PeptideSequence>VLEQMYLRSATMLLATCK</PeptideSequence>
</Peptide>
<Peptide id="EAAGIVPTVRLAVNEAGIYK_0000000000000000000000">
<PeptideSequence>EAAGIVPTVRLAVNEAGIYK</PeptideSequence>
</Peptide>
<Peptide id="QNLVIESSRPGMGTILEVK_000000000000000000000">
<PeptideSequence>QNLVIESSRPGMGTILEVK</PeptideSequence>
</Peptide>
<Peptide id="DKEETLPLEDGWWGPGTR_00000000000000000000">
<PeptideSequence>DKEETLPLEDGWWGPGTR</PeptideSequence>
</Peptide>
<Peptide id="KPEQGTEVLKFFDWAYK_0000000000000000000">
<PeptideSequence>KPEQGTEVLKFFDWAYK</PeptideSequence>
</Peptide>
<Peptide id="FLGLSCGFVKENMNLEER_00000000000000000000">
<PeptideSequence>FLGLSCGFVKENMNLEER</PeptideSequence>
</Peptide>
<Peptide id="YTRSNQNTNINQRPMVR_0000000000000000000">
<PeptideSequence>YTRSNQNTNINQRPMVR</PeptideSequence>
</Peptide>
<Peptide id="ANEPQNDSFDEPIQSSVSK_000000000000000000000">
<PeptideSequence>ANEPQNDSFDEPIQSSVSK</PeptideSequence>
</Peptide>
<Peptide id="TIGMVFQRPNPFPTMSIR_00000000000000000000">
<PeptideSequence>TIGMVFQRPNPFPTMSIR</PeptideSequence>
</Peptide>
<Peptide id="RPLRPQVVTDDDGQAPEAK_000000000000000000000">
<PeptideSequence>RPLRPQVVTDDDGQAPEAK</PeptideSequence>
</Peptide>
<Peptide id="VSAQRLQEAGILSAEELQR_000000000000000000000">
<PeptideSequence>VSAQRLQEAGILSAEELQR</PeptideSequence>
</Peptide>
<Peptide id="NIVGFDTNHAYYNQEGKK_00000000000000000000">
<PeptideSequence>NIVGFDTNHAYYNQEGKK</PeptideSequence>
</Peptide>
<Peptide id="MAAIALHQGKVVEMQTGEGK_0000000000000000000000">
<PeptideSequence>MAAIALHQGKVVEMQTGEGK</PeptideSequence>
</Peptide>
<Peptide id="KLADGADLDDLLVPAFAVVR_0000000000000000000000">
<PeptideSequence>KLADGADLDDLLVPAFAVVR</PeptideSequence>
</Peptide>
<Peptide id="AASTSKPTITFDKFGDNGLK_0000000000000000000000">
<PeptideSequence>AASTSKPTITFDKFGDNGLK</PeptideSequence>
</Peptide>
<Peptide id="VMSTGRAYEVDQVGIFTPK_000000000000000000000">
<PeptideSequence>VMSTGRAYEVDQVGIFTPK</PeptideSequence>
</Peptide>
<Peptide id="QYINAIKDYELQLVTYK_0000000000000000000">
<PeptideSequence>QYINAIKDYELQLVTYK</PeptideSequence>
</Peptide>
<Peptide id="FCDAYFHRNMSTDYTCK_0000000000000000000">
<PeptideSequence>FCDAYFHRNMSTDYTCK</PeptideSequence>
</Peptide>
<Peptide id="QFHNVSAEQIAYVAQLQR_00000000000000000000">
<PeptideSequence>QFHNVSAEQIAYVAQLQR</PeptideSequence>
</Peptide>
<Peptide id="HADLGAVYALCKPFLEAAGR_0000000000000000000000">
<PeptideSequence>HADLGAVYALCKPFLEAAGR</PeptideSequence>
</Peptide>
<Peptide id="VFVAATHGVFAEGAIERLSK_0000000000000000000000">
<PeptideSequence>VFVAATHGVFAEGAIERLSK</PeptideSequence>
</Peptide>
<Peptide id="VQPSTLALPTQYVDDVISR_000000000000000000000">
<PeptideSequence>VQPSTLALPTQYVDDVISR</PeptideSequence>
</Peptide>
<Peptide id="FGSKLLEEFFTEEEQIR_0000000000000000000">
<PeptideSequence>FGSKLLEEFFTEEEQIR</PeptideSequence>
</Peptide>
<Peptide id="NQSSHLQFTSSWIFFER_0000000000000000000">
<PeptideSequence>NQSSHLQFTSSWIFFER</PeptideSequence>
</Peptide>
<Peptide id="DRLDLMYDELSEVSEATK_00000000000000000000">
<PeptideSequence>DRLDLMYDELSEVSEATK</PeptideSequence>
</Peptide>
<Peptide id="NLPTEAFLGIGSFIGRYCR_000000000000000000000">
<PeptideSequence>NLPTEAFLGIGSFIGRYCR</PeptideSequence>
</Peptide>
<Peptide id="IEGDMMVTTATFKNITSVR_000000000000000000000">
<PeptideSequence>IEGDMMVTTATFKNITSVR</PeptideSequence>
</Peptide>
<Peptide id="VVIAGDGQVSLGQTIMKGNAR_00000000000000000000000">
<PeptideSequence>VVIAGDGQVSLGQTIMKGNAR</PeptideSequence>
</Peptide>
<Peptide id="GGHFAAFEEPELLAQDIRK_000000000000000000000">
<PeptideSequence>GGHFAAFEEPELLAQDIRK</PeptideSequence>
</Peptide>
<Peptide id="ALGYGTDLEITELFGEDER_000000000000000000000">
<PeptideSequence>ALGYGTDLEITELFGEDER</PeptideSequence>
</Peptide>
<Peptide id="LKPPEAAGYVEAVIESLDAR_0000000000000000000000">
<PeptideSequence>LKPPEAAGYVEAVIESLDAR</PeptideSequence>
</Peptide>
<Peptide id="MHARSTGPYSLVTQQPLGGK_0000000000000000000000">
<PeptideSequence>MHARSTGPYSLVTQQPLGGK</PeptideSequence>
</Peptide>
<Peptide id="FQSITIEAFNDMLDNIEK_00000000000000000000">
<PeptideSequence>FQSITIEAFNDMLDNIEK</PeptideSequence>
</Peptide>
<Peptide id="KVSNNSPVIFDVTHALQCR_000000000000000000000">
<PeptideSequence>KVSNNSPVIFDVTHALQCR</PeptideSequence>
</Peptide>
<Peptide id="SACPCNIVILPVEILKNSSK_0000000000000000000000">
<PeptideSequence>SACPCNIVILPVEILKNSSK</PeptideSequence>
</Peptide>
<Peptide id="LEAIVKPGCVRILPDCVFR_000000000000000000000">
<PeptideSequence>LEAIVKPGCVRILPDCVFR</PeptideSequence>
</Peptide>
<Peptide id="ALETPNASVYLYGKSTRPNR_0000000000000000000000">
<PeptideSequence>ALETPNASVYLYGKSTRPNR</PeptideSequence>
</Peptide>
<Peptide id="NADLETIFNLAKPFLEEAGR_0000000000000000000000">
<PeptideSequence>NADLETIFNLAKPFLEEAGR</PeptideSequence>
</Peptide>
<Peptide id="ESIPEALEFLKDRPLYAEK_000000000000000000000">
<PeptideSequence>ESIPEALEFLKDRPLYAEK</PeptideSequence>
</Peptide>
<Peptide id="ECLACNVSDSNLDTAILEIPK_00000000000000000000000">
<PeptideSequence>ECLACNVSDSNLDTAILEIPK</PeptideSequence>
</Peptide>
<Peptide id="GYASLDYNFQRFQIADLVK_000000000000000000000">
<PeptideSequence>GYASLDYNFQRFQIADLVK</PeptideSequence>
</Peptide>
<Peptide id="VYVPTGFSAFPFELLHTPEK_0000000000000000000000">
<PeptideSequence>VYVPTGFSAFPFELLHTPEK</PeptideSequence>
</Peptide>
<Peptide id="LEAQHQALVTLWHQLHVDMK_0000000000000000000000">
<PeptideSequence>LEAQHQALVTLWHQLHVDMK</PeptideSequence>
</Peptide>
<Peptide id="LDLPPFTLIGATTRAGSLTSPLR_0000000000000000000000000">
<PeptideSequence>LDLPPFTLIGATTRAGSLTSPLR</PeptideSequence>
</Peptide>
<Peptide id="TANAIFQGEEQTEDDCQDALAK_000000000000000000000000">
<PeptideSequence>TANAIFQGEEQTEDDCQDALAK</PeptideSequence>
</Peptide>
<Peptide id="LDQYMHTDVTEDDLRDFQR_000000000000000000000">
<PeptideSequence>LDQYMHTDVTEDDLRDFQR</PeptideSequence>
</Peptide>
<Peptide id="EGIPLDEVLIQAFTLVKEVAGR_000000000000000000000000">
<PeptideSequence>EGIPLDEVLIQAFTLVKEVAGR</PeptideSequence>
</Peptide>
<Peptide id="LADGADLDDLLVPAFAVVREAAR_0000000000000000000000000">
<PeptideSequence>LADGADLDDLLVPAFAVVREAAR</PeptideSequence>
</Peptide>
<Peptide id="QMFDVAIQAAIGSHIIARQTVK_000000000000000000000000">
<PeptideSequence>QMFDVAIQAAIGSHIIARQTVK</PeptideSequence>
</Peptide>
<Peptide id="IGHSGTLDPEVDGVLPICVGKATK_00000000000000000000000000">
<PeptideSequence>IGHSGTLDPEVDGVLPICVGKATK</PeptideSequence>
</Peptide>
<Peptide id="GMLTGPVTILCWTFPREDITR_00000000000000000000000">
<PeptideSequence>GMLTGPVTILCWTFPREDITR</PeptideSequence>
</Peptide>
<Peptide id="CWQPTDFLPDPASEGFDEQVK_00000000000000000000000">
<PeptideSequence>CWQPTDFLPDPASEGFDEQVK</PeptideSequence>
</Peptide>
<Peptide id="DCLVNIGGFLCMNDDEMFSSAK_000000000000000000000000">
<PeptideSequence>DCLVNIGGFLCMNDDEMFSSAK</PeptideSequence>
</Peptide>
<Peptide id="FFGLIERPVLPPHLPADVAAYK_000000000000000000000000">
<PeptideSequence>FFGLIERPVLPPHLPADVAAYK</PeptideSequence>
</Peptide>
<Peptide id="QTNLSQVHITTKINPELIGGFR_000000000000000000000000">
<PeptideSequence>QTNLSQVHITTKINPELIGGFR</PeptideSequence>
</Peptide>
<Peptide id="PVQHCLTYLFARHHGGTFLIR_00000000000000000000000">
<PeptideSequence>PVQHCLTYLFARHHGGTFLIR</PeptideSequence>
</Peptide>
<Peptide id="IPGWRPVENAPMEKSLAGQTER_000000000000000000000000">
<PeptideSequence>IPGWRPVENAPMEKSLAGQTER</PeptideSequence>
</Peptide>
<Peptide id="ELVLLLLQWMRHHTAAFEER_0000000000000000000000">
<PeptideSequence>ELVLLLLQWMRHHTAAFEER</PeptideSequence>
</Peptide>
<Peptide id="FPNGVQLSPAEDFVLVAETTMAR_0000000000000000000000000">
<PeptideSequence>FPNGVQLSPAEDFVLVAETTMAR</PeptideSequence>
</Peptide>
<Peptide id="FEESINKLIAEGVTTFIEIGPGK_0000000000000000000000000">
<PeptideSequence>FEESINKLIAEGVTTFIEIGPGK</PeptideSequence>
</Peptide>
<Peptide id="GGNVIAGFAGATADAFTLLERLEAK_000000000000000000000000000">
<PeptideSequence>GGNVIAGFAGATADAFTLLERLEAK</PeptideSequence>
</Peptide>
<Peptide id="VGMTRLFDQESGAMVPVTVIDVK_0000000000000000000000000">
<PeptideSequence>VGMTRLFDQESGAMVPVTVIDVK</PeptideSequence>
</Peptide>
<Peptide id="TGAVINVKKPQFVSPGQMGNIVDK_00000000000000000000000000">
<PeptideSequence>TGAVINVKKPQFVSPGQMGNIVDK</PeptideSequence>
</Peptide>
<Peptide id="GANVIAGVWLEEAGQKLSIYNALK_00000000000000000000000000">
<PeptideSequence>GANVIAGVWLEEAGQKLSIYNALK</PeptideSequence>
</Peptide>
<Peptide id="GTVIDKVYLDSMDPHHWFDIR_00000000000000000000000">
<PeptideSequence>GTVIDKVYLDSMDPHHWFDIR</PeptideSequence>
</Peptide>
<Peptide id="MIEIDRLVSTDVLNENEALVDR_000000000000000000000000">
<PeptideSequence>MIEIDRLVSTDVLNENEALVDR</PeptideSequence>
</Peptide>
<Peptide id="SVTPVLDPEWQRSPEGLDYLSR_000000000000000000000000">
<PeptideSequence>SVTPVLDPEWQRSPEGLDYLSR</PeptideSequence>
</Peptide>
<Peptide id="IQVVADALNSMGADITPTADGMIIK_000000000000000000000000000">
<PeptideSequence>IQVVADALNSMGADITPTADGMIIK</PeptideSequence>
</Peptide>
<Peptide id="SLLVNGRPTEYPADEGEFHAWR_000000000000000000000000">
<PeptideSequence>SLLVNGRPTEYPADEGEFHAWR</PeptideSequence>
</Peptide>
<Peptide id="ADVMNVGVNLEAFSQAINAIQALR_00000000000000000000000000">
<PeptideSequence>ADVMNVGVNLEAFSQAINAIQALR</PeptideSequence>
</Peptide>
<Peptide id="NLAEASGFALSAIQDLVSLMPFGAR_000000000000000000000000000">
<PeptideSequence>NLAEASGFALSAIQDLVSLMPFGAR</PeptideSequence>
</Peptide>
<Peptide id="KFFGLIERPVLPPHLPADVAAYK_0000000000000000000000000">
<PeptideSequence>KFFGLIERPVLPPHLPADVAAYK</PeptideSequence>
</Peptide>
<Peptide id="ENPVVPIGCLATAAALTYGLYSFHR_000000000000000000000000000">
<PeptideSequence>ENPVVPIGCLATAAALTYGLYSFHR</PeptideSequence>
</Peptide>
<Peptide id="EHVKIQPENQTLASITFQNYFR_000000000000000000000000">
<PeptideSequence>EHVKIQPENQTLASITFQNYFR</PeptideSequence>
</Peptide>
<Peptide id="WSVENIQSALEPHKNDIQEVLNK_0000000000000000000000000">
<PeptideSequence>WSVENIQSALEPHKNDIQEVLNK</PeptideSequence>
</Peptide>
<Peptide id="IISSKPLFSPLPPSRSSIFSTFPSR_000000000000000000000000000">
<PeptideSequence>IISSKPLFSPLPPSRSSIFSTFPSR</PeptideSequence>
</Peptide>
<Peptide id="MAEPVGDLVVDLSLDAARFDEQMAR_000000000000000000000000000">
<PeptideSequence>MAEPVGDLVVDLSLDAARFDEQMAR</PeptideSequence>
</Peptide>
<Peptide id="WKYYLVNLWQCHFYVWSQPGR_00000000000000000000000">
<PeptideSequence>WKYYLVNLWQCHFYVWSQPGR</PeptideSequence>
</Peptide>
<Peptide id="DGKTYLLNFIDTPGHVDFSYEVSR_00000000000000000000000000">
<PeptideSequence>DGKTYLLNFIDTPGHVDFSYEVSR</PeptideSequence>
</Peptide>
<Peptide id="YAPSPTGLLHIGNARTALFNYLYAR_000000000000000000000000000">
<PeptideSequence>YAPSPTGLLHIGNARTALFNYLYAR</PeptideSequence>
</Peptide>
<Peptide id="EDDSIRPFKVETSDEEIHDLHQR_0000000000000000000000000">
<PeptideSequence>EDDSIRPFKVETSDEEIHDLHQR</PeptideSequence>
</Peptide>
<Peptide id="FCNALGHPISKSTWADSSDFDIIDR_000000000000000000000000000">
<PeptideSequence>FCNALGHPISKSTWADSSDFDIIDR</PeptideSequence>
</Peptide>
<Peptide id="LLEAAAQSTKGYYSPYSVSGSGSTAGSR_000000000000000000000000000000">
<PeptideSequence>LLEAAAQSTKGYYSPYSVSGSGSTAGSR</PeptideSequence>
</Peptide>
<Peptide id="DSDLGLNPVSLGDTIRVPMPALTEER_0000000000000000000000000000">
<PeptideSequence>DSDLGLNPVSLGDTIRVPMPALTEER</PeptideSequence>
</Peptide>
<Peptide id="TLKPEEQRQALHSLELHYQAFLR_0000000000000000000000000">
<PeptideSequence>TLKPEEQRQALHSLELHYQAFLR</PeptideSequence>
</Peptide>
<Peptide id="LLLAIIEKFQGGPVGLDNLAAAIGEER_00000000000000000000000000000">
<PeptideSequence>LLLAIIEKFQGGPVGLDNLAAAIGEER</PeptideSequence>
</Peptide>
<Peptide id="CWQPTDFLPDPASEGFDEQVKELR_00000000000000000000000000">
<PeptideSequence>CWQPTDFLPDPASEGFDEQVKELR</PeptideSequence>
</Peptide>
<Peptide id="WKYYLVNFWQCHFYVWSQPGR_00000000000000000000000">
<PeptideSequence>WKYYLVNFWQCHFYVWSQPGR</PeptideSequence>
</Peptide>
<Peptide id="VIIAGAGGAAHLPGMVAAMTPLPVIGVPVK_00000000000000000000000000000000">
<PeptideSequence>VIIAGAGGAAHLPGMVAAMTPLPVIGVPVK</PeptideSequence>
</Peptide>
<Peptide id="FDFTHPEPLKPEELERVELLVNR_0000000000000000000000000">
<PeptideSequence>FDFTHPEPLKPEELERVELLVNR</PeptideSequence>
</Peptide>
<Peptide id="MEGASTITQQVVKNFLLTNEVSLER_000000000000000000000000000">
<PeptideSequence>MEGASTITQQVVKNFLLTNEVSLER</PeptideSequence>
</Peptide>
<Peptide id="LFDQESGAMVPVTVIDVKGNTFAQIK_0000000000000000000000000000">
<PeptideSequence>LFDQESGAMVPVTVIDVKGNTFAQIK</PeptideSequence>
</Peptide>
<Peptide id="MQQLIPRQMFDVAIQAAIGSHIIAR_000000000000000000000000000">
<PeptideSequence>MQQLIPRQMFDVAIQAAIGSHIIAR</PeptideSequence>
</Peptide>
<Peptide id="TTCCDEVTVNDLLWKSVHDVDESVR_000000000000000000000000000">
<PeptideSequence>TTCCDEVTVNDLLWKSVHDVDESVR</PeptideSequence>
</Peptide>
<Peptide id="GAENIAYICLAVTVNLAGGQPVSMANMR_000000000000000000000000000000">
<PeptideSequence>GAENIAYICLAVTVNLAGGQPVSMANMR</PeptideSequence>
</Peptide>
<Peptide id="LASGMLLVALLVCLTVMVLMSVWQQR_0000000000000000000000000000">
<PeptideSequence>LASGMLLVALLVCLTVMVLMSVWQQR</PeptideSequence>
</Peptide>
<Peptide id="LDLKDVNIYYGAFHAVADVSLAVQPR_0000000000000000000000000000">
<PeptideSequence>LDLKDVNIYYGAFHAVADVSLAVQPR</PeptideSequence>
</Peptide>
<Peptide id="ENPLHRFQSITIEAFNDMLDNIEK_00000000000000000000000000">
<PeptideSequence>ENPLHRFQSITIEAFNDMLDNIEK</PeptideSequence>
</Peptide>
<Peptide id="LFENQLVGPESIAHIGDVMFTGTADGR_00000000000000000000000000000">
<PeptideSequence>LFENQLVGPESIAHIGDVMFTGTADGR</PeptideSequence>
</Peptide>
<Peptide id="MYQQNHLIISANDSNQNKFFGYNK_00000000000000000000000000">
<PeptideSequence>MYQQNHLIISANDSNQNKFFGYNK</PeptideSequence>
</Peptide>
<Peptide id="KFSLDDLLTNVMLYWTTGTIISSQR_000000000000000000000000000">
<PeptideSequence>KFSLDDLLTNVMLYWTTGTIISSQR</PeptideSequence>
</Peptide>
<Peptide id="LLEAQACTGGIIDPSTGERFPVTDAVNK_000000000000000000000000000000">
<PeptideSequence>LLEAQACTGGIIDPSTGERFPVTDAVNK</PeptideSequence>
</Peptide>
<Peptide id="LKPPEAAGYVEAVIESLDARTVAVTFR_00000000000000000000000000000">
<PeptideSequence>LKPPEAAGYVEAVIESLDARTVAVTFR</PeptideSequence>
</Peptide>
<Peptide id="MYQQNHFLISVNDSNQNKFLGYNK_00000000000000000000000000">
<PeptideSequence>MYQQNHFLISVNDSNQNKFLGYNK</PeptideSequence>
</Peptide>
<Peptide id="AIVVQSTYKPQDEFLIEALLLGDALR_0000000000000000000000000000">
<PeptideSequence>AIVVQSTYKPQDEFLIEALLLGDALR</PeptideSequence>
</Peptide>
<Peptide id="LLDAQLATGGIVDPRLGFHLPLEVAYQR_000000000000000000000000000000">
<PeptideSequence>LLDAQLATGGIVDPRLGFHLPLEVAYQR</PeptideSequence>
</Peptide>
<Peptide id="IGRMFPDMSIELFRPNGTSAVLLVTLGK_000000000000000000000000000000">
<PeptideSequence>IGRMFPDMSIELFRPNGTSAVLLVTLGK</PeptideSequence>
</Peptide>
<Peptide id="YAMHRHNVGFMAADVIAEIHDFPPPVK_00000000000000000000000000000">
<PeptideSequence>YAMHRHNVGFMAADVIAEIHDFPPPVK</PeptideSequence>
</Peptide>
<Peptide id="SIVFEAPHALASVPGGSSAITAALHAAESSTK_0000000000000000000000000000000000">
<PeptideSequence>SIVFEAPHALASVPGGSSAITAALHAAESSTK</PeptideSequence>
</Peptide>
<Peptide id="AIWSTEHAGFELVPQNLFQEFVMEVR_0000000000000000000000000000">
<PeptideSequence>AIWSTEHAGFELVPQNLFQEFVMEVR</PeptideSequence>
</Peptide>
<Peptide id="AAAIKDPLLSVILGFNVEILPDALSEIQK_0000000000000000000000000000000">
<PeptideSequence>AAAIKDPLLSVILGFNVEILPDALSEIQK</PeptideSequence>
</Peptide>
<Peptide id="NLFMPIRIAVSGEMHGPELPNTIYLLGR_000000000000000000000000000000">
<PeptideSequence>NLFMPIRIAVSGEMHGPELPNTIYLLGR</PeptideSequence>
</Peptide>
<Peptide id="GSLGLAPGVPIIDVVAVQPSGTSKVFVDFLR_000000000000000000000000000000000">
<PeptideSequence>GSLGLAPGVPIIDVVAVQPSGTSKVFVDFLR</PeptideSequence>
</Peptide>
<Peptide id="SLREALEAESAWCYLYGTGSVAGVYLPGSR_00000000000000000000000000000000">
<PeptideSequence>SLREALEAESAWCYLYGTGSVAGVYLPGSR</PeptideSequence>
</Peptide>
<Peptide id="LSPVVEEILYPAMEDYQLDIMIGEGPGAR_0000000000000000000000000000000">
<PeptideSequence>LSPVVEEILYPAMEDYQLDIMIGEGPGAR</PeptideSequence>
</Peptide>
<Peptide id="AILMSDLGLNPSTSGTLIRLPLPPLTEETR_00000000000000000000000000000000">
<PeptideSequence>AILMSDLGLNPSTSGTLIRLPLPPLTEETR</PeptideSequence>
</Peptide>
<Peptide id="TIQYLIGSGMDPRTENNPYLGFVYTSLR_000000000000000000000000000000">
<PeptideSequence>TIQYLIGSGMDPRTENNPYLGFVYTSLR</PeptideSequence>
</Peptide>
<Peptide id="ENPVVPIGCLATAAALTYGLYSFHRGNSQR_00000000000000000000000000000000">
<PeptideSequence>ENPVVPIGCLATAAALTYGLYSFHRGNSQR</PeptideSequence>
</Peptide>
<Peptide id="MADVMNVGVNLEAFSQAINAIQALRSSVTR_00000000000000000000000000000000">
<PeptideSequence>MADVMNVGVNLEAFSQAINAIQALRSSVTR</PeptideSequence>
</Peptide>
<Peptide id="AIWSTEHAGFELVPQNLFQEFVMEVRK_00000000000000000000000000000">
<PeptideSequence>AIWSTEHAGFELVPQNLFQEFVMEVRK</PeptideSequence>
</Peptide>
<Peptide id="YSEWKIDVANGSAAFGSALYNWAVSVPSQK_00000000000000000000000000000000">
<PeptideSequence>YSEWKIDVANGSAAFGSALYNWAVSVPSQK</PeptideSequence>
</Peptide>
<Peptide id="NDMVEYFAENLAGFQTTKFGWVQSYGSR_000000000000000000000000000000">
<PeptideSequence>NDMVEYFAENLAGFQTTKFGWVQSYGSR</PeptideSequence>
</Peptide>
<Peptide id="ASVLDVPYLLATQLQSFKDFLQDEVAPEK_0000000000000000000000000000000">
<PeptideSequence>ASVLDVPYLLATQLQSFKDFLQDEVAPEK</PeptideSequence>
</Peptide>
<Peptide id="TLSAVMPAYLNALSGKGVHILTFNDYLAER_00000000000000000000000000000000">
<PeptideSequence>TLSAVMPAYLNALSGKGVHILTFNDYLAER</PeptideSequence>
</Peptide>
<Peptide id="SLHDPDGLVATYISEVHEHDGHLYLGSFR_0000000000000000000000000000000">
<PeptideSequence>SLHDPDGLVATYISEVHEHDGHLYLGSFR</PeptideSequence>
</Peptide>
<Peptide id="GEFMNEAVPAGEGAMAAILGMDAEALKQVTDK_0000000000000000000000000000000000">
<PeptideSequence>GEFMNEAVPAGEGAMAAILGMDAEALKQVTDK</PeptideSequence>
</Peptide>
<Peptide id="VLGLRPFDVQLIGGMVLHQGAIAEMKTGEGK_000000000000000000000000000000000">
<PeptideSequence>VLGLRPFDVQLIGGMVLHQGAIAEMKTGEGK</PeptideSequence>
</Peptide>
<Peptide id="VNYQGIGSSGGVKQIIANTVDFGASDAPLSDEK_00000000000000000000000000000000000">
<PeptideSequence>VNYQGIGSSGGVKQIIANTVDFGASDAPLSDEK</PeptideSequence>
</Peptide>
<Peptide id="FVAQHIADSLTNVELTQDCKCLPVEGIHTR_00000000000000000000000000000000">
<PeptideSequence>FVAQHIADSLTNVELTQDCKCLPVEGIHTR</PeptideSequence>
</Peptide>
<Peptide id="GGSLADLAILIVDINEGFQPQTIESINILKR_000000000000000000000000000000000">
<PeptideSequence>GGSLADLAILIVDINEGFQPQTIESINILKR</PeptideSequence>
</Peptide>
<Peptide id="LAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGK_0000000000000000000000000000000000000">
<PeptideSequence>LAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGK</PeptideSequence>
</Peptide>
<Peptide id="AIAVQPDVLLMDEPCSALDPISTLAIEDLIATLK_000000000000000000000000000000000000">
<PeptideSequence>AIAVQPDVLLMDEPCSALDPISTLAIEDLIATLK</PeptideSequence>
</Peptide>
<Peptide id="TISNLLENEPIIQVGSFVVSHLKNLQASTDPSK_00000000000000000000000000000000000">
<PeptideSequence>TISNLLENEPIIQVGSFVVSHLKNLQASTDPSK</PeptideSequence>
</Peptide>
<Peptide id="GATSGKAIWSTEHAGFELVPQNLFQEFVMEVR_0000000000000000000000000000000000">
<PeptideSequence>GATSGKAIWSTEHAGFELVPQNLFQEFVMEVR</PeptideSequence>
</Peptide>
<Peptide id="LLQLKSEEMQTVQQEQLLQETQALQQSFLSEK_0000000000000000000000000000000000">
<PeptideSequence>LLQLKSEEMQTVQQEQLLQETQALQQSFLSEK</PeptideSequence>
</Peptide>
<Peptide id="VVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETR_00000000000000000000000000000000000000">
<PeptideSequence>VVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETR</PeptideSequence>
</Peptide>
<Peptide id="ATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFK_0000000000000000000000000000000000000">
<PeptideSequence>ATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFK</PeptideSequence>
</Peptide>
<Peptide id="QTFGVKVITDVHEASQAQPVAEVVDVIQLPAFLAR_0000000000000000000000000000000000000">
<PeptideSequence>QTFGVKVITDVHEASQAQPVAEVVDVIQLPAFLAR</PeptideSequence>
</Peptide>
<Peptide id="YLQKEHLIQHGISVTESVAVPSNDEQSLIEIGNK_000000000000000000000000000000000000">
<PeptideSequence>YLQKEHLIQHGISVTESVAVPSNDEQSLIEIGNK</PeptideSequence>
</Peptide>
<PeptideEvidence id="MKQK_000000_1_KDSA_ENT38_1_4" start="1" end="4" pre="-" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "MKQK_000000"/>
<PeptideEvidence id="SLPPR_0000000_1_APLP_LOCMI_498_502" start="498" end="502" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "SLPPR_0000000"/>
<PeptideEvidence id="AGFEVR_00000000_1_RPOB_CLOTH_520_525" start="520" end="525" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "AGFEVR_00000000"/>
<PeptideEvidence id="AGFEVR_00000000_1_RPOB_DECAR_618_623" start="618" end="623" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "AGFEVR_00000000"/>
<PeptideEvidence id="TFRQK_0000000_1_APLP_LOCMI_715_719" start="715" end="719" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "TFRQK_0000000"/>
<PeptideEvidence id="QTFGVK_00000000_1_KDSA_ENT38_86_91" start="86" end="91" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "QTFGVK_00000000"/>
<PeptideEvidence id="GNYVVK_00000000_1_PUR6_DEBOC_156_161" start="156" end="161" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "GNYVVK_00000000"/>
<PeptideEvidence id="YQSER_0000000_1_TRUB_LACS1_293_297" start="293" end="297" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "YQSER_0000000"/>
<PeptideEvidence id="RDTYK_0000000_1_RPOB_CLOTH_721_725" start="721" end="725" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "RDTYK_0000000"/>
<PeptideEvidence id="LSYDGK_00000000_1_APLP_LOCMI_3153_3158" start="3153" end="3158" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "LSYDGK_00000000"/>
<PeptideEvidence id="EENDNA_00000000_1_FABD_BACSU_312_317" start="312" end="317" pre="K" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "EENDNA_00000000"/>
<PeptideEvidence id="STSEKSK_000000000_1_PLEC1_HUMAN_1917_1923" start="1917" end="1923" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "STSEKSK_000000000"/>
<PeptideEvidence id="DFFLPK_00000000_1_CP2A6_HUMAN_382_387" start="382" end="387" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "DFFLPK_00000000"/>
<PeptideEvidence id="ENGYRK_00000000_1_KPRS_PYRFU_71_76" start="71" end="76" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "ENGYRK_00000000"/>
<PeptideEvidence id="DYVITR_00000000_1_PBPA_RICCN_227_232" start="227" end="232" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "DYVITR_00000000"/>
<PeptideEvidence id="GFQGAMR_000000000_1_RL3_AKKM8_120_126" start="120" end="126" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "GFQGAMR_000000000"/>
<PeptideEvidence id="KIGGYNK_000000000_1_MATK_CERBE_81_87" start="81" end="87" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "KIGGYNK_000000000"/>
<PeptideEvidence id="LSFSGLR_000000000_1_PLEC1_HUMAN_3440_3446" start="3440" end="3446" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LSFSGLR_000000000"/>
<PeptideEvidence id="LDIYQK_00000000_1_SYE_STRSY_66_71" start="66" end="71" pre="R" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "LDIYQK_00000000"/>
<PeptideEvidence id="SLYRIK_00000000_1_MATK_FRAVE_419_424" start="419" end="424" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "SLYRIK_00000000"/>
<PeptideEvidence id="SLYRIK_00000000_1_MATK_SPICA_421_426" start="421" end="426" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "SLYRIK_00000000"/>
<PeptideEvidence id="WTDMVK_00000000_1_SYE_STREM_168_173" start="168" end="173" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "WTDMVK_00000000"/>
<PeptideEvidence id="NSSKDTK_000000000_1_RMD6_YEAST_18_24" start="18" end="24" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "NSSKDTK_000000000"/>
<PeptideEvidence id="FVRICR_00000000_1_MATK_CERBE_403_408" start="403" end="408" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "FVRICR_00000000"/>
<PeptideEvidence id="FVRICR_00000000_1_MATK_SPICA_402_407" start="402" end="407" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "FVRICR_00000000"/>
<PeptideEvidence id="FIEQEK_00000000_1_PLEC1_HUMAN_2645_2650" start="2645" end="2650" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "FIEQEK_00000000"/>
<PeptideEvidence id="TVAVTFR_000000000_1_BRIX_AERPE_149_155" start="149" end="155" pre="R" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "TVAVTFR_000000000"/>
<PeptideEvidence id="MQEEEK_00000000_1_CP2A6_HUMAN_275_280" start="275" end="280" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "MQEEEK_00000000"/>
<PeptideEvidence id="YKGIAGGK_0000000000_1_PP438_ARATH_169_176" start="169" end="176" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "YKGIAGGK_0000000000"/>
<PeptideEvidence id="AAYIAER_000000000_1_SYE_STREM_141_147" start="141" end="147" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "AAYIAER_000000000"/>
<PeptideEvidence id="ALMDTDK_000000000_1_HSLV_RHILO_139_145" start="139" end="145" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "ALMDTDK_000000000"/>
<PeptideEvidence id="SAPYAER_000000000_1_METE_VIBHA_412_418" start="412" end="418" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "SAPYAER_000000000"/>
<PeptideEvidence id="MLFARR_00000000_1_LEPA_LEGPA_1_6" start="1" end="6" pre="-" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "MLFARR_00000000"/>
<PeptideEvidence id="VISYWR_00000000_1_HYEP_HUMAN_93_98" start="93" end="98" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "VISYWR_00000000"/>
<PeptideEvidence id="NKSIFSK_000000000_1_MATK_CERBE_193_199" start="193" end="199" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "NKSIFSK_000000000"/>
<PeptideEvidence id="SILYDGR_000000000_1_RPOB_CLOTH_1029_1035" start="1029" end="1035" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "SILYDGR_000000000"/>
<PeptideEvidence id="TAYIAER_000000000_1_SYE_STRSY_121_127" start="121" end="127" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "TAYIAER_000000000"/>
<PeptideEvidence id="DAVYTVR_000000000_1_FABD_BACSU_108_114" start="108" end="114" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "DAVYTVR_000000000"/>
<PeptideEvidence id="TDRYLR_00000000_1_HSLV_RHILO_88_93" start="88" end="93" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "TDRYLR_00000000"/>
<PeptideEvidence id="SLLFCLK_000000000_1_PBPA_RICCN_4_10" start="4" end="10" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "SLLFCLK_000000000"/>
<PeptideEvidence id="WPIGLGGK_0000000000_1_PSTS_ECOLI_193_200" start="193" end="200" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "WPIGLGGK_0000000000"/>
<PeptideEvidence id="WPIGLGGK_0000000000_1_PSTS_SHIFL_193_200" start="193" end="200" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "WPIGLGGK_0000000000"/>
<PeptideEvidence id="GEFVFTK_000000000_1_VMTH_LAMBD_754_760" start="754" end="760" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "GEFVFTK_000000000"/>
<PeptideEvidence id="FEKTFR_00000000_1_APLP_LOCMI_712_717" start="712" end="717" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "FEKTFR_00000000"/>
<PeptideEvidence id="FYEKIK_00000000_1_MATK_FRAVE_244_249" start="244" end="249" pre="R" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "FYEKIK_00000000"/>
<PeptideEvidence id="VAVRNLR_000000000_1_RRF_BORA1_127_133" start="127" end="133" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "VAVRNLR_000000000"/>
<PeptideEvidence id="AALDFYK_000000000_1_PTH_SPHAL_74_80" start="74" end="80" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "AALDFYK_000000000"/>
<PeptideEvidence id="LQPVKDK_000000000_1_METE_VIBHA_309_315" start="309" end="315" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "LQPVKDK_000000000"/>
<PeptideEvidence id="FLGLTER_000000000_1_HYEP_HUMAN_271_277" start="271" end="277" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "FLGLTER_000000000"/>
<PeptideEvidence id="NEFDWK_00000000_1_HYEP_HUMAN_99_104" start="99" end="104" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "NEFDWK_00000000"/>
<PeptideEvidence id="GFDDQTR_000000000_1_VMTH_LAMBD_279_285" start="279" end="285" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "GFDDQTR_000000000"/>
<PeptideEvidence id="YRQSER_00000000_1_SYE_STREM_80_85" start="80" end="85" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "YRQSER_00000000"/>
<PeptideEvidence id="IYSRDGK_000000000_1_PBPA_RICCN_51_57" start="51" end="57" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "IYSRDGK_000000000"/>
<PeptideEvidence id="ELGNHRL_000000000_1_RMD6_YEAST_225_231" start="225" end="231" pre="K" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "ELGNHRL_000000000"/>
<PeptideEvidence id="GHIADAVR_0000000000_1_METE_VIBHA_468_475" start="468" end="475" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "GHIADAVR_0000000000"/>
<PeptideEvidence id="FLSVLER_000000000_1_HYEP_HUMAN_448_454" start="448" end="454" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "FLSVLER_000000000"/>
<PeptideEvidence id="AQFEQLK_000000000_1_PLEC1_HUMAN_3463_3469" start="3463" end="3469" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "AQFEQLK_000000000"/>
<PeptideEvidence id="VYVAQKR_000000000_1_RPOB_CLOTH_925_931" start="925" end="931" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "VYVAQKR_000000000"/>
<PeptideEvidence id="SPAAFDQK_0000000000_1_SYE_STRSY_295_302" start="295" end="302" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "SPAAFDQK_0000000000"/>
<PeptideEvidence id="SPAAFDQK_0000000000_1_SYE_STREM_315_322" start="315" end="322" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "SPAAFDQK_0000000000"/>
<PeptideEvidence id="NIQFGER_000000000_1_APLP_LOCMI_3161_3167" start="3161" end="3167" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "NIQFGER_000000000"/>
<PeptideEvidence id="NGKIIYR_000000000_1_PBPA_RICCN_590_596" start="590" end="596" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "NGKIIYR_000000000"/>
<PeptideEvidence id="VQRSAFR_000000000_1_METE_VIBHA_447_453" start="447" end="453" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "VQRSAFR_000000000"/>
<PeptideEvidence id="QVEILNR_000000000_1_HYEP_HUMAN_106_112" start="106" end="112" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "QVEILNR_000000000"/>
<PeptideEvidence id="LALEAARK_0000000000_1_VMTH_LAMBD_365_372" start="365" end="372" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "LALEAARK_0000000000"/>
<PeptideEvidence id="YLYLSGR_000000000_1_STAD_SOLTU_183_189" start="183" end="189" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "YLYLSGR_000000000"/>
<PeptideEvidence id="VFYDATR_000000000_1_TPL_CITFR_211_217" start="211" end="217" pre="K" post="C" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "VFYDATR_000000000"/>
<PeptideEvidence id="VFYDATR_000000000_1_TPL_ESCIN_211_217" start="211" end="217" pre="K" post="C" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "VFYDATR_000000000"/>
<PeptideEvidence id="AENILPSK_0000000000_1_KPRS_PYRFU_133_140" start="133" end="140" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "AENILPSK_0000000000"/>
<PeptideEvidence id="VFYSLMR_000000000_1_HYEP_HUMAN_289_295" start="289" end="295" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "VFYSLMR_000000000"/>
<PeptideEvidence id="GLLSAEVAR_00000000000_1_PLEC1_HUMAN_3850_3858" start="3850" end="3858" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "GLLSAEVAR_00000000000"/>
<PeptideEvidence id="CLQLPLTK_0000000000_1_RUVB_HAMD5_200_207" start="200" end="207" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "CLQLPLTK_0000000000"/>
<PeptideEvidence id="IGIGHPGHK_00000000000_1_PTH_SPHAL_130_138" start="130" end="138" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "IGIGHPGHK_00000000000"/>
<PeptideEvidence id="DGILPLYK_0000000000_1_TRUB_LACS1_2_9" start="2" end="9" pre="M" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "DGILPLYK_0000000000"/>
<PeptideEvidence id="VPVDVAYR_0000000000_1_PLEC1_HUMAN_2961_2968" start="2961" end="2968" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "VPVDVAYR_0000000000"/>
<PeptideEvidence id="RDANSDLK_0000000000_1_RRF_ALCBS_133_140" start="133" end="140" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "RDANSDLK_0000000000"/>
<PeptideEvidence id="EVDSNVKK_0000000000_1_PP438_ARATH_480_487" start="480" end="487" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "EVDSNVKK_0000000000"/>
<PeptideEvidence id="ELEICRR_000000000_1_PUR6_DEBOC_328_334" start="328" end="334" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "ELEICRR_000000000"/>
<PeptideEvidence id="QVKSTVTR_0000000000_1_FABP_CLOSI_80_87" start="80" end="87" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_FABP_CLOSI" peptide_ref = "QVKSTVTR_0000000000"/>
<PeptideEvidence id="FGINNEPK_0000000000_1_PBPA_RICCN_540_547" start="540" end="547" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "FGINNEPK_0000000000"/>
<PeptideEvidence id="GDINSEVGK_00000000000_1_EF2_ARCFU_271_279" start="271" end="279" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "GDINSEVGK_00000000000"/>
<PeptideEvidence id="EIRSEER_000000000_1_IF2P_METTP_300_306" start="300" end="306" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "EIRSEER_000000000"/>
<PeptideEvidence id="GFNSVATAR_00000000000_1_HYEP_HUMAN_198_206" start="198" end="206" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "GFNSVATAR_00000000000"/>
<PeptideEvidence id="SDAQSRMK_0000000000_1_RRF_ALCBS_7_14" start="7" end="14" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "SDAQSRMK_0000000000"/>
<PeptideEvidence id="AGISVGQYK_00000000000_1_VMTH_LAMBD_58_66" start="58" end="66" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "AGISVGQYK_00000000000"/>
<PeptideEvidence id="ITERFEK_000000000_1_APLP_LOCMI_708_714" start="708" end="714" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "ITERFEK_000000000"/>
<PeptideEvidence id="RDYVITR_000000000_1_PBPA_RICCN_226_232" start="226" end="232" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "RDYVITR_000000000"/>
<PeptideEvidence id="GFQGAMRR_0000000000_1_RL3_AKKM8_120_127" start="120" end="127" pre="K" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "GFQGAMRR_0000000000"/>
<PeptideEvidence id="DTPLLMNK_0000000000_1_MATK_CERBE_287_294" start="287" end="294" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "DTPLLMNK_0000000000"/>
<PeptideEvidence id="DTPLLMNK_0000000000_1_MATK_FRAVE_284_291" start="284" end="291" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "DTPLLMNK_0000000000"/>
<PeptideEvidence id="DTPLLMNK_0000000000_1_MATK_SPICA_286_293" start="286" end="293" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "DTPLLMNK_0000000000"/>
<PeptideEvidence id="CIYQYNK_000000000_1_TRUB_LACS1_282_288" start="282" end="288" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "CIYQYNK_000000000"/>
<PeptideEvidence id="DKLLSAER_0000000000_1_PLEC1_HUMAN_4139_4146" start="4139" end="4146" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "DKLLSAER_0000000000"/>
<PeptideEvidence id="TTSGPVLEK_00000000000_1_RUVB_HAMD5_86_94" start="86" end="94" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "TTSGPVLEK_00000000000"/>
<PeptideEvidence id="AAWKTNIK_0000000000_1_PSTS_ECOLI_331_338" start="331" end="338" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "AAWKTNIK_0000000000"/>
<PeptideEvidence id="AAWKTNIK_0000000000_1_PSTS_SHIFL_331_338" start="331" end="338" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "AAWKTNIK_0000000000"/>
<PeptideEvidence id="DAEELKVK_0000000000_1_AROA_STRP4_332_339" start="332" end="339" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "DAEELKVK_0000000000"/>
<PeptideEvidence id="DAEELKVK_0000000000_1_AROA_STRPN_332_339" start="332" end="339" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "DAEELKVK_0000000000"/>
<PeptideEvidence id="EVESLKAR_0000000000_1_SYA_THET2_761_768" start="761" end="768" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "EVESLKAR_0000000000"/>
<PeptideEvidence id="DAEEIARK_0000000000_1_HSLV_RHILO_146_153" start="146" end="153" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "DAEEIARK_0000000000"/>
<PeptideEvidence id="DKPSLPFK_0000000000_1_PBPA_RICCN_719_726" start="719" end="726" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "DKPSLPFK_0000000000"/>
<PeptideEvidence id="ELMWKPK_000000000_1_EF2_ARCFU_12_18" start="12" end="18" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "ELMWKPK_000000000"/>
<PeptideEvidence id="KVISYWR_000000000_1_HYEP_HUMAN_92_98" start="92" end="98" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "KVISYWR_000000000"/>
<PeptideEvidence id="STVRTFLK_0000000000_1_MATK_CERBE_444_451" start="444" end="451" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "STVRTFLK_0000000000"/>
<PeptideEvidence id="STVRTFLK_0000000000_1_MATK_FRAVE_441_448" start="441" end="448" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "STVRTFLK_0000000000"/>
<PeptideEvidence id="STVRTFLK_0000000000_1_MATK_SPICA_443_450" start="443" end="450" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "STVRTFLK_0000000000"/>
<PeptideEvidence id="GLTFASSLR_00000000000_1_RPOB_DECAR_93_101" start="93" end="101" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "GLTFASSLR_00000000000"/>
<PeptideEvidence id="QNNLAYTK_0000000000_1_PSTS_ECOLI_226_233" start="226" end="233" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "QNNLAYTK_0000000000"/>
<PeptideEvidence id="QNNLAYTK_0000000000_1_PSTS_SHIFL_226_233" start="226" end="233" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "QNNLAYTK_0000000000"/>
<PeptideEvidence id="DLPPLRLK_0000000000_1_AROA_STRP4_143_150" start="143" end="150" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "DLPPLRLK_0000000000"/>
<PeptideEvidence id="DLPPLRLK_0000000000_1_AROA_STRPN_143_150" start="143" end="150" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "DLPPLRLK_0000000000"/>
<PeptideEvidence id="DAVYTVRK_0000000000_1_FABD_BACSU_108_115" start="108" end="115" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "DAVYTVRK_0000000000"/>
<PeptideEvidence id="GKGFQGAMR_00000000000_1_RL3_AKKM8_118_126" start="118" end="126" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "GKGFQGAMR_00000000000"/>
<PeptideEvidence id="NEFDWKK_000000000_1_HYEP_HUMAN_99_105" start="99" end="105" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "NEFDWKK_000000000"/>
<PeptideEvidence id="SVSSSSSLGR_000000000000_1_YQB6_CAEEL_1028_1037" start="1028" end="1037" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "SVSSSSSLGR_000000000000"/>
<PeptideEvidence id="NCFGEGLAR_00000000000_1_CP2A6_HUMAN_438_446" start="438" end="446" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "NCFGEGLAR_00000000000"/>
<PeptideEvidence id="QINMSFVK_0000000000_1_PP438_ARATH_504_511" start="504" end="511" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "QINMSFVK_0000000000"/>
<PeptideEvidence id="SPDDYELK_0000000000_1_APLP_LOCMI_1318_1325" start="1318" end="1325" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "SPDDYELK_0000000000"/>
<PeptideEvidence id="LEEVGYEK_0000000000_1_PUR6_DEBOC_549_556" start="549" end="556" pre="R" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "LEEVGYEK_0000000000"/>
<PeptideEvidence id="TLEFFPGR_0000000000_1_KPRS_PYRFU_125_132" start="125" end="132" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "TLEFFPGR_0000000000"/>
<PeptideEvidence id="FLGEITMR_0000000000_1_PBPA_RICCN_503_510" start="503" end="510" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "FLGEITMR_0000000000"/>
<PeptideEvidence id="GGGAAGHNGIR_0000000000000_1_PTH_SPHAL_105_115" start="105" end="115" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "GGGAAGHNGIR_0000000000000"/>
<PeptideEvidence id="RMEEEER_000000000_1_PLEC1_HUMAN_1480_1486" start="1480" end="1486" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "RMEEEER_000000000"/>
<PeptideEvidence id="GAFISNTLR_00000000000_1_RPOB_DECAR_348_356" start="348" end="356" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "GAFISNTLR_00000000000"/>
<PeptideEvidence id="TGEDDSNIK_00000000000_1_YQB6_CAEEL_871_879" start="871" end="879" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "TGEDDSNIK_00000000000"/>
<PeptideEvidence id="ANVANKYAK_00000000000_1_ATPD_STAHJ_2_10" start="2" end="10" pre="M" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "ANVANKYAK_00000000000"/>
<PeptideEvidence id="IEVFDSLR_0000000000_1_STAD_SOLTU_67_74" start="67" end="74" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "IEVFDSLR_0000000000"/>
<PeptideEvidence id="QVRYLGDK_0000000000_1_TPL_CITFR_321_328" start="321" end="328" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "QVRYLGDK_0000000000"/>
<PeptideEvidence id="QVRYLGDK_0000000000_1_TPL_ESCIN_321_328" start="321" end="328" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "QVRYLGDK_0000000000"/>
<PeptideEvidence id="NPESFKEK_0000000000_1_HIG2A_HUMAN_31_38" start="31" end="38" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_HIG2A_HUMAN" peptide_ref = "NPESFKEK_0000000000"/>
<PeptideEvidence id="AMEEQQSR_0000000000_1_SYA_THET2_430_437" start="430" end="437" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "AMEEQQSR_0000000000"/>
<PeptideEvidence id="VVAKNIVDK_00000000000_1_RPOB_DECAR_300_308" start="300" end="308" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "VVAKNIVDK_00000000000"/>
<PeptideEvidence id="FTHPNLEK_0000000000_1_APLP_LOCMI_2219_2226" start="2219" end="2226" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "FTHPNLEK_0000000000"/>
<PeptideEvidence id="SNYQAFQK_0000000000_1_MED27_DANRE_234_241" start="234" end="241" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "SNYQAFQK_0000000000"/>
<PeptideEvidence id="FLSVLERQ_0000000000_1_HYEP_HUMAN_448_455" start="448" end="455" pre="K" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "FLSVLERQ_0000000000"/>
<PeptideEvidence id="ALMGANMQR_00000000000_1_RPOB_CLOTH_659_667" start="659" end="667" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "ALMGANMQR_00000000000"/>
<PeptideEvidence id="ALMGANMQR_00000000000_1_RPOB_DECAR_754_762" start="754" end="762" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "ALMGANMQR_00000000000"/>
<PeptideEvidence id="ALFDVAIDK_00000000000_1_ATPD_STAHJ_11_19" start="11" end="19" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "ALFDVAIDK_00000000000"/>
<PeptideEvidence id="SPAAFDQKK_00000000000_1_SYE_STRSY_295_303" start="295" end="303" pre="K" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "SPAAFDQKK_00000000000"/>
<PeptideEvidence id="SPAAFDQKK_00000000000_1_SYE_STREM_315_323" start="315" end="323" pre="K" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "SPAAFDQKK_00000000000"/>
<PeptideEvidence id="NIQFGERK_0000000000_1_APLP_LOCMI_3161_3168" start="3161" end="3168" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "NIQFGERK_0000000000"/>
<PeptideEvidence id="DRPLYAEK_0000000000_1_PUR6_DEBOC_175_182" start="175" end="182" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "DRPLYAEK_0000000000"/>
<PeptideEvidence id="ETLESREK_0000000000_1_MED27_DANRE_43_50" start="43" end="50" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "ETLESREK_0000000000"/>
<PeptideEvidence id="IIPLLTDPK_00000000000_1_HYEP_HUMAN_160_168" start="160" end="168" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "IIPLLTDPK_00000000000"/>
<PeptideEvidence id="MHEVIPGAR_00000000000_1_PSTB_MYCS2_53_61" start="53" end="61" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "MHEVIPGAR_00000000000"/>
<PeptideEvidence id="MHEVIPGAR_00000000000_1_PSTB_MYCSM_53_61" start="53" end="61" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "MHEVIPGAR_00000000000"/>
<PeptideEvidence id="FGDNGLKMK_00000000000_1_FABP_CLOSI_45_53" start="45" end="53" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_FABP_CLOSI" peptide_ref = "FGDNGLKMK_00000000000"/>
<PeptideEvidence id="DLPRYDLK_0000000000_1_TRUB_LACS1_240_247" start="240" end="247" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "DLPRYDLK_0000000000"/>
<PeptideEvidence id="TKEVDSNVK_00000000000_1_PP438_ARATH_478_486" start="478" end="486" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "TKEVDSNVK_00000000000"/>
<PeptideEvidence id="GTVDARTAQK_000000000000_1_PLEC1_HUMAN_4552_4561" start="4552" end="4561" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "GTVDARTAQK_000000000000"/>
<PeptideEvidence id="LLRAIFGEK_00000000000_1_RPOB_CLOTH_874_882" start="874" end="882" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "LLRAIFGEK_00000000000"/>
<PeptideEvidence id="LLRAIFGEK_00000000000_1_RPOB_DECAR_976_984" start="976" end="984" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "LLRAIFGEK_00000000000"/>
<PeptideEvidence id="DADVEKELK_00000000000_1_APLP_LOCMI_2718_2726" start="2718" end="2726" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "DADVEKELK_00000000000"/>
<PeptideEvidence id="FGINNEPKK_00000000000_1_PBPA_RICCN_540_548" start="540" end="548" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "FGINNEPKK_00000000000"/>
<PeptideEvidence id="GEIEQTELK_00000000000_1_METE_VIBHA_29_37" start="29" end="37" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "GEIEQTELK_00000000000"/>
<PeptideEvidence id="KGFNSVATAR_000000000000_1_HYEP_HUMAN_197_206" start="197" end="206" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "KGFNSVATAR_000000000000"/>
<PeptideEvidence id="LISLFQAMK_00000000000_1_PLEC1_HUMAN_4159_4167" start="4159" end="4167" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LISLFQAMK_00000000000"/>
<PeptideEvidence id="VKTYEAIVK_00000000000_1_RPOB_CLOTH_1121_1129" start="1121" end="1129" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "VKTYEAIVK_00000000000"/>
<PeptideEvidence id="SIFAKSNQR_00000000000_1_MATK_FRAVE_195_203" start="195" end="203" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "SIFAKSNQR_00000000000"/>
<PeptideEvidence id="YLEDGGLER_00000000000_1_HYEP_HUMAN_339_347" start="339" end="347" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "YLEDGGLER_00000000000"/>
<PeptideEvidence id="LSEPFSDEK_00000000000_1_TRUB_LACS1_91_99" start="91" end="99" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "LSEPFSDEK_00000000000"/>
<PeptideEvidence id="IDFMDVSPK_00000000000_1_RPOB_CLOTH_630_638" start="630" end="638" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "IDFMDVSPK_00000000000"/>
<PeptideEvidence id="VLEQMYLR_0000000000_1_YQB6_CAEEL_658_665" start="658" end="665" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "VLEQMYLR_0000000000"/>
<PeptideEvidence id="SAGYGELLNK_000000000000_1_PP438_ARATH_385_394" start="385" end="394" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "SAGYGELLNK_000000000000"/>
<PeptideEvidence id="ILVELRNGR_00000000000_1_RPOB_DECAR_506_514" start="506" end="514" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "ILVELRNGR_00000000000"/>
<PeptideEvidence id="FRDFFLPK_0000000000_1_CP2A6_HUMAN_380_387" start="380" end="387" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "FRDFFLPK_0000000000"/>
<PeptideEvidence id="DVELLYPVK_00000000000_1_HYEP_HUMAN_278_286" start="278" end="286" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "DVELLYPVK_00000000000"/>
<PeptideEvidence id="ERAEQESAR_00000000000_1_PLEC1_HUMAN_2163_2171" start="2163" end="2171" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "ERAEQESAR_00000000000"/>
<PeptideEvidence id="RYDLAKPGR_00000000000_1_RPOB_CLOTH_263_271" start="263" end="271" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "RYDLAKPGR_00000000000"/>
<PeptideEvidence id="KWDDEAIAK_00000000000_1_PSTS_ECOLI_135_143" start="135" end="143" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "KWDDEAIAK_00000000000"/>
<PeptideEvidence id="KWDDEAIAK_00000000000_1_PSTS_SHIFL_135_143" start="135" end="143" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "KWDDEAIAK_00000000000"/>
<PeptideEvidence id="VGTTVLDGSVK_0000000000000_1_ATPD_STAHJ_155_165" start="155" end="165" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "VGTTVLDGSVK_0000000000000"/>
<PeptideEvidence id="GKNLFMPIR_00000000000_1_SYE_STRSY_421_429" start="421" end="429" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "GKNLFMPIR_00000000000"/>
<PeptideEvidence id="GKNLFMPIR_00000000000_1_SYE_STREM_441_449" start="441" end="449" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "GKNLFMPIR_00000000000"/>
<PeptideEvidence id="AEQQTQQDK_00000000000_1_VMTH_LAMBD_374_382" start="374" end="382" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "AEQQTQQDK_00000000000"/>
<PeptideEvidence id="LTGLSSEGRR_000000000000_1_STAD_SOLTU_343_352" start="343" end="352" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "LTGLSSEGRR_000000000000"/>
<PeptideEvidence id="LIEIDDTEK_00000000000_1_PSTB_MYCS2_231_239" start="231" end="239" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "LIEIDDTEK_00000000000"/>
<PeptideEvidence id="LIEIDDTEK_00000000000_1_PSTB_MYCSM_231_239" start="231" end="239" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "LIEIDDTEK_00000000000"/>
<PeptideEvidence id="GDVTVISKTR_000000000000_1_APLP_LOCMI_175_184" start="175" end="184" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "GDVTVISKTR_000000000000"/>
<PeptideEvidence id="EGLVSETKGR_000000000000_1_SECA2_ALKMQ_346_355" start="346" end="355" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "EGLVSETKGR_000000000000"/>
<PeptideEvidence id="KLGFVEVQR_00000000000_1_RMD6_YEAST_186_194" start="186" end="194" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "KLGFVEVQR_00000000000"/>
<PeptideEvidence id="SKEEVSQLR_00000000000_1_IF2P_METTP_11_19" start="11" end="19" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "SKEEVSQLR_00000000000"/>
<PeptideEvidence id="QELLRQFR_0000000000_1_PLEC1_HUMAN_3405_3412" start="3405" end="3412" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "QELLRQFR_0000000000"/>
<PeptideEvidence id="VEFTLVPER_00000000000_1_RPOB_DECAR_240_248" start="240" end="248" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "VEFTLVPER_00000000000"/>
<PeptideEvidence id="TWAAEDQLR_00000000000_1_VMTH_LAMBD_618_626" start="618" end="626" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "TWAAEDQLR_00000000000"/>
<PeptideEvidence id="NGAVFVDIVR_000000000000_1_TPL_CITFR_133_142" start="133" end="142" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "NGAVFVDIVR_000000000000"/>
<PeptideEvidence id="NGAVFVDIVR_000000000000_1_TPL_ESCIN_133_142" start="133" end="142" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "NGAVFVDIVR_000000000000"/>
<PeptideEvidence id="GLFEVNPWK_00000000000_1_APMAP_HUMAN_171_179" start="171" end="179" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "GLFEVNPWK_00000000000"/>
<PeptideEvidence id="VVRSEGEDAK_000000000000_1_RRF_BORA1_117_126" start="117" end="126" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "VVRSEGEDAK_000000000000"/>
<PeptideEvidence id="MPGQMGNAKR_000000000000_1_RL3_AKKM8_163_172" start="163" end="172" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "MPGQMGNAKR_000000000000"/>
<PeptideEvidence id="YQGKSILASK_000000000000_1_MATK_CERBE_277_286" start="277" end="286" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "YQGKSILASK_000000000000"/>
<PeptideEvidence id="YQGKSILASK_000000000000_1_MATK_SPICA_276_285" start="276" end="285" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "YQGKSILASK_000000000000"/>
<PeptideEvidence id="SVSSSSSLGRK_0000000000000_1_YQB6_CAEEL_1028_1038" start="1028" end="1038" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "SVSSSSSLGRK_0000000000000"/>
<PeptideEvidence id="SGVGKTSFIAK_0000000000000_1_CA089_XENLA_60_70" start="60" end="70" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "SGVGKTSFIAK_0000000000000"/>
<PeptideEvidence id="GLKFIYEPK_00000000000_1_TPL_CITFR_436_444" start="436" end="444" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "GLKFIYEPK_00000000000"/>
<PeptideEvidence id="GLKFIYEPK_00000000000_1_TPL_ESCIN_436_444" start="436" end="444" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "GLKFIYEPK_00000000000"/>
<PeptideEvidence id="YILRLSCVK_00000000000_1_MATK_FRAVE_425_433" start="425" end="433" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "YILRLSCVK_00000000000"/>
<PeptideEvidence id="ELGVNFFIR_00000000000_1_FABP_CLOSI_22_30" start="22" end="30" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_FABP_CLOSI" peptide_ref = "ELGVNFFIR_00000000000"/>
<PeptideEvidence id="EDDSIRPFK_00000000000_1_HYEP_HUMAN_44_52" start="44" end="52" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "EDDSIRPFK_00000000000"/>
<PeptideEvidence id="LHERLVAIR_00000000000_1_PLEC1_HUMAN_614_622" start="614" end="622" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LHERLVAIR_00000000000"/>
<PeptideEvidence id="IGEGDEMIDK_000000000000_1_PP438_ARATH_373_382" start="373" end="382" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "IGEGDEMIDK_000000000000"/>
<PeptideEvidence id="DMEAMAIGLR_000000000000_1_TPL_CITFR_298_307" start="298" end="307" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "DMEAMAIGLR_000000000000"/>
<PeptideEvidence id="DMEAMAIGLR_000000000000_1_TPL_ESCIN_298_307" start="298" end="307" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "DMEAMAIGLR_000000000000"/>
<PeptideEvidence id="DQSKQLLFK_00000000000_1_APLP_LOCMI_1501_1509" start="1501" end="1509" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "DQSKQLLFK_00000000000"/>
<PeptideEvidence id="MLKNISSVSK_000000000000_1_SECA2_ALKMQ_1_10" start="1" end="10" pre="-" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "MLKNISSVSK_000000000000"/>
<PeptideEvidence id="FLETLEGGLK_000000000000_1_SYA_THET2_368_377" start="368" end="377" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "FLETLEGGLK_000000000000"/>
<PeptideEvidence id="FQGWLQDGR_00000000000_1_PTH_SPHAL_42_50" start="42" end="50" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "FQGWLQDGR_00000000000"/>
<PeptideEvidence id="QIFPSKFDK_00000000000_1_TRUB_LACS1_152_160" start="152" end="160" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "QIFPSKFDK_00000000000"/>
<PeptideEvidence id="VEECQRFAK_00000000000_1_PLEC1_HUMAN_1402_1410" start="1402" end="1410" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "VEECQRFAK_00000000000"/>
<PeptideEvidence id="FATVRFIQK_00000000000_1_YQB6_CAEEL_451_459" start="451" end="459" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "FATVRFIQK_00000000000"/>
<PeptideEvidence id="MANVANKYAK_000000000000_1_ATPD_STAHJ_1_10" start="1" end="10" pre="-" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "MANVANKYAK_000000000000"/>
<PeptideEvidence id="LKYTEEAQK_00000000000_1_VMTH_LAMBD_395_403" start="395" end="403" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "LKYTEEAQK_00000000000"/>
<PeptideEvidence id="LLEYDTVTR_00000000000_1_APMAP_HUMAN_239_247" start="239" end="247" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "LLEYDTVTR_00000000000"/>
<PeptideEvidence id="DPSYLHLLR_00000000000_1_MATK_CERBE_169_177" start="169" end="177" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "DPSYLHLLR_00000000000"/>
<PeptideEvidence id="AGEKVDIPER_000000000000_1_TRUB_LACS1_134_143" start="134" end="143" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "AGEKVDIPER_000000000000"/>
<PeptideEvidence id="ERVAQLLER_00000000000_1_PLEC1_HUMAN_1316_1324" start="1316" end="1324" pre="R" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "ERVAQLLER_00000000000"/>
<PeptideEvidence id="AGENRAIAALK_0000000000000_1_APLP_LOCMI_464_474" start="464" end="474" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "AGENRAIAALK_0000000000000"/>
<PeptideEvidence id="QITLFHINK_00000000000_1_SECA2_ALKMQ_664_672" start="664" end="672" pre="K" post="C" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "QITLFHINK_00000000000"/>
<PeptideEvidence id="LDYIIGKSSK_000000000000_1_PUR6_DEBOC_373_382" start="373" end="382" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "LDYIIGKSSK_000000000000"/>
<PeptideEvidence id="VVNYLMDSGK_000000000000_1_TRUB_LACS1_55_64" start="55" end="64" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "VVNYLMDSGK_000000000000"/>
<PeptideEvidence id="YDLSGVGRMK_000000000000_1_RPOB_DECAR_399_408" start="399" end="408" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "YDLSGVGRMK_000000000000"/>
<PeptideEvidence id="DFIDSFLIR_00000000000_1_CP2A6_HUMAN_266_274" start="266" end="274" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "DFIDSFLIR_00000000000"/>
<PeptideEvidence id="MENDYGLKR_00000000000_1_PP438_ARATH_201_209" start="201" end="209" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "MENDYGLKR_00000000000"/>
<PeptideEvidence id="FSSASGVEVDK_0000000000000_1_VMTH_LAMBD_212_222" start="212" end="222" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "FSSASGVEVDK_0000000000000"/>
<PeptideEvidence id="LGEGIILAPDK_0000000000000_1_KPRS_PYRFU_150_160" start="150" end="160" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "LGEGIILAPDK_0000000000000"/>
<PeptideEvidence id="HDDGNTVIVR_000000000000_1_FABP_CLOSI_99_108" start="99" end="108" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_FABP_CLOSI" peptide_ref = "HDDGNTVIVR_000000000000"/>
<PeptideEvidence id="HATTIVTVRK_000000000000_1_HSLV_RHILO_2_11" start="2" end="11" pre="M" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "HATTIVTVRK_000000000000"/>
<PeptideEvidence id="QRELEQLGR_00000000000_1_PLEC1_HUMAN_1336_1344" start="1336" end="1344" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "QRELEQLGR_00000000000"/>
<PeptideEvidence id="YSVDECKER_00000000000_1_RPOB_CLOTH_75_83" start="75" end="83" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "YSVDECKER_00000000000"/>
<PeptideEvidence id="LGKPAEMVKR_000000000000_1_BRIX_AERPE_167_176" start="167" end="176" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "LGKPAEMVKR_000000000000"/>
<PeptideEvidence id="KPEQGTEVLK_000000000000_1_PSTS_ECOLI_291_300" start="291" end="300" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "KPEQGTEVLK_000000000000"/>
<PeptideEvidence id="KPEQGTEVLK_000000000000_1_PSTS_SHIFL_291_300" start="291" end="300" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "KPEQGTEVLK_000000000000"/>
<PeptideEvidence id="NYTMSFLPR_00000000000_1_CP2A6_HUMAN_486_494" start="486" end="494" pre="R" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "NYTMSFLPR_00000000000"/>
<PeptideEvidence id="VVRAEAEQAR_000000000000_1_RRF_ALCBS_116_125" start="116" end="125" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "VVRAEAEQAR_000000000000"/>
<PeptideEvidence id="DQVIAGLVGGAE_00000000000000_1_CA089_XENLA_238_249" start="238" end="249" pre="R" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "DQVIAGLVGGAE_00000000000000"/>
<PeptideEvidence id="SSIFSTFPSR_000000000000_1_PP438_ARATH_48_57" start="48" end="57" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "SSIFSTFPSR_000000000000"/>
<PeptideEvidence id="MHATTIVTVR_000000000000_1_HSLV_RHILO_1_10" start="1" end="10" pre="-" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "MHATTIVTVR_000000000000"/>
<PeptideEvidence id="YDRIADFTK_00000000000_1_IF2P_METTP_194_202" start="194" end="202" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "YDRIADFTK_00000000000"/>
<PeptideEvidence id="LEQLKDLNR_00000000000_1_LEPA_LEGPA_7_15" start="7" end="15" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "LEQLKDLNR_00000000000"/>
<PeptideEvidence id="LISYSYMVR_00000000000_1_HYEP_HUMAN_420_428" start="420" end="428" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "LISYSYMVR_00000000000"/>
<PeptideEvidence id="TEAEIALKEK_000000000000_1_PLEC1_HUMAN_1987_1996" start="1987" end="1996" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "TEAEIALKEK_000000000000"/>
<PeptideEvidence id="GETQLTPEEK_000000000000_1_RPOB_DECAR_966_975" start="966" end="975" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "GETQLTPEEK_000000000000"/>
<PeptideEvidence id="DKESLTLVVK_000000000000_1_PP438_ARATH_210_219" start="210" end="219" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "DKESLTLVVK_000000000000"/>
<PeptideEvidence id="MFEDGYITR_00000000000_1_PBPA_RICCN_233_241" start="233" end="241" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "MFEDGYITR_00000000000"/>
<PeptideEvidence id="LETALAGSTIR_0000000000000_1_IF2P_METTP_326_336" start="326" end="336" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "LETALAGSTIR_0000000000000"/>
<PeptideEvidence id="EMSVYEAYR_00000000000_1_PLEC1_HUMAN_4288_4296" start="4288" end="4296" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "EMSVYEAYR_00000000000"/>
<PeptideEvidence id="ELQSLCLDVK_000000000000_1_RPOB_CLOTH_1148_1157" start="1148" end="1157" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "ELQSLCLDVK_000000000000"/>
<PeptideEvidence id="DLSATIPGAFR_0000000000000_1_BRIX_AERPE_17_27" start="17" end="27" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "DLSATIPGAFR_0000000000000"/>
<PeptideEvidence id="GNDGIAAFVQR_0000000000000_1_PSTS_ECOLI_201_211" start="201" end="211" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "GNDGIAAFVQR_0000000000000"/>
<PeptideEvidence id="GNDGIAAFVQR_0000000000000_1_PSTS_SHIFL_201_211" start="201" end="211" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "GNDGIAAFVQR_0000000000000"/>
<PeptideEvidence id="ELYEQVPAAK_000000000000_1_FABD_BACSU_21_30" start="21" end="30" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "ELYEQVPAAK_000000000000"/>
<PeptideEvidence id="ELIPTEEALR_000000000000_1_PLEC1_HUMAN_3926_3935" start="3926" end="3935" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "ELIPTEEALR_000000000000"/>
<PeptideEvidence id="GADRIVVVGER_0000000000000_1_BRIX_AERPE_46_56" start="46" end="56" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "GADRIVVVGER_0000000000000"/>
<PeptideEvidence id="RVFTEVTYR_00000000000_1_YQB6_CAEEL_108_116" start="108" end="116" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "RVFTEVTYR_00000000000"/>
<PeptideEvidence id="GHASIAEKMVK_0000000000000_1_PP438_ARATH_225_235" start="225" end="235" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "GHASIAEKMVK_0000000000000"/>
<PeptideEvidence id="KGDVIVVEAIK_0000000000000_1_PBPA_RICCN_396_406" start="396" end="406" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "KGDVIVVEAIK_0000000000000"/>
<PeptideEvidence id="GYGVVFSNGER_0000000000000_1_CP2A6_HUMAN_113_123" start="113" end="123" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "GYGVVFSNGER_0000000000000"/>
<PeptideEvidence id="GYIETEDDDK_000000000000_1_APLP_LOCMI_683_692" start="683" end="692" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "GYIETEDDDK_000000000000"/>
<PeptideEvidence id="IRIGIGHPGHK_0000000000000_1_PTH_SPHAL_128_138" start="128" end="138" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "IRIGIGHPGHK_0000000000000"/>
<PeptideEvidence id="LEAIVKPGCVR_0000000000000_1_IF2P_METTP_469_479" start="469" end="479" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "LEAIVKPGCVR_0000000000000"/>
<PeptideEvidence id="GVQVSMTYSGR_0000000000000_1_LEPA_LEGPA_439_449" start="439" end="449" pre="R" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "GVQVSMTYSGR_0000000000000"/>
<PeptideEvidence id="LYEYARAGEK_000000000000_1_TRUB_LACS1_128_137" start="128" end="137" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "LYEYARAGEK_000000000000"/>
<PeptideEvidence id="LREAIAELER_000000000000_1_PLEC1_HUMAN_2585_2594" start="2585" end="2594" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LREAIAELER_000000000000"/>
<PeptideEvidence id="AARDSGVVILAK_00000000000000_1_RPOB_CLOTH_688_699" start="688" end="699" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "AARDSGVVILAK_00000000000000"/>
<PeptideEvidence id="VFDFLKDGMK_000000000000_1_MED27_DANRE_31_40" start="31" end="40" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "VFDFLKDGMK_000000000000"/>
<PeptideEvidence id="QRQLAAEEER_000000000000_1_PLEC1_HUMAN_2109_2118" start="2109" end="2118" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "QRQLAAEEER_000000000000"/>
<PeptideEvidence id="SARCLQLPLTK_0000000000000_1_RUVB_HAMD5_197_207" start="197" end="207" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "SARCLQLPLTK_0000000000000"/>
<PeptideEvidence id="AEAEQARVSIR_0000000000000_1_RRF_ALCBS_119_129" start="119" end="129" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "AEAEQARVSIR_0000000000000"/>
<PeptideEvidence id="DYPDKIFTCK_000000000000_1_SECA2_ALKMQ_407_416" start="407" end="416" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "DYPDKIFTCK_000000000000"/>
<PeptideEvidence id="LAEDEAFQRR_000000000000_1_PLEC1_HUMAN_2006_2015" start="2006" end="2015" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LAEDEAFQRR_000000000000"/>
<PeptideEvidence id="ERDATYAAPLK_0000000000000_1_RPOB_CLOTH_82_92" start="82" end="92" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "ERDATYAAPLK_0000000000000"/>
<PeptideEvidence id="LARQDVIEYK_000000000000_1_RPOB_DECAR_413_422" start="413" end="422" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "LARQDVIEYK_000000000000"/>
<PeptideEvidence id="SLEALDTAMKR_0000000000000_1_RRF_ALCBS_16_26" start="16" end="26" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "SLEALDTAMKR_0000000000000"/>
<PeptideEvidence id="RHFSGTESDAK_0000000000000_1_VMTH_LAMBD_28_38" start="28" end="38" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "RHFSGTESDAK_0000000000000"/>
<PeptideEvidence id="NYPAEPFRIK_000000000000_1_TPL_CITFR_2_11" start="2" end="11" pre="M" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "NYPAEPFRIK_000000000000"/>
<PeptideEvidence id="NYPAEPFRIK_000000000000_1_TPL_ESCIN_2_11" start="2" end="11" pre="M" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "NYPAEPFRIK_000000000000"/>
<PeptideEvidence id="KFQGWLQDGR_000000000000_1_PTH_SPHAL_41_50" start="41" end="50" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "KFQGWLQDGR_000000000000"/>
<PeptideEvidence id="IQTVGLYMGPR_0000000000000_1_EF2_ARCFU_333_343" start="333" end="343" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "IQTVGLYMGPR_0000000000000"/>
<PeptideEvidence id="NLSHYYSGSSK_0000000000000_1_MATK_CERBE_409_419" start="409" end="419" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "NLSHYYSGSSK_0000000000000"/>
<PeptideEvidence id="GWLYYEAGQR_000000000000_1_PLEC1_HUMAN_4514_4523" start="4514" end="4523" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "GWLYYEAGQR_000000000000"/>
<PeptideEvidence id="ENGDELAPGVNK_00000000000000_1_RPOB_CLOTH_910_921" start="910" end="921" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "ENGDELAPGVNK_00000000000000"/>
<PeptideEvidence id="FVNTYETQLK_000000000000_1_APLP_LOCMI_2497_2506" start="2497" end="2506" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "FVNTYETQLK_000000000000"/>
<PeptideEvidence id="VEEGVLRVGER_0000000000000_1_SYA_THET2_548_558" start="548" end="558" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "VEEGVLRVGER_0000000000000"/>
<PeptideEvidence id="AQARAEEDAQR_0000000000000_1_PLEC1_HUMAN_2532_2542" start="2532" end="2542" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "AQARAEEDAQR_0000000000000"/>
<PeptideEvidence id="DTKLGPEDITR_0000000000000_1_RPOB_CLOTH_815_825" start="815" end="825" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "DTKLGPEDITR_0000000000000"/>
<PeptideEvidence id="LENGEIETIAR_0000000000000_1_APMAP_HUMAN_124_134" start="124" end="134" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "LENGEIETIAR_0000000000000"/>
<PeptideEvidence id="ITEAANKAAAER_00000000000000_1_SECA_MESSB_734_745" start="734" end="745" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "ITEAANKAAAER_00000000000000"/>
<PeptideEvidence id="VEGSPLEGLESK_00000000000000_1_SYA_THET2_668_679" start="668" end="679" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "VEGSPLEGLESK_00000000000000"/>
<PeptideEvidence id="DTPLLMNKWK_000000000000_1_MATK_CERBE_287_296" start="287" end="296" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "DTPLLMNKWK_000000000000"/>
<PeptideEvidence id="DTPLLMNKWK_000000000000_1_MATK_FRAVE_284_293" start="284" end="293" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "DTPLLMNKWK_000000000000"/>
<PeptideEvidence id="DTPLLMNKWK_000000000000_1_MATK_SPICA_286_295" start="286" end="295" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "DTPLLMNKWK_000000000000"/>
<PeptideEvidence id="DANSDLKELLK_0000000000000_1_RRF_ALCBS_134_144" start="134" end="144" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "DANSDLKELLK_0000000000000"/>
<PeptideEvidence id="GVTFVSHGNTAR_00000000000000_1_STAD_SOLTU_227_238" start="227" end="238" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "GVTFVSHGNTAR_00000000000000"/>
<PeptideEvidence id="VLKEISENWK_000000000000_1_APLP_LOCMI_2517_2526" start="2517" end="2526" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "VLKEISENWK_000000000000"/>
<PeptideEvidence id="GLFEVNPWKR_000000000000_1_APMAP_HUMAN_171_180" start="171" end="180" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "GLFEVNPWKR_000000000000"/>
<PeptideEvidence id="EHLVNLDHLR_000000000000_1_SECA_MESSB_772_781" start="772" end="781" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "EHLVNLDHLR_000000000000"/>
<PeptideEvidence id="MYKSLLFCLK_000000000000_1_PBPA_RICCN_1_10" start="1" end="10" pre="-" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "MYKSLLFCLK_000000000000"/>
<PeptideEvidence id="LIACLMEEANR_0000000000000_1_YQB6_CAEEL_219_229" start="219" end="229" pre="R" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "LIACLMEEANR_0000000000000"/>
<PeptideEvidence id="ALFDVAIDKDR_0000000000000_1_ATPD_STAHJ_11_21" start="11" end="21" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "ALFDVAIDKDR_0000000000000"/>
<PeptideEvidence id="EKEISEDEQR_000000000000_1_RRF_ALCBS_145_154" start="145" end="154" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "EKEISEDEQR_000000000000"/>
<PeptideEvidence id="SATLIVESSDLK_00000000000000_1_AROA_STRP4_287_298" start="287" end="298" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "SATLIVESSDLK_00000000000000"/>
<PeptideEvidence id="SATLIVESSDLK_00000000000000_1_AROA_STRPN_287_298" start="287" end="298" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "SATLIVESSDLK_00000000000000"/>
<PeptideEvidence id="EMQALSDEALR_0000000000000_1_SECA_MESSB_36_46" start="36" end="46" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "EMQALSDEALR_0000000000000"/>
<PeptideEvidence id="FLETLEGGLKR_0000000000000_1_SYA_THET2_368_378" start="368" end="378" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "FLETLEGGLKR_0000000000000"/>
<PeptideEvidence id="DSDTQLTQVQK_0000000000000_1_FABP_CLOSI_88_98" start="88" end="98" pre="R" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_FABP_CLOSI" peptide_ref = "DSDTQLTQVQK_0000000000000"/>
<PeptideEvidence id="ASYTLNKFYR_000000000000_1_MATK_SPICA_475_484" start="475" end="484" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "ASYTLNKFYR_000000000000"/>
<PeptideEvidence id="LEQYPDQLTR_000000000000_1_HSLV_RHILO_68_77" start="68" end="77" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "LEQYPDQLTR_000000000000"/>
<PeptideEvidence id="FSTWTNTEFR_000000000000_1_HYEP_HUMAN_329_338" start="329" end="338" pre="K" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "FSTWTNTEFR_000000000000"/>
<PeptideEvidence id="QLFSNTVIPNR_0000000000000_1_RPOB_CLOTH_155_165" start="155" end="165" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "QLFSNTVIPNR_0000000000000"/>
<PeptideEvidence id="GEEQIQQLTDK_0000000000000_1_RRF_ALCBS_156_166" start="156" end="166" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "GEEQIQQLTDK_0000000000000"/>
<PeptideEvidence id="KTAAVVEQSLSR_00000000000000_1_VMTH_LAMBD_39_50" start="39" end="50" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "KTAAVVEQSLSR_00000000000000"/>
<PeptideEvidence id="TLDEVAERSLR_0000000000000_1_PSTB_MYCS2_120_130" start="120" end="130" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "TLDEVAERSLR_0000000000000"/>
<PeptideEvidence id="TLDEVAERSLR_0000000000000_1_PSTB_MYCSM_120_130" start="120" end="130" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "TLDEVAERSLR_0000000000000"/>
<PeptideEvidence id="NNVTGEHHRPK_0000000000000_1_TPL_CITFR_389_399" start="389" end="399" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "NNVTGEHHRPK_0000000000000"/>
<PeptideEvidence id="NNVTGEHHRPK_0000000000000_1_TPL_ESCIN_389_399" start="389" end="399" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "NNVTGEHHRPK_0000000000000"/>
<PeptideEvidence id="ANVTKDGVDIEK_00000000000000_1_SECA2_ALKMQ_728_739" start="728" end="739" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "ANVTKDGVDIEK_00000000000000"/>
<PeptideEvidence id="GQDEVQKLTDR_0000000000000_1_RRF_BORA1_157_167" start="157" end="167" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "GQDEVQKLTDR_0000000000000"/>
<PeptideEvidence id="DQMQIFIQAAK_0000000000000_1_RUVB_HAMD5_40_50" start="40" end="50" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "DQMQIFIQAAK_0000000000000"/>
<PeptideEvidence id="KMGVSISGQTER_00000000000000_1_AROA_STRP4_131_142" start="131" end="142" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "KMGVSISGQTER_00000000000000"/>
<PeptideEvidence id="KMGVSISGQTER_00000000000000_1_AROA_STRPN_131_142" start="131" end="142" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "KMGVSISGQTER_00000000000000"/>
<PeptideEvidence id="YGFDSNRYDR_000000000000_1_IF2P_METTP_187_196" start="187" end="196" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "YGFDSNRYDR_000000000000"/>
<PeptideEvidence id="GARDEIQTQMR_0000000000000_1_VMTH_LAMBD_833_843" start="833" end="843" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "GARDEIQTQMR_0000000000000"/>
<PeptideEvidence id="SVADIRNSAESR_00000000000000_1_RRF_BORA1_2_13" start="2" end="13" pre="M" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "SVADIRNSAESR_00000000000000"/>
<PeptideEvidence id="SLAIDIDLERY_0000000000000_1_RPOB_DECAR_1417_1427" start="1417" end="1427" pre="R" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "SLAIDIDLERY_0000000000000"/>
<PeptideEvidence id="DGVTVDAAEKFR_00000000000000_1_APLP_LOCMI_313_324" start="313" end="324" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "DGVTVDAAEKFR_00000000000000"/>
<PeptideEvidence id="GNSQRSQLMMR_0000000000000_1_HIG2A_HUMAN_70_80" start="70" end="80" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_HIG2A_HUMAN" peptide_ref = "GNSQRSQLMMR_0000000000000"/>
<PeptideEvidence id="MTQYAIEAPKR_0000000000000_1_PUR6_DEBOC_436_446" start="436" end="446" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "MTQYAIEAPKR_0000000000000"/>
<PeptideEvidence id="LEPADYEVDEK_0000000000000_1_SECA_MESSB_248_258" start="248" end="258" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "LEPADYEVDEK_0000000000000"/>
<PeptideEvidence id="LSALGPGGLSRER_000000000000000_1_RPOB_CLOTH_507_519" start="507" end="519" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "LSALGPGGLSRER_000000000000000"/>
<PeptideEvidence id="VSALGPGGLTRER_000000000000000_1_RPOB_DECAR_605_617" start="605" end="617" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "VSALGPGGLTRER_000000000000000"/>
<PeptideEvidence id="DFRWMGPIYK_000000000000_1_SECA2_ALKMQ_142_151" start="142" end="151" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "DFRWMGPIYK_000000000000"/>
<PeptideEvidence id="AAMAFEREIFK_0000000000000_1_SYA_THET2_440_450" start="440" end="450" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "AAMAFEREIFK_0000000000000"/>
<PeptideEvidence id="ERGMTSNDAVIK_00000000000000_1_TRUB_LACS1_10_21" start="10" end="21" pre="K" post="C" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "ERGMTSNDAVIK_00000000000000"/>
<PeptideEvidence id="RLTAEDLFEAR_0000000000000_1_PLEC1_HUMAN_3783_3793" start="3783" end="3793" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "RLTAEDLFEAR_0000000000000"/>
<PeptideEvidence id="SSFEDVPALISR_00000000000000_1_CA089_XENLA_145_156" start="145" end="156" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "SSFEDVPALISR_00000000000000"/>
<PeptideEvidence id="ICEHYVTVTQK_0000000000000_1_KDSA_ENT38_37_47" start="37" end="47" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "ICEHYVTVTQK_0000000000000"/>
<PeptideEvidence id="EQLIALFDESR_0000000000000_1_SYE_STREM_301_311" start="301" end="311" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "EQLIALFDESR_0000000000000"/>
<PeptideEvidence id="AQGMGLEAGALFR_000000000000000_1_SYA_THET2_834_846" start="834" end="846" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "AQGMGLEAGALFR_000000000000000"/>
<PeptideEvidence id="TLEAFHDTCRQ_0000000000000_1_MED27_DANRE_301_311" start="301" end="311" pre="R" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "TLEAFHDTCRQ_0000000000000"/>
<PeptideEvidence id="SIIFGSLAEGETK_000000000000000_1_AROA_STRP4_26_38" start="26" end="38" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "SIIFGSLAEGETK_000000000000000"/>
<PeptideEvidence id="SIIFGSLAEGETK_000000000000000_1_AROA_STRPN_26_38" start="26" end="38" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "SIIFGSLAEGETK_000000000000000"/>
<PeptideEvidence id="AGISVGQYKAAMR_000000000000000_1_VMTH_LAMBD_58_70" start="58" end="70" pre="K" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "AGISVGQYKAAMR_000000000000000"/>
<PeptideEvidence id="ESGSGFTLTLPSR_000000000000000_1_APLP_LOCMI_2147_2159" start="2147" end="2159" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "ESGSGFTLTLPSR_000000000000000"/>
<PeptideEvidence id="GNTFAQIKTEDK_00000000000000_1_RL3_AKKM8_33_44" start="33" end="44" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "GNTFAQIKTEDK_00000000000000"/>
<PeptideEvidence id="NFSIIAHIDHGK_00000000000000_1_LEPA_LEGPA_18_29" start="18" end="29" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "NFSIIAHIDHGK_00000000000000"/>
<PeptideEvidence id="IDFELTVTADQK_00000000000000_1_APLP_LOCMI_1858_1869" start="1858" end="1869" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "IDFELTVTADQK_00000000000000"/>
<PeptideEvidence id="MVTQKEAEIMTV_00000000000000_1_RRF_BORA1_175_186" start="175" end="186" pre="K" post="-" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "MVTQKEAEIMTV_00000000000000"/>
<PeptideEvidence id="LAQGHTTVDELAR_000000000000000_1_PLEC1_HUMAN_2809_2821" start="2809" end="2821" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LAQGHTTVDELAR_000000000000000"/>
<PeptideEvidence id="ALQERIDDLIPK_00000000000000_1_RPOB_CLOTH_384_395" start="384" end="395" pre="K" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "ALQERIDDLIPK_00000000000000"/>
<PeptideEvidence id="FSIATLRDFGVGK_000000000000000_1_CP2A6_HUMAN_130_142" start="130" end="142" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "FSIATLRDFGVGK_000000000000000"/>
<PeptideEvidence id="LFDEADETLETK_00000000000000_1_FABD_BACSU_32_43" start="32" end="43" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "LFDEADETLETK_00000000000000"/>
<PeptideEvidence id="GGGKGALAQGGGLDPR_000000000000000000_1_SYA_THET2_856_871" start="856" end="871" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "GGGKGALAQGGGLDPR_000000000000000000"/>
<PeptideEvidence id="LFNYSVIHMMR_0000000000000_1_RMD6_YEAST_152_162" start="152" end="162" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "LFNYSVIHMMR_0000000000000"/>
<PeptideEvidence id="AMRPDKYSEWK_0000000000000_1_EF2_ARCFU_180_190" start="180" end="190" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "AMRPDKYSEWK_0000000000000"/>
<PeptideEvidence id="EALVDQAEEFSGR_000000000000000_1_CP2A6_HUMAN_89_101" start="89" end="101" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "EALVDQAEEFSGR_000000000000000"/>
<PeptideEvidence id="TIQYLIGSGMDPR_000000000000000_1_STAD_SOLTU_198_210" start="198" end="210" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "TIQYLIGSGMDPR_000000000000000"/>
<PeptideEvidence id="EDEAIVHPWINK_00000000000000_1_SECA_MESSB_610_621" start="610" end="621" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "EDEAIVHPWINK_00000000000000"/>
<PeptideEvidence id="IQEEAGFLIDALR_000000000000000_1_CP2A6_HUMAN_149_161" start="149" end="161" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "IQEEAGFLIDALR_000000000000000"/>
<PeptideEvidence id="LAQICGSIAADEKR_0000000000000000_1_STAD_SOLTU_248_261" start="248" end="261" pre="K" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "LAQICGSIAADEKR_0000000000000000"/>
<PeptideEvidence id="EKLIEQLYSPVR_00000000000000_1_FABD_BACSU_245_256" start="245" end="256" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "EKLIEQLYSPVR_00000000000000"/>
<PeptideEvidence id="SMIQHIGDDFRR_00000000000000_1_PTH_SPHAL_116_127" start="116" end="127" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "SMIQHIGDDFRR_00000000000000"/>
<PeptideEvidence id="DTKYSLYTTINR_00000000000000_1_RMD6_YEAST_22_33" start="22" end="33" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "DTKYSLYTTINR_00000000000000"/>
<PeptideEvidence id="HANGFPDLDTLFK_000000000000000_1_METE_VIBHA_84_96" start="84" end="96" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "HANGFPDLDTLFK_000000000000000"/>
<PeptideEvidence id="TVSNVISSIVFGDR_0000000000000000_1_CP2A6_HUMAN_177_190" start="177" end="190" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "TVSNVISSIVFGDR_0000000000000000"/>
<PeptideEvidence id="TLNRMHEVIPGAR_000000000000000_1_PSTB_MYCS2_49_61" start="49" end="61" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "TLNRMHEVIPGAR_000000000000000"/>
<PeptideEvidence id="TLNRMHEVIPGAR_000000000000000_1_PSTB_MYCSM_49_61" start="49" end="61" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "TLNRMHEVIPGAR_000000000000000"/>
<PeptideEvidence id="SAAVLFDTPGSSADR_00000000000000000_1_APLP_LOCMI_1019_1033" start="1019" end="1033" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "SAAVLFDTPGSSADR_00000000000000000"/>
<PeptideEvidence id="LNCVLHAEILLKK_000000000000000_1_SECA2_ALKMQ_295_307" start="295" end="307" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "LNCVLHAEILLKK_000000000000000"/>
<PeptideEvidence id="APVKEMFGFAGAIR_0000000000000000_1_EF2_ARCFU_665_678" start="665" end="678" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "APVKEMFGFAGAIR_0000000000000000"/>
<PeptideEvidence id="LSESLYPIDYAVK_000000000000000_1_TRUB_LACS1_227_239" start="227" end="239" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "LSESLYPIDYAVK_000000000000000"/>
<PeptideEvidence id="EEEEVGFDWSDR_00000000000000_1_PLEC1_HUMAN_773_784" start="773" end="784" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "EEEEVGFDWSDR_00000000000000"/>
<PeptideEvidence id="YGDLHDDKMLYK_00000000000000_1_YQB6_CAEEL_596_607" start="596" end="607" pre="K" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "YGDLHDDKMLYK_00000000000000"/>
<PeptideEvidence id="YVDQLLAEGKAYK_000000000000000_1_SYE_STRSY_72_84" start="72" end="84" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "YVDQLLAEGKAYK_000000000000000"/>
<PeptideEvidence id="LDKPGGGLSGGQQQR_00000000000000000_1_PSTB_MYCS2_142_156" start="142" end="156" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "LDKPGGGLSGGQQQR_00000000000000000"/>
<PeptideEvidence id="LDKPGGGLSGGQQQR_00000000000000000_1_PSTB_MYCSM_142_156" start="142" end="156" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "LDKPGGGLSGGQQQR_00000000000000000"/>
<PeptideEvidence id="IFGSDRMDGMLQK_000000000000000_1_SECA_MESSB_593_605" start="593" end="605" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "IFGSDRMDGMLQK_000000000000000"/>
<PeptideEvidence id="GADVALVLSGGQAVLK_000000000000000000_1_SYA_THET2_814_829" start="814" end="829" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "GADVALVLSGGQAVLK_000000000000000000"/>
<PeptideEvidence id="AQCVSLNYTAKDGK_0000000000000000_1_LEPA_LEGPA_68_81" start="68" end="81" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "AQCVSLNYTAKDGK_0000000000000000"/>
<PeptideEvidence id="VVNYLMDSGKVYK_000000000000000_1_TRUB_LACS1_55_67" start="55" end="67" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "VVNYLMDSGKVYK_000000000000000"/>
<PeptideEvidence id="GENVPEPGIPECFK_0000000000000000_1_RPOB_CLOTH_1130_1143" start="1130" end="1143" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "GENVPEPGIPECFK_0000000000000000"/>
<PeptideEvidence id="CFVDVIFNFAKGR_000000000000000_1_YQB6_CAEEL_523_535" start="523" end="535" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "CFVDVIFNFAKGR_000000000000000"/>
<PeptideEvidence id="TLVLSGNQAGLTADR_00000000000000000_1_VMTH_LAMBD_152_166" start="152" end="166" pre="K" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "TLVLSGNQAGLTADR_00000000000000000"/>
<PeptideEvidence id="TLNELAESVLDALK_0000000000000000_1_APLP_LOCMI_2553_2566" start="2553" end="2566" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "TLNELAESVLDALK_0000000000000000"/>
<PeptideEvidence id="GVELASELAKENGAK_00000000000000000_1_FABD_BACSU_175_189" start="175" end="189" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "GVELASELAKENGAK_00000000000000000"/>
<PeptideEvidence id="DAAKEAMDSPIVLR_0000000000000000_1_PBPA_RICCN_242_255" start="242" end="255" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "DAAKEAMDSPIVLR_0000000000000000"/>
<PeptideEvidence id="AGRPKQVTDFFEK_000000000000000_1_PP438_ARATH_188_200" start="188" end="200" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "AGRPKQVTDFFEK_000000000000000"/>
<PeptideEvidence id="ILQADYNTLMAAAK_0000000000000000_1_VMTH_LAMBD_431_444" start="431" end="444" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "ILQADYNTLMAAAK_0000000000000000"/>
<PeptideEvidence id="SVSSLETTETEIVK_0000000000000000_1_MATK_SPICA_110_123" start="110" end="123" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "SVSSLETTETEIVK_0000000000000000"/>
<PeptideEvidence id="GTGGANIDPTFFLSR_00000000000000000_1_CP2A6_HUMAN_162_176" start="162" end="176" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "GTGGANIDPTFFLSR_00000000000000000"/>
<PeptideEvidence id="LAGEMSRGGFEIGTK_00000000000000000_1_PP438_ARATH_267_281" start="267" end="281" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "LAGEMSRGGFEIGTK_00000000000000000"/>
<PeptideEvidence id="LPQGWVLSAGVVNGR_00000000000000000_1_METE_VIBHA_281_295" start="281" end="295" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "LPQGWVLSAGVVNGR_00000000000000000"/>
<PeptideEvidence id="KQEELQQLEQQR_00000000000000_1_PLEC1_HUMAN_2706_2717" start="2706" end="2717" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "KQEELQQLEQQR_00000000000000"/>
<PeptideEvidence id="VTPKGETQLTPEEK_0000000000000000_1_RPOB_DECAR_962_975" start="962" end="975" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "VTPKGETQLTPEEK_0000000000000000"/>
<PeptideEvidence id="FQFWDCGEGALRK_000000000000000_1_CA089_XENLA_108_120" start="108" end="120" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "FQFWDCGEGALRK_000000000000000"/>
<PeptideEvidence id="LILASKDTPLLMNK_0000000000000000_1_MATK_FRAVE_278_291" start="278" end="291" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "LILASKDTPLLMNK_0000000000000000"/>
<PeptideEvidence id="YSLVLELSDSGAFR_0000000000000000_1_APMAP_HUMAN_361_374" start="361" end="374" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "YSLVLELSDSGAFR_0000000000000000"/>
<PeptideEvidence id="SELYNTIDTFILK_000000000000000_1_SECA_MESSB_235_247" start="235" end="247" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "SELYNTIDTFILK_000000000000000"/>
<PeptideEvidence id="LVQAALGGGGGASLEEK_0000000000000000000_1_SYA_THET2_769_785" start="769" end="785" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "LVQAALGGGGGASLEEK_0000000000000000000"/>
<PeptideEvidence id="KTAAHVNKPHVQAR_0000000000000000_1_METE_VIBHA_387_400" start="387" end="400" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "KTAAHVNKPHVQAR_0000000000000000"/>
<PeptideEvidence id="MIFKLFSQETVMK_000000000000000_1_APMAP_HUMAN_344_356" start="344" end="356" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "MIFKLFSQETVMK_000000000000000"/>
<PeptideEvidence id="AQRHISDLYEDLR_000000000000000_1_PLEC1_HUMAN_196_208" start="196" end="208" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "AQRHISDLYEDLR_000000000000000"/>
<PeptideEvidence id="VNEYGFIETPYRK_000000000000000_1_RPOB_CLOTH_558_570" start="558" end="570" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "VNEYGFIETPYRK_000000000000000"/>
<PeptideEvidence id="MQEAGYNTFLLNSK_0000000000000000_1_TPL_CITFR_28_41" start="28" end="41" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "MQEAGYNTFLLNSK_0000000000000000"/>
<PeptideEvidence id="MQEAGYNTFLLNSK_0000000000000000_1_TPL_ESCIN_28_41" start="28" end="41" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "MQEAGYNTFLLNSK_0000000000000000"/>
<PeptideEvidence id="EETVTADYYAAQVR_0000000000000000_1_PBPA_RICCN_260_273" start="260" end="273" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "EETVTADYYAAQVR_0000000000000000"/>
<PeptideEvidence id="SQMLENSFIMDNAR_0000000000000000_1_MATK_CERBE_344_357" start="344" end="357" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "SQMLENSFIMDNAR_0000000000000000"/>
<PeptideEvidence id="AERFGPDIMTYVEK_0000000000000000_1_SECA_MESSB_746_759" start="746" end="759" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "AERFGPDIMTYVEK_0000000000000000"/>
<PeptideEvidence id="EYIYALAHDHGLNR_0000000000000000_1_MATK_CERBE_26_39" start="26" end="39" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "EYIYALAHDHGLNR_0000000000000000"/>
<PeptideEvidence id="EYIYALAHDHGLNR_0000000000000000_1_MATK_SPICA_26_39" start="26" end="39" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "EYIYALAHDHGLNR_0000000000000000"/>
<PeptideEvidence id="SNQNTNINQRPMVR_0000000000000000_1_RPOB_DECAR_834_847" start="834" end="847" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "SNQNTNINQRPMVR_0000000000000000"/>
<PeptideEvidence id="EVMAGETVPTVLNALK_000000000000000000_1_SYE_STRSY_375_390" start="375" end="390" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "EVMAGETVPTVLNALK_000000000000000000"/>
<PeptideEvidence id="AMGGKLEITEIDPVAK_000000000000000000_1_AROA_STRP4_271_286" start="271" end="286" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "AMGGKLEITEIDPVAK_000000000000000000"/>
<PeptideEvidence id="AMGGKLEITEIDPVAK_000000000000000000_1_AROA_STRPN_271_286" start="271" end="286" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "AMGGKLEITEIDPVAK_000000000000000000"/>
<PeptideEvidence id="EIVAEGLLIDDNNEK_00000000000000000_1_APLP_LOCMI_1059_1073" start="1059" end="1073" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "EIVAEGLLIDDNNEK_00000000000000000"/>
<PeptideEvidence id="DSDLGLNPVSLGDTIR_000000000000000000_1_RRF_BORA1_85_100" start="85" end="100" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "DSDLGLNPVSLGDTIR_000000000000000000"/>
<PeptideEvidence id="FYKENLGQGWMTQK_0000000000000000_1_HYEP_HUMAN_373_386" start="373" end="386" pre="R" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "FYKENLGQGWMTQK_0000000000000000"/>
<PeptideEvidence id="LRSLESLHSFVAAATK_000000000000000000_1_PLEC1_HUMAN_749_764" start="749" end="764" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LRSLESLHSFVAAATK_000000000000000000"/>
<PeptideEvidence id="ETVTGTSPVVEGKSPNK_0000000000000000000_1_EF2_ARCFU_466_482" start="466" end="482" pre="R" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "ETVTGTSPVVEGKSPNK_0000000000000000000"/>
<PeptideEvidence id="GQSQAGCGCSGAAASDMTK_000000000000000000000_1_METE_VIBHA_100_118" start="100" end="118" pre="R" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "GQSQAGCGCSGAAASDMTK_000000000000000000000"/>
<PeptideEvidence id="SVGELAENQFRAGLVR_000000000000000000_1_RPOB_DECAR_530_545" start="530" end="545" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "SVGELAENQFRAGLVR_000000000000000000"/>
<PeptideEvidence id="ELTGNPDAESQTISQR_000000000000000000_1_PP438_ARATH_82_97" start="82" end="97" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "ELTGNPDAESQTISQR_000000000000000000"/>
<PeptideEvidence id="LSPKAQGMGLEAGALFR_0000000000000000000_1_SYA_THET2_830_846" start="830" end="846" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "LSPKAQGMGLEAGALFR_0000000000000000000"/>
<PeptideEvidence id="EIEEDFDRLTLLPR_0000000000000000_1_METE_VIBHA_174_187" start="174" end="187" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "EIEEDFDRLTLLPR_0000000000000000"/>
<PeptideEvidence id="VDALAVIVHRDSAHSR_000000000000000000_1_LEPA_LEGPA_504_519" start="504" end="519" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "VDALAVIVHRDSAHSR_000000000000000000"/>
<PeptideEvidence id="SSSVGSSSSYPISPAVSR_00000000000000000000_1_PLEC1_HUMAN_4384_4401" start="4384" end="4401" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "SSSVGSSSSYPISPAVSR_00000000000000000000"/>
<PeptideEvidence id="DSTKTEEEGLLEIYK_00000000000000000_1_RPOB_CLOTH_223_237" start="223" end="237" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "DSTKTEEEGLLEIYK_00000000000000000"/>
<PeptideEvidence id="AVDELAVTNTIPTPVSK_0000000000000000000_1_KPRS_PYRFU_252_268" start="252" end="268" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "AVDELAVTNTIPTPVSK_0000000000000000000"/>
<PeptideEvidence id="VEVDEIPAGNIVAVIGLK_00000000000000000000_1_EF2_ARCFU_345_362" start="345" end="362" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "VEVDEIPAGNIVAVIGLK_00000000000000000000"/>
<PeptideEvidence id="EETLPLEDGWWGPGTR_000000000000000000_1_HYEP_HUMAN_24_39" start="24" end="39" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "EETLPLEDGWWGPGTR_000000000000000000"/>
<PeptideEvidence id="LDLMYDELSEVSEATK_000000000000000000_1_ATPD_STAHJ_22_37" start="22" end="37" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "LDLMYDELSEVSEATK_000000000000000000"/>
<PeptideEvidence id="CDGPSALPLDKLEPFLK_0000000000000000000_1_KDSA_ENT38_249_265" start="249" end="265" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "CDGPSALPLDKLEPFLK_0000000000000000000"/>
<PeptideEvidence id="AVLGPHVRQAGSLVAPDR_00000000000000000000_1_SYA_THET2_586_603" start="586" end="603" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "AVLGPHVRQAGSLVAPDR_00000000000000000000"/>
<PeptideEvidence id="MSACPCNIVILPVEILK_0000000000000000000_1_RMD6_YEAST_1_17" start="1" end="17" pre="-" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "MSACPCNIVILPVEILK_0000000000000000000"/>
<PeptideEvidence id="FLGLTERDVELLYPVK_000000000000000000_1_HYEP_HUMAN_271_286" start="271" end="286" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "FLGLTERDVELLYPVK_000000000000000000"/>
<PeptideEvidence id="TVAVTFRYGGAPVGPMLR_00000000000000000000_1_BRIX_AERPE_149_166" start="149" end="166" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "TVAVTFRYGGAPVGPMLR_00000000000000000000"/>
<PeptideEvidence id="NTETFNVLINNLCKIR_000000000000000000_1_PP438_ARATH_321_336" start="321" end="336" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "NTETFNVLINNLCKIR_000000000000000000"/>
<PeptideEvidence id="EDEAIVHPWINKALEK_000000000000000000_1_SECA_MESSB_610_625" start="610" end="625" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "EDEAIVHPWINKALEK_000000000000000000"/>
<PeptideEvidence id="LVSSLEGTEIVKSYNLR_0000000000000000000_1_MATK_CERBE_110_126" start="110" end="126" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "LVSSLEGTEIVKSYNLR_0000000000000000000"/>
<PeptideEvidence id="DTSLRVPHGESGIVVDVK_00000000000000000000_1_RPOB_CLOTH_888_905" start="888" end="905" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "DTSLRVPHGESGIVVDVK_00000000000000000000"/>
<PeptideEvidence id="TEIIRQQGLASYDYVR_000000000000000000_1_PLEC1_HUMAN_3766_3781" start="3766" end="3781" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "TEIIRQQGLASYDYVR_000000000000000000"/>
<PeptideEvidence id="TRIRPTVNVEEDQNIK_000000000000000000_1_YQB6_CAEEL_1070_1085" start="1070" end="1085" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "TRIRPTVNVEEDQNIK_000000000000000000"/>
<PeptideEvidence id="GSTLDGVDSLHSIVQMPR_00000000000000000000_1_PUR6_DEBOC_480_497" start="480" end="497" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "GSTLDGVDSLHSIVQMPR_00000000000000000000"/>
<PeptideEvidence id="HIPANAYAEQWDAKGLK_0000000000000000000_1_SECA_MESSB_687_703" start="687" end="703" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "HIPANAYAEQWDAKGLK_0000000000000000000"/>
<PeptideEvidence id="DGYNAIQVAFDAQKESR_0000000000000000000_1_RL3_AKKM8_45_61" start="45" end="61" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "DGYNAIQVAFDAQKESR_0000000000000000000"/>
<PeptideEvidence id="TLARPGPEPAPATDERDR_00000000000000000000_1_PLEC1_HUMAN_162_179" start="162" end="179" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "TLARPGPEPAPATDERDR_00000000000000000000"/>
<PeptideEvidence id="DLLSMTIPDCERVGLMR_0000000000000000000_1_YQB6_CAEEL_477_493" start="477" end="493" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "DLLSMTIPDCERVGLMR_0000000000000000000"/>
<PeptideEvidence id="NLRPIHYELPIASAQVK_0000000000000000000_1_AROA_STRP4_154_170" start="154" end="170" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "NLRPIHYELPIASAQVK_0000000000000000000"/>
<PeptideEvidence id="NLRPIHYELPIASAQVK_0000000000000000000_1_AROA_STRPN_154_170" start="154" end="170" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "NLRPIHYELPIASAQVK_0000000000000000000"/>
<PeptideEvidence id="QIEKTIQYLIGSGMDPR_0000000000000000000_1_STAD_SOLTU_194_210" start="194" end="210" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "QIEKTIQYLIGSGMDPR_0000000000000000000"/>
<PeptideEvidence id="YEIDKMIPQEYYTQK_00000000000000000_1_SECA2_ALKMQ_561_575" start="561" end="575" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "YEIDKMIPQEYYTQK_00000000000000000"/>
<PeptideEvidence id="GAWLEYETDSNDVLSVR_0000000000000000000_1_RPOB_CLOTH_166_182" start="166" end="182" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "GAWLEYETDSNDVLSVR_0000000000000000000"/>
<PeptideEvidence id="AEPAAIALFDVAHKIIFK_00000000000000000000_1_YQB6_CAEEL_117_134" start="117" end="134" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "AEPAAIALFDVAHKIIFK_00000000000000000000"/>
<PeptideEvidence id="AENILPSKEIAEYFSDK_0000000000000000000_1_KPRS_PYRFU_133_149" start="133" end="149" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "AENILPSKEIAEYFSDK_0000000000000000000"/>
<PeptideEvidence id="KPIANISLDNWQGELKK_0000000000000000000_1_PBPA_RICCN_324_340" start="324" end="340" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "KPIANISLDNWQGELKK_0000000000000000000"/>
<PeptideEvidence id="ESYEITGFTSMGNGYGIK_00000000000000000000_1_RMD6_YEAST_134_151" start="134" end="151" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "ESYEITGFTSMGNGYGIK_00000000000000000000"/>
<PeptideEvidence id="WPIGLGGKGNDGIAAFVQR_000000000000000000000_1_PSTS_ECOLI_193_211" start="193" end="211" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "WPIGLGGKGNDGIAAFVQR_000000000000000000000"/>
<PeptideEvidence id="WPIGLGGKGNDGIAAFVQR_000000000000000000000_1_PSTS_SHIFL_193_211" start="193" end="211" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "WPIGLGGKGNDGIAAFVQR_000000000000000000000"/>
<PeptideEvidence id="SSWADSSDSDIIDRFVR_0000000000000000000_1_MATK_FRAVE_386_402" start="386" end="402" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "SSWADSSDSDIIDRFVR_0000000000000000000"/>
<PeptideEvidence id="DTERNHTATHLLHAALR_0000000000000000000_1_SYA_THET2_569_585" start="569" end="585" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "DTERNHTATHLLHAALR_0000000000000000000"/>
<PeptideEvidence id="ISPTEVQMTPVNIDVKGK_00000000000000000000_1_KPRS_PYRFU_185_202" start="185" end="202" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "ISPTEVQMTPVNIDVKGK_00000000000000000000"/>
<PeptideEvidence id="TISVQPYEKHMAGPIER_0000000000000000000_1_RRF_BORA1_65_81" start="65" end="81" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "TISVQPYEKHMAGPIER_0000000000000000000"/>
<PeptideEvidence id="GGHFAAFEEPELLAQDIR_00000000000000000000_1_HYEP_HUMAN_429_446" start="429" end="446" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "GGHFAAFEEPELLAQDIR_00000000000000000000"/>
<PeptideEvidence id="QEELYSELQARETFEK_000000000000000000_1_PLEC1_HUMAN_3358_3373" start="3358" end="3373" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "QEELYSELQARETFEK_000000000000000000"/>
<PeptideEvidence id="SADILIVLEQVTGNAETVK_000000000000000000000_1_APLP_LOCMI_3088_3106" start="3088" end="3106" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "SADILIVLEQVTGNAETVK_000000000000000000000"/>
<PeptideEvidence id="VSNNSPVIFDVTHALQCR_00000000000000000000_1_KDSA_ENT38_190_207" start="190" end="207" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "VSNNSPVIFDVTHALQCR_00000000000000000000"/>
<PeptideEvidence id="GQQTIYFEVGCGKGTYVR_00000000000000000000_1_TRUB_LACS1_163_180" start="163" end="180" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "GQQTIYFEVGCGKGTYVR_00000000000000000000"/>
<PeptideEvidence id="TLDPNSPRDFIDSFLIR_0000000000000000000_1_CP2A6_HUMAN_258_274" start="258" end="274" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "TLDPNSPRDFIDSFLIR_0000000000000000000"/>
<PeptideEvidence id="SALMFAALQAKGESVIIEK_000000000000000000000_1_AROA_STRP4_171_189" start="171" end="189" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "SALMFAALQAKGESVIIEK_000000000000000000000"/>
<PeptideEvidence id="SALMFAALQAKGESVIIEK_000000000000000000000_1_AROA_STRPN_171_189" start="171" end="189" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "SALMFAALQAKGESVIIEK_000000000000000000000"/>
<PeptideEvidence id="NQSNHLRLTSSGIFFER_0000000000000000000_1_MATK_FRAVE_225_241" start="225" end="241" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "NQSNHLRLTSSGIFFER_0000000000000000000"/>
<PeptideEvidence id="DEAHDAGLNIAFKGDIDLK_000000000000000000000_1_TPL_CITFR_143_161" start="143" end="161" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "DEAHDAGLNIAFKGDIDLK_000000000000000000000"/>
<PeptideEvidence id="DEAHDAGLNIAFKGDIDLK_000000000000000000000_1_TPL_ESCIN_143_161" start="143" end="161" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "DEAHDAGLNIAFKGDIDLK_000000000000000000000"/>
<PeptideEvidence id="KEAILWAWEFLTEHLR_000000000000000000_1_SYA_THET2_103_118" start="103" end="118" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "KEAILWAWEFLTEHLR_000000000000000000"/>
<PeptideEvidence id="VGRGQSQAGCGCSGAAASDMTK_000000000000000000000000_1_METE_VIBHA_97_118" start="97" end="118" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "VGRGQSQAGCGCSGAAASDMTK_000000000000000000000000"/>
<PeptideEvidence id="LQAEEVAQQKSLAQAEAEK_000000000000000000000_1_PLEC1_HUMAN_1783_1801" start="1783" end="1801" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LQAEEVAQQKSLAQAEAEK_000000000000000000000"/>
<PeptideEvidence id="YGGAPVGPMLRLGKPAEMVK_0000000000000000000000_1_BRIX_AERPE_156_175" start="156" end="175" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "YGGAPVGPMLRLGKPAEMVK_0000000000000000000000"/>
<PeptideEvidence id="ALEMLNVDKEGLDYMDSK_00000000000000000000_1_RUVB_HAMD5_251_268" start="251" end="268" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "ALEMLNVDKEGLDYMDSK_00000000000000000000"/>
<PeptideEvidence id="VLEQMYLRSATMLLATCK_00000000000000000000_1_YQB6_CAEEL_658_675" start="658" end="675" pre="K" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "VLEQMYLRSATMLLATCK_00000000000000000000"/>
<PeptideEvidence id="EAAGIVPTVRLAVNEAGIYK_0000000000000000000000_1_SYE_STRSY_128_147" start="128" end="147" pre="R" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "EAAGIVPTVRLAVNEAGIYK_0000000000000000000000"/>
<PeptideEvidence id="EAAGIVPTVRLAVNEAGIYK_0000000000000000000000_1_SYE_STREM_148_167" start="148" end="167" pre="R" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "EAAGIVPTVRLAVNEAGIYK_0000000000000000000000"/>
<PeptideEvidence id="QNLVIESSRPGMGTILEVK_000000000000000000000_1_IF2P_METTP_234_252" start="234" end="252" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "QNLVIESSRPGMGTILEVK_000000000000000000000"/>
<PeptideEvidence id="DKEETLPLEDGWWGPGTR_00000000000000000000_1_HYEP_HUMAN_22_39" start="22" end="39" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "DKEETLPLEDGWWGPGTR_00000000000000000000"/>
<PeptideEvidence id="KPEQGTEVLKFFDWAYK_0000000000000000000_1_PSTS_ECOLI_291_307" start="291" end="307" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "KPEQGTEVLKFFDWAYK_0000000000000000000"/>
<PeptideEvidence id="KPEQGTEVLKFFDWAYK_0000000000000000000_1_PSTS_SHIFL_291_307" start="291" end="307" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "KPEQGTEVLKFFDWAYK_0000000000000000000"/>
<PeptideEvidence id="FLGLSCGFVKENMNLEER_00000000000000000000_1_SECA2_ALKMQ_152_169" start="152" end="169" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "FLGLSCGFVKENMNLEER_00000000000000000000"/>
<PeptideEvidence id="YTRSNQNTNINQRPMVR_0000000000000000000_1_RPOB_DECAR_831_847" start="831" end="847" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "YTRSNQNTNINQRPMVR_0000000000000000000"/>
<PeptideEvidence id="ANEPQNDSFDEPIQSSVSK_000000000000000000000_1_YQB6_CAEEL_42_60" start="42" end="60" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "ANEPQNDSFDEPIQSSVSK_000000000000000000000"/>
<PeptideEvidence id="TIGMVFQRPNPFPTMSIR_00000000000000000000_1_PSTB_MYCS2_86_103" start="86" end="103" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "TIGMVFQRPNPFPTMSIR_00000000000000000000"/>
<PeptideEvidence id="TIGMVFQRPNPFPTMSIR_00000000000000000000_1_PSTB_MYCSM_86_103" start="86" end="103" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "TIGMVFQRPNPFPTMSIR_00000000000000000000"/>
<PeptideEvidence id="RPLRPQVVTDDDGQAPEAK_000000000000000000000_1_APMAP_HUMAN_11_29" start="11" end="29" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "RPLRPQVVTDDDGQAPEAK_000000000000000000000"/>
<PeptideEvidence id="VSAQRLQEAGILSAEELQR_000000000000000000000_1_PLEC1_HUMAN_2790_2808" start="2790" end="2808" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "VSAQRLQEAGILSAEELQR_000000000000000000000"/>
<PeptideEvidence id="NIVGFDTNHAYYNQEGKK_00000000000000000000_1_APLP_LOCMI_3263_3280" start="3263" end="3280" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "NIVGFDTNHAYYNQEGKK_00000000000000000000"/>
<PeptideEvidence id="MAAIALHQGKVVEMQTGEGK_0000000000000000000000_1_SECA2_ALKMQ_92_111" start="92" end="111" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "MAAIALHQGKVVEMQTGEGK_0000000000000000000000"/>
<PeptideEvidence id="KLADGADLDDLLVPAFAVVR_0000000000000000000000_1_SECA_MESSB_55_74" start="55" end="74" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "KLADGADLDDLLVPAFAVVR_0000000000000000000000"/>
<PeptideEvidence id="AASTSKPTITFDKFGDNGLK_0000000000000000000000_1_FABP_CLOSI_32_51" start="32" end="51" pre="K" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_FABP_CLOSI" peptide_ref = "AASTSKPTITFDKFGDNGLK_0000000000000000000000"/>
<PeptideEvidence id="VMSTGRAYEVDQVGIFTPK_000000000000000000000_1_LEPA_LEGPA_237_255" start="237" end="255" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "VMSTGRAYEVDQVGIFTPK_000000000000000000000"/>
<PeptideEvidence id="QYINAIKDYELQLVTYK_0000000000000000000_1_PLEC1_HUMAN_1411_1427" start="1411" end="1427" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "QYINAIKDYELQLVTYK_0000000000000000000"/>
<PeptideEvidence id="FCDAYFHRNMSTDYTCK_0000000000000000000_1_YQB6_CAEEL_563_579" start="563" end="579" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "FCDAYFHRNMSTDYTCK_0000000000000000000"/>
<PeptideEvidence id="QFHNVSAEQIAYVAQLQR_00000000000000000000_1_VMTH_LAMBD_244_261" start="244" end="261" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "QFHNVSAEQIAYVAQLQR_00000000000000000000"/>
<PeptideEvidence id="HADLGAVYALCKPFLEAAGR_0000000000000000000000_1_SYE_STREM_334_353" start="334" end="353" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "HADLGAVYALCKPFLEAAGR_0000000000000000000000"/>
<PeptideEvidence id="VFVAATHGVFAEGAIERLSK_0000000000000000000000_1_KPRS_PYRFU_232_251" start="232" end="251" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "VFVAATHGVFAEGAIERLSK_0000000000000000000000"/>
<PeptideEvidence id="VQPSTLALPTQYVDDVISR_000000000000000000000_1_MED27_DANRE_150_168" start="150" end="168" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "VQPSTLALPTQYVDDVISR_000000000000000000000"/>
<PeptideEvidence id="FGSKLLEEFFTEEEQIR_0000000000000000000_1_MATK_SPICA_452_468" start="452" end="468" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "FGSKLLEEFFTEEEQIR_0000000000000000000"/>
<PeptideEvidence id="NQSSHLQFTSSWIFFER_0000000000000000000_1_MATK_CERBE_225_241" start="225" end="241" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "NQSSHLQFTSSWIFFER_0000000000000000000"/>
<PeptideEvidence id="DRLDLMYDELSEVSEATK_00000000000000000000_1_ATPD_STAHJ_20_37" start="20" end="37" pre="K" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "DRLDLMYDELSEVSEATK_00000000000000000000"/>
<PeptideEvidence id="NLPTEAFLGIGSFIGRYCR_000000000000000000000_1_APLP_LOCMI_417_435" start="417" end="435" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "NLPTEAFLGIGSFIGRYCR_000000000000000000000"/>
<PeptideEvidence id="IEGDMMVTTATFKNITSVR_000000000000000000000_1_FABP_CLOSI_110_128" start="110" end="128" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_FABP_CLOSI" peptide_ref = "IEGDMMVTTATFKNITSVR_000000000000000000000"/>
<PeptideEvidence id="VVIAGDGQVSLGQTIMKGNAR_00000000000000000000000_1_HSLV_RHILO_15_35" start="15" end="35" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "VVIAGDGQVSLGQTIMKGNAR_00000000000000000000000"/>
<PeptideEvidence id="GGHFAAFEEPELLAQDIRK_000000000000000000000_1_HYEP_HUMAN_429_447" start="429" end="447" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "GGHFAAFEEPELLAQDIRK_000000000000000000000"/>
<PeptideEvidence id="ALGYGTDLEITELFGEDER_000000000000000000000_1_RPOB_CLOTH_197_215" start="197" end="215" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_CLOTH" peptide_ref = "ALGYGTDLEITELFGEDER_000000000000000000000"/>
<PeptideEvidence id="LKPPEAAGYVEAVIESLDAR_0000000000000000000000_1_BRIX_AERPE_129_148" start="129" end="148" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "LKPPEAAGYVEAVIESLDAR_0000000000000000000000"/>
<PeptideEvidence id="MHARSTGPYSLVTQQPLGGK_0000000000000000000000_1_RPOB_DECAR_1328_1347" start="1328" end="1347" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "MHARSTGPYSLVTQQPLGGK_0000000000000000000000"/>
<PeptideEvidence id="FQSITIEAFNDMLDNIEK_00000000000000000000_1_SECA2_ALKMQ_702_719" start="702" end="719" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "FQSITIEAFNDMLDNIEK_00000000000000000000"/>
<PeptideEvidence id="KVSNNSPVIFDVTHALQCR_000000000000000000000_1_KDSA_ENT38_189_207" start="189" end="207" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "KVSNNSPVIFDVTHALQCR_000000000000000000000"/>
<PeptideEvidence id="SACPCNIVILPVEILKNSSK_0000000000000000000000_1_RMD6_YEAST_2_21" start="2" end="21" pre="M" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_RMD6_YEAST" peptide_ref = "SACPCNIVILPVEILKNSSK_0000000000000000000000"/>
<PeptideEvidence id="LEAIVKPGCVRILPDCVFR_000000000000000000000_1_IF2P_METTP_469_487" start="469" end="487" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "LEAIVKPGCVRILPDCVFR_000000000000000000000"/>
<PeptideEvidence id="ALETPNASVYLYGKSTRPNR_0000000000000000000000_1_PUR6_DEBOC_335_354" start="335" end="354" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "ALETPNASVYLYGKSTRPNR_0000000000000000000000"/>
<PeptideEvidence id="NADLETIFNLAKPFLEEAGR_0000000000000000000000_1_SYE_STRSY_314_333" start="314" end="333" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "NADLETIFNLAKPFLEEAGR_0000000000000000000000"/>
<PeptideEvidence id="ESIPEALEFLKDRPLYAEK_000000000000000000000_1_PUR6_DEBOC_164_182" start="164" end="182" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "ESIPEALEFLKDRPLYAEK_000000000000000000000"/>
<PeptideEvidence id="ECLACNVSDSNLDTAILEIPK_00000000000000000000000_1_PBPA_RICCN_601_621" start="601" end="621" pre="R" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "ECLACNVSDSNLDTAILEIPK_00000000000000000000000"/>
<PeptideEvidence id="GYASLDYNFQRFQIADLVK_000000000000000000000_1_LEPA_LEGPA_476_494" start="476" end="494" pre="R" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "GYASLDYNFQRFQIADLVK_000000000000000000000"/>
<PeptideEvidence id="VYVPTGFSAFPFELLHTPEK_0000000000000000000000_1_HYEP_HUMAN_392_411" start="392" end="411" pre="K" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "VYVPTGFSAFPFELLHTPEK_0000000000000000000000"/>
<PeptideEvidence id="LEAQHQALVTLWHQLHVDMK_0000000000000000000000_1_PLEC1_HUMAN_1009_1028" start="1009" end="1028" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LEAQHQALVTLWHQLHVDMK_0000000000000000000000"/>
<PeptideEvidence id="LDLPPFTLIGATTRAGSLTSPLR_0000000000000000000000000_1_RUVB_HAMD5_151_173" start="151" end="173" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "LDLPPFTLIGATTRAGSLTSPLR_0000000000000000000000000"/>
<PeptideEvidence id="TANAIFQGEEQTEDDCQDALAK_000000000000000000000000_1_YQB6_CAEEL_762_783" start="762" end="783" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "TANAIFQGEEQTEDDCQDALAK_000000000000000000000000"/>
<PeptideEvidence id="LDQYMHTDVTEDDLRDFQR_000000000000000000000_1_CA089_XENLA_173_191" start="173" end="191" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "LDQYMHTDVTEDDLRDFQR_000000000000000000000"/>
<PeptideEvidence id="EGIPLDEVLIQAFTLVKEVAGR_000000000000000000000000_1_SECA2_ALKMQ_59_80" start="59" end="80" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "EGIPLDEVLIQAFTLVKEVAGR_000000000000000000000000"/>
<PeptideEvidence id="LADGADLDDLLVPAFAVVREAAR_0000000000000000000000000_1_SECA_MESSB_56_78" start="56" end="78" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "LADGADLDDLLVPAFAVVREAAR_0000000000000000000000000"/>
<PeptideEvidence id="QMFDVAIQAAIGSHIIARQTVK_000000000000000000000000_1_LEPA_LEGPA_534_555" start="534" end="555" pre="R" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "QMFDVAIQAAIGSHIIARQTVK_000000000000000000000000"/>
<PeptideEvidence id="IGHSGTLDPEVDGVLPICVGKATK_00000000000000000000000000_1_TRUB_LACS1_31_54" start="31" end="54" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_TRUB_LACS1" peptide_ref = "IGHSGTLDPEVDGVLPICVGKATK_00000000000000000000000000"/>
<PeptideEvidence id="GMLTGPVTILCWTFPREDITR_00000000000000000000000_1_METE_VIBHA_555_575" start="555" end="575" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "GMLTGPVTILCWTFPREDITR_00000000000000000000000"/>
<PeptideEvidence id="CWQPTDFLPDPASEGFDEQVK_00000000000000000000000_1_STAD_SOLTU_91_111" start="91" end="111" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "CWQPTDFLPDPASEGFDEQVK_00000000000000000000000"/>
<PeptideEvidence id="DCLVNIGGFLCMNDDEMFSSAK_000000000000000000000000_1_TPL_CITFR_258_279" start="258" end="279" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "DCLVNIGGFLCMNDDEMFSSAK_000000000000000000000000"/>
<PeptideEvidence id="DCLVNIGGFLCMNDDEMFSSAK_000000000000000000000000_1_TPL_ESCIN_258_279" start="258" end="279" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "DCLVNIGGFLCMNDDEMFSSAK_000000000000000000000000"/>
<PeptideEvidence id="FFGLIERPVLPPHLPADVAAYK_000000000000000000000000_1_CA089_XENLA_32_53" start="32" end="53" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "FFGLIERPVLPPHLPADVAAYK_000000000000000000000000"/>
<PeptideEvidence id="QTNLSQVHITTKINPELIGGFR_000000000000000000000000_1_ATPD_STAHJ_131_152" start="131" end="152" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_ATPD_STAHJ" peptide_ref = "QTNLSQVHITTKINPELIGGFR_000000000000000000000000"/>
<PeptideEvidence id="PVQHCLTYLFARHHGGTFLIR_00000000000000000000000_1_SYE_STRSY_2_22" start="2" end="22" pre="M" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "PVQHCLTYLFARHHGGTFLIR_00000000000000000000000"/>
<PeptideEvidence id="IPGWRPVENAPMEKSLAGQTER_000000000000000000000000_1_IF2P_METTP_147_168" start="147" end="168" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "IPGWRPVENAPMEKSLAGQTER_000000000000000000000000"/>
<PeptideEvidence id="ELVLLLLQWMRHHTAAFEER_0000000000000000000000_1_PLEC1_HUMAN_423_442" start="423" end="442" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "ELVLLLLQWMRHHTAAFEER_0000000000000000000000"/>
<PeptideEvidence id="FPNGVQLSPAEDFVLVAETTMAR_0000000000000000000000000_1_APMAP_HUMAN_258_280" start="258" end="280" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "FPNGVQLSPAEDFVLVAETTMAR_0000000000000000000000000"/>
<PeptideEvidence id="FEESINKLIAEGVTTFIEIGPGK_0000000000000000000000000_1_FABD_BACSU_257_279" start="257" end="279" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "FEESINKLIAEGVTTFIEIGPGK_0000000000000000000000000"/>
<PeptideEvidence id="GGNVIAGFAGATADAFTLLERLEAK_000000000000000000000000000_1_HSLV_RHILO_43_67" start="43" end="67" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_HSLV_RHILO" peptide_ref = "GGNVIAGFAGATADAFTLLERLEAK_000000000000000000000000000"/>
<PeptideEvidence id="VGMTRLFDQESGAMVPVTVIDVK_0000000000000000000000000_1_RL3_AKKM8_10_32" start="10" end="32" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "VGMTRLFDQESGAMVPVTVIDVK_0000000000000000000000000"/>
<PeptideEvidence id="TGAVINVKKPQFVSPGQMGNIVDK_00000000000000000000000000_1_KDSA_ENT38_131_154" start="131" end="154" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "TGAVINVKKPQFVSPGQMGNIVDK_00000000000000000000000000"/>
<PeptideEvidence id="GANVIAGVWLEEAGQKLSIYNALK_00000000000000000000000000_1_PLEC1_HUMAN_3159_3182" start="3159" end="3182" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "GANVIAGVWLEEAGQKLSIYNALK_00000000000000000000000000"/>
<PeptideEvidence id="GTVIDKVYLDSMDPHHWFDIR_00000000000000000000000_1_RPOB_DECAR_1069_1089" start="1069" end="1089" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "GTVIDKVYLDSMDPHHWFDIR_00000000000000000000000"/>
<PeptideEvidence id="MIEIDRLVSTDVLNENEALVDR_000000000000000000000000_1_RUVB_HAMD5_1_22" start="1" end="22" pre="-" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "MIEIDRLVSTDVLNENEALVDR_000000000000000000000000"/>
<PeptideEvidence id="SVTPVLDPEWQRSPEGLDYLSR_000000000000000000000000_1_CA089_XENLA_2_23" start="2" end="23" pre="M" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "SVTPVLDPEWQRSPEGLDYLSR_000000000000000000000000"/>
<PeptideEvidence id="IQVVADALNSMGADITPTADGMIIK_000000000000000000000000000_1_AROA_STRP4_344_368" start="344" end="368" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "IQVVADALNSMGADITPTADGMIIK_000000000000000000000000000"/>
<PeptideEvidence id="IQVVADALNSMGADITPTADGMIIK_000000000000000000000000000_1_AROA_STRPN_344_368" start="344" end="368" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "IQVVADALNSMGADITPTADGMIIK_000000000000000000000000000"/>
<PeptideEvidence id="SLLVNGRPTEYPADEGEFHAWR_000000000000000000000000_1_APLP_LOCMI_2882_2903" start="2882" end="2903" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "SLLVNGRPTEYPADEGEFHAWR_000000000000000000000000"/>
<PeptideEvidence id="ADVMNVGVNLEAFSQAINAIQALR_00000000000000000000000000_1_MED27_DANRE_2_25" start="2" end="25" pre="M" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "ADVMNVGVNLEAFSQAINAIQALR_00000000000000000000000000"/>
<PeptideEvidence id="NLAEASGFALSAIQDLVSLMPFGAR_000000000000000000000000000_1_RPOB_DECAR_438_462" start="438" end="462" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "NLAEASGFALSAIQDLVSLMPFGAR_000000000000000000000000000"/>
<PeptideEvidence id="KFFGLIERPVLPPHLPADVAAYK_0000000000000000000000000_1_CA089_XENLA_31_53" start="31" end="53" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_CA089_XENLA" peptide_ref = "KFFGLIERPVLPPHLPADVAAYK_0000000000000000000000000"/>
<PeptideEvidence id="ENPVVPIGCLATAAALTYGLYSFHR_000000000000000000000000000_1_HIG2A_HUMAN_45_69" start="45" end="69" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_HIG2A_HUMAN" peptide_ref = "ENPVVPIGCLATAAALTYGLYSFHR_000000000000000000000000000"/>
<PeptideEvidence id="EHVKIQPENQTLASITFQNYFR_000000000000000000000000_1_SECA_MESSB_350_371" start="350" end="371" pre="K" post="M" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "EHVKIQPENQTLASITFQNYFR_000000000000000000000000"/>
<PeptideEvidence id="WSVENIQSALEPHKNDIQEVLNK_0000000000000000000000000_1_APLP_LOCMI_2442_2464" start="2442" end="2464" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "WSVENIQSALEPHKNDIQEVLNK_0000000000000000000000000"/>
<PeptideEvidence id="IISSKPLFSPLPPSRSSIFSTFPSR_000000000000000000000000000_1_PP438_ARATH_33_57" start="33" end="57" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PP438_ARATH" peptide_ref = "IISSKPLFSPLPPSRSSIFSTFPSR_000000000000000000000000000"/>
<PeptideEvidence id="MAEPVGDLVVDLSLDAARFDEQMAR_000000000000000000000000000_1_VMTH_LAMBD_1_25" start="1" end="25" pre="-" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_VMTH_LAMBD" peptide_ref = "MAEPVGDLVVDLSLDAARFDEQMAR_000000000000000000000000000"/>
<PeptideEvidence id="WKYYLVNLWQCHFYVWSQPGR_00000000000000000000000_1_MATK_CERBE_295_315" start="295" end="315" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "WKYYLVNLWQCHFYVWSQPGR_00000000000000000000000"/>
<PeptideEvidence id="DGKTYLLNFIDTPGHVDFSYEVSR_00000000000000000000000000_1_LEPA_LEGPA_79_102" start="79" end="102" pre="K" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "DGKTYLLNFIDTPGHVDFSYEVSR_00000000000000000000000000"/>
<PeptideEvidence id="YAPSPTGLLHIGNARTALFNYLYAR_000000000000000000000000000_1_SYE_STREM_9_33" start="9" end="33" pre="R" post="H" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "YAPSPTGLLHIGNARTALFNYLYAR_000000000000000000000000000"/>
<PeptideEvidence id="EDDSIRPFKVETSDEEIHDLHQR_0000000000000000000000000_1_HYEP_HUMAN_44_66" start="44" end="66" pre="R" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "EDDSIRPFKVETSDEEIHDLHQR_0000000000000000000000000"/>
<PeptideEvidence id="FCNALGHPISKSTWADSSDFDIIDR_000000000000000000000000000_1_MATK_CERBE_378_402" start="378" end="402" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_CERBE" peptide_ref = "FCNALGHPISKSTWADSSDFDIIDR_000000000000000000000000000"/>
<PeptideEvidence id="FCNALGHPISKSTWADSSDFDIIDR_000000000000000000000000000_1_MATK_SPICA_377_401" start="377" end="401" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "FCNALGHPISKSTWADSSDFDIIDR_000000000000000000000000000"/>
<PeptideEvidence id="LLEAAAQSTKGYYSPYSVSGSGSTAGSR_000000000000000000000000000000_1_PLEC1_HUMAN_4600_4627" start="4600" end="4627" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LLEAAAQSTKGYYSPYSVSGSGSTAGSR_000000000000000000000000000000"/>
<PeptideEvidence id="DSDLGLNPVSLGDTIRVPMPALTEER_0000000000000000000000000000_1_RRF_BORA1_85_110" start="85" end="110" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_BORA1" peptide_ref = "DSDLGLNPVSLGDTIRVPMPALTEER_0000000000000000000000000000"/>
<PeptideEvidence id="TLKPEEQRQALHSLELHYQAFLR_0000000000000000000000000_1_PLEC1_HUMAN_1053_1075" start="1053" end="1075" pre="R" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "TLKPEEQRQALHSLELHYQAFLR_0000000000000000000000000"/>
<PeptideEvidence id="LLLAIIEKFQGGPVGLDNLAAAIGEER_00000000000000000000000000000_1_RUVB_HAMD5_269_295" start="269" end="295" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "LLLAIIEKFQGGPVGLDNLAAAIGEER_00000000000000000000000000000"/>
<PeptideEvidence id="CWQPTDFLPDPASEGFDEQVKELR_00000000000000000000000000_1_STAD_SOLTU_91_114" start="91" end="114" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "CWQPTDFLPDPASEGFDEQVKELR_00000000000000000000000000"/>
<PeptideEvidence id="WKYYLVNFWQCHFYVWSQPGR_00000000000000000000000_1_MATK_FRAVE_292_312" start="292" end="312" pre="K" post="I" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "WKYYLVNFWQCHFYVWSQPGR_00000000000000000000000"/>
<PeptideEvidence id="VIIAGAGGAAHLPGMVAAMTPLPVIGVPVK_00000000000000000000000000000000_1_PUR6_DEBOC_450_479" start="450" end="479" pre="K" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "VIIAGAGGAAHLPGMVAAMTPLPVIGVPVK_00000000000000000000000000000000"/>
<PeptideEvidence id="FDFTHPEPLKPEELERVELLVNR_0000000000000000000000000_1_SYA_THET2_606_628" start="606" end="628" pre="R" post="W" isDecoy="false" dBSequence_ref="DBSeq_1_SYA_THET2" peptide_ref = "FDFTHPEPLKPEELERVELLVNR_0000000000000000000000000"/>
<PeptideEvidence id="MEGASTITQQVVKNFLLTNEVSLER_000000000000000000000000000_1_PBPA_RICCN_119_143" start="119" end="143" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PBPA_RICCN" peptide_ref = "MEGASTITQQVVKNFLLTNEVSLER_000000000000000000000000000"/>
<PeptideEvidence id="LFDQESGAMVPVTVIDVKGNTFAQIK_0000000000000000000000000000_1_RL3_AKKM8_15_40" start="15" end="40" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_RL3_AKKM8" peptide_ref = "LFDQESGAMVPVTVIDVKGNTFAQIK_0000000000000000000000000000"/>
<PeptideEvidence id="MQQLIPRQMFDVAIQAAIGSHIIAR_000000000000000000000000000_1_LEPA_LEGPA_527_551" start="527" end="551" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_LEPA_LEGPA" peptide_ref = "MQQLIPRQMFDVAIQAAIGSHIIAR_000000000000000000000000000"/>
<PeptideEvidence id="TTCCDEVTVNDLLWKSVHDVDESVR_000000000000000000000000000_1_YQB6_CAEEL_297_321" start="297" end="321" pre="K" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_YQB6_CAEEL" peptide_ref = "TTCCDEVTVNDLLWKSVHDVDESVR_000000000000000000000000000"/>
<PeptideEvidence id="GAENIAYICLAVTVNLAGGQPVSMANMR_000000000000000000000000000000_1_TPL_CITFR_171_198" start="171" end="198" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_CITFR" peptide_ref = "GAENIAYICLAVTVNLAGGQPVSMANMR_000000000000000000000000000000"/>
<PeptideEvidence id="GAENIAYICLAVTVNLAGGQPVSMANMR_000000000000000000000000000000_1_TPL_ESCIN_171_198" start="171" end="198" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_TPL_ESCIN" peptide_ref = "GAENIAYICLAVTVNLAGGQPVSMANMR_000000000000000000000000000000"/>
<PeptideEvidence id="LASGMLLVALLVCLTVMVLMSVWQQR_0000000000000000000000000000_1_CP2A6_HUMAN_2_27" start="2" end="27" pre="M" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_CP2A6_HUMAN" peptide_ref = "LASGMLLVALLVCLTVMVLMSVWQQR_0000000000000000000000000000"/>
<PeptideEvidence id="LDLKDVNIYYGAFHAVADVSLAVQPR_0000000000000000000000000000_1_PSTB_MYCS2_5_30" start="5" end="30" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "LDLKDVNIYYGAFHAVADVSLAVQPR_0000000000000000000000000000"/>
<PeptideEvidence id="LDLKDVNIYYGAFHAVADVSLAVQPR_0000000000000000000000000000_1_PSTB_MYCSM_5_30" start="5" end="30" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "LDLKDVNIYYGAFHAVADVSLAVQPR_0000000000000000000000000000"/>
<PeptideEvidence id="ENPLHRFQSITIEAFNDMLDNIEK_00000000000000000000000000_1_SECA2_ALKMQ_696_719" start="696" end="719" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "ENPLHRFQSITIEAFNDMLDNIEK_00000000000000000000000000"/>
<PeptideEvidence id="LFENQLVGPESIAHIGDVMFTGTADGR_00000000000000000000000000000_1_APMAP_HUMAN_94_120" start="94" end="120" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "LFENQLVGPESIAHIGDVMFTGTADGR_00000000000000000000000000000"/>
<PeptideEvidence id="MYQQNHLIISANDSNQNKFFGYNK_00000000000000000000000000_1_MATK_SPICA_64_87" start="64" end="87" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_SPICA" peptide_ref = "MYQQNHLIISANDSNQNKFFGYNK_00000000000000000000000000"/>
<PeptideEvidence id="KFSLDDLLTNVMLYWTTGTIISSQR_000000000000000000000000000_1_HYEP_HUMAN_348_372" start="348" end="372" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_HYEP_HUMAN" peptide_ref = "KFSLDDLLTNVMLYWTTGTIISSQR_000000000000000000000000000"/>
<PeptideEvidence id="LLEAQACTGGIIDPSTGERFPVTDAVNK_000000000000000000000000000000_1_PLEC1_HUMAN_4448_4475" start="4448" end="4475" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LLEAQACTGGIIDPSTGERFPVTDAVNK_000000000000000000000000000000"/>
<PeptideEvidence id="LKPPEAAGYVEAVIESLDARTVAVTFR_00000000000000000000000000000_1_BRIX_AERPE_129_155" start="129" end="155" pre="R" post="Y" isDecoy="false" dBSequence_ref="DBSeq_1_BRIX_AERPE" peptide_ref = "LKPPEAAGYVEAVIESLDARTVAVTFR_00000000000000000000000000000"/>
<PeptideEvidence id="MYQQNHFLISVNDSNQNKFLGYNK_00000000000000000000000000_1_MATK_FRAVE_64_87" start="64" end="87" pre="R" post="N" isDecoy="false" dBSequence_ref="DBSeq_1_MATK_FRAVE" peptide_ref = "MYQQNHFLISVNDSNQNKFLGYNK_00000000000000000000000000"/>
<PeptideEvidence id="AIVVQSTYKPQDEFLIEALLLGDALR_0000000000000000000000000000_1_KPRS_PYRFU_45_70" start="45" end="70" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_KPRS_PYRFU" peptide_ref = "AIVVQSTYKPQDEFLIEALLLGDALR_0000000000000000000000000000"/>
<PeptideEvidence id="LLDAQLATGGIVDPRLGFHLPLEVAYQR_000000000000000000000000000000_1_PLEC1_HUMAN_3936_3963" start="3936" end="3963" pre="R" post="G" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LLDAQLATGGIVDPRLGFHLPLEVAYQR_000000000000000000000000000000"/>
<PeptideEvidence id="IGRMFPDMSIELFRPNGTSAVLLVTLGK_000000000000000000000000000000_1_MED27_DANRE_169_196" start="169" end="196" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "IGRMFPDMSIELFRPNGTSAVLLVTLGK_000000000000000000000000000000"/>
<PeptideEvidence id="YAMHRHNVGFMAADVIAEIHDFPPPVK_00000000000000000000000000000_1_PTH_SPHAL_14_40" start="14" end="40" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_PTH_SPHAL" peptide_ref = "YAMHRHNVGFMAADVIAEIHDFPPPVK_00000000000000000000000000000"/>
<PeptideEvidence id="SIVFEAPHALASVPGGSSAITAALHAAESSTK_0000000000000000000000000000000000_1_APLP_LOCMI_281_312" start="281" end="312" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "SIVFEAPHALASVPGGSSAITAALHAAESSTK_0000000000000000000000000000000000"/>
<PeptideEvidence id="AIWSTEHAGFELVPQNLFQEFVMEVR_0000000000000000000000000000_1_EF2_ARCFU_685_710" start="685" end="710" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "AIWSTEHAGFELVPQNLFQEFVMEVR_0000000000000000000000000000"/>
<PeptideEvidence id="AAAIKDPLLSVILGFNVEILPDALSEIQK_0000000000000000000000000000000_1_IF2P_METTP_407_435" start="407" end="435" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "AAAIKDPLLSVILGFNVEILPDALSEIQK_0000000000000000000000000000000"/>
<PeptideEvidence id="NLFMPIRIAVSGEMHGPELPNTIYLLGR_000000000000000000000000000000_1_SYE_STRSY_423_450" start="423" end="450" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STRSY" peptide_ref = "NLFMPIRIAVSGEMHGPELPNTIYLLGR_000000000000000000000000000000"/>
<PeptideEvidence id="NLFMPIRIAVSGEMHGPELPNTIYLLGR_000000000000000000000000000000_1_SYE_STREM_443_470" start="443" end="470" pre="K" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_SYE_STREM" peptide_ref = "NLFMPIRIAVSGEMHGPELPNTIYLLGR_000000000000000000000000000000"/>
<PeptideEvidence id="GSLGLAPGVPIIDVVAVQPSGTSKVFVDFLR_000000000000000000000000000000000_1_APLP_LOCMI_1875_1905" start="1875" end="1905" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "GSLGLAPGVPIIDVVAVQPSGTSKVFVDFLR_000000000000000000000000000000000"/>
<PeptideEvidence id="SLREALEAESAWCYLYGTGSVAGVYLPGSR_00000000000000000000000000000000_1_PLEC1_HUMAN_3809_3838" start="3809" end="3838" pre="R" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "SLREALEAESAWCYLYGTGSVAGVYLPGSR_00000000000000000000000000000000"/>
<PeptideEvidence id="LSPVVEEILYPAMEDYQLDIMIGEGPGAR_0000000000000000000000000000000_1_RUVB_HAMD5_119_147" start="119" end="147" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_RUVB_HAMD5" peptide_ref = "LSPVVEEILYPAMEDYQLDIMIGEGPGAR_0000000000000000000000000000000"/>
<PeptideEvidence id="AILMSDLGLNPSTSGTLIRLPLPPLTEETR_00000000000000000000000000000000_1_RRF_ALCBS_81_110" start="81" end="110" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RRF_ALCBS" peptide_ref = "AILMSDLGLNPSTSGTLIRLPLPPLTEETR_00000000000000000000000000000000"/>
<PeptideEvidence id="TIQYLIGSGMDPRTENNPYLGFVYTSLR_000000000000000000000000000000_1_STAD_SOLTU_198_225" start="198" end="225" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_STAD_SOLTU" peptide_ref = "TIQYLIGSGMDPRTENNPYLGFVYTSLR_000000000000000000000000000000"/>
<PeptideEvidence id="ENPVVPIGCLATAAALTYGLYSFHRGNSQR_00000000000000000000000000000000_1_HIG2A_HUMAN_45_74" start="45" end="74" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_HIG2A_HUMAN" peptide_ref = "ENPVVPIGCLATAAALTYGLYSFHRGNSQR_00000000000000000000000000000000"/>
<PeptideEvidence id="MADVMNVGVNLEAFSQAINAIQALRSSVTR_00000000000000000000000000000000_1_MED27_DANRE_1_30" start="1" end="30" pre="-" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_MED27_DANRE" peptide_ref = "MADVMNVGVNLEAFSQAINAIQALRSSVTR_00000000000000000000000000000000"/>
<PeptideEvidence id="AIWSTEHAGFELVPQNLFQEFVMEVRK_00000000000000000000000000000_1_EF2_ARCFU_685_711" start="685" end="711" pre="K" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "AIWSTEHAGFELVPQNLFQEFVMEVRK_00000000000000000000000000000"/>
<PeptideEvidence id="YSEWKIDVANGSAAFGSALYNWAVSVPSQK_00000000000000000000000000000000_1_EF2_ARCFU_186_215" start="186" end="215" pre="K" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "YSEWKIDVANGSAAFGSALYNWAVSVPSQK_00000000000000000000000000000000"/>
<PeptideEvidence id="NDMVEYFAENLAGFQTTKFGWVQSYGSR_000000000000000000000000000000_1_METE_VIBHA_493_520" start="493" end="520" pre="R" post="C" isDecoy="false" dBSequence_ref="DBSeq_1_METE_VIBHA" peptide_ref = "NDMVEYFAENLAGFQTTKFGWVQSYGSR_000000000000000000000000000000"/>
<PeptideEvidence id="ASVLDVPYLLATQLQSFKDFLQDEVAPEK_0000000000000000000000000000000_1_RPOB_DECAR_19_47" start="19" end="47" pre="R" post="R" isDecoy="false" dBSequence_ref="DBSeq_1_RPOB_DECAR" peptide_ref = "ASVLDVPYLLATQLQSFKDFLQDEVAPEK_0000000000000000000000000000000"/>
<PeptideEvidence id="TLSAVMPAYLNALSGKGVHILTFNDYLAER_00000000000000000000000000000000_1_SECA2_ALKMQ_112_141" start="112" end="141" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_SECA2_ALKMQ" peptide_ref = "TLSAVMPAYLNALSGKGVHILTFNDYLAER_00000000000000000000000000000000"/>
<PeptideEvidence id="SLHDPDGLVATYISEVHEHDGHLYLGSFR_0000000000000000000000000000000_1_APMAP_HUMAN_376_404" start="376" end="404" pre="R" post="S" isDecoy="false" dBSequence_ref="DBSeq_1_APMAP_HUMAN" peptide_ref = "SLHDPDGLVATYISEVHEHDGHLYLGSFR_0000000000000000000000000000000"/>
<PeptideEvidence id="GEFMNEAVPAGEGAMAAILGMDAEALKQVTDK_0000000000000000000000000000000000_1_FABD_BACSU_117_148" start="117" end="148" pre="R" post="V" isDecoy="false" dBSequence_ref="DBSeq_1_FABD_BACSU" peptide_ref = "GEFMNEAVPAGEGAMAAILGMDAEALKQVTDK_0000000000000000000000000000000000"/>
<PeptideEvidence id="VLGLRPFDVQLIGGMVLHQGAIAEMKTGEGK_000000000000000000000000000000000_1_SECA_MESSB_80_110" start="80" end="110" pre="R" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_SECA_MESSB" peptide_ref = "VLGLRPFDVQLIGGMVLHQGAIAEMKTGEGK_000000000000000000000000000000000"/>
<PeptideEvidence id="VNYQGIGSSGGVKQIIANTVDFGASDAPLSDEK_00000000000000000000000000000000000_1_PSTS_ECOLI_56_88" start="56" end="88" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "VNYQGIGSSGGVKQIIANTVDFGASDAPLSDEK_00000000000000000000000000000000000"/>
<PeptideEvidence id="VNYQGIGSSGGVKQIIANTVDFGASDAPLSDEK_00000000000000000000000000000000000_1_PSTS_SHIFL_56_88" start="56" end="88" pre="K" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "VNYQGIGSSGGVKQIIANTVDFGASDAPLSDEK_00000000000000000000000000000000000"/>
<PeptideEvidence id="FVAQHIADSLTNVELTQDCKCLPVEGIHTR_00000000000000000000000000000000_1_APLP_LOCMI_3324_3353" start="3324" end="3353" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "FVAQHIADSLTNVELTQDCKCLPVEGIHTR_00000000000000000000000000000000"/>
<PeptideEvidence id="GGSLADLAILIVDINEGFQPQTIESINILKR_000000000000000000000000000000000_1_IF2P_METTP_102_132" start="102" end="132" pre="R" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_IF2P_METTP" peptide_ref = "GGSLADLAILIVDINEGFQPQTIESINILKR_000000000000000000000000000000000"/>
<PeptideEvidence id="LAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGK_0000000000000000000000000000000000000_1_PSTS_ECOLI_89_123" start="89" end="123" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_ECOLI" peptide_ref = "LAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGK_0000000000000000000000000000000000000"/>
<PeptideEvidence id="LAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGK_0000000000000000000000000000000000000_1_PSTS_SHIFL_89_123" start="89" end="123" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_PSTS_SHIFL" peptide_ref = "LAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGK_0000000000000000000000000000000000000"/>
<PeptideEvidence id="AIAVQPDVLLMDEPCSALDPISTLAIEDLIATLK_000000000000000000000000000000000000_1_PSTB_MYCS2_162_195" start="162" end="195" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCS2" peptide_ref = "AIAVQPDVLLMDEPCSALDPISTLAIEDLIATLK_000000000000000000000000000000000000"/>
<PeptideEvidence id="AIAVQPDVLLMDEPCSALDPISTLAIEDLIATLK_000000000000000000000000000000000000_1_PSTB_MYCSM_162_195" start="162" end="195" pre="R" post="L" isDecoy="false" dBSequence_ref="DBSeq_1_PSTB_MYCSM" peptide_ref = "AIAVQPDVLLMDEPCSALDPISTLAIEDLIATLK_000000000000000000000000000000000000"/>
<PeptideEvidence id="TISNLLENEPIIQVGSFVVSHLKNLQASTDPSK_00000000000000000000000000000000000_1_APLP_LOCMI_556_588" start="556" end="588" pre="K" post="A" isDecoy="false" dBSequence_ref="DBSeq_1_APLP_LOCMI" peptide_ref = "TISNLLENEPIIQVGSFVVSHLKNLQASTDPSK_00000000000000000000000000000000000"/>
<PeptideEvidence id="GATSGKAIWSTEHAGFELVPQNLFQEFVMEVR_0000000000000000000000000000000000_1_EF2_ARCFU_679_710" start="679" end="710" pre="R" post="K" isDecoy="false" dBSequence_ref="DBSeq_1_EF2_ARCFU" peptide_ref = "GATSGKAIWSTEHAGFELVPQNLFQEFVMEVR_0000000000000000000000000000000000"/>
<PeptideEvidence id="LLQLKSEEMQTVQQEQLLQETQALQQSFLSEK_0000000000000000000000000000000000_1_PLEC1_HUMAN_2605_2636" start="2605" end="2636" pre="K" post="D" isDecoy="false" dBSequence_ref="DBSeq_1_PLEC1_HUMAN" peptide_ref = "LLQLKSEEMQTVQQEQLLQETQALQQSFLSEK_0000000000000000000000000000000000"/>
<PeptideEvidence id="VVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETR_00000000000000000000000000000000000000_1_AROA_STRP4_227_262" start="227" end="262" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRP4" peptide_ref = "VVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETR_00000000000000000000000000000000000000"/>
<PeptideEvidence id="VVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETR_00000000000000000000000000000000000000_1_AROA_STRPN_227_262" start="227" end="262" pre="K" post="T" isDecoy="false" dBSequence_ref="DBSeq_1_AROA_STRPN" peptide_ref = "VVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETR_00000000000000000000000000000000000000"/>
<PeptideEvidence id="ATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFK_0000000000000000000000000000000000000_1_HIG2A_HUMAN_2_36" start="2" end="36" pre="M" post="E" isDecoy="false" dBSequence_ref="DBSeq_1_HIG2A_HUMAN" peptide_ref = "ATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFK_0000000000000000000000000000000000000"/>
<PeptideEvidence id="QTFGVKVITDVHEASQAQPVAEVVDVIQLPAFLAR_0000000000000000000000000000000000000_1_KDSA_ENT38_86_120" start="86" end="120" pre="K" post="Q" isDecoy="false" dBSequence_ref="DBSeq_1_KDSA_ENT38" peptide_ref = "QTFGVKVITDVHEASQAQPVAEVVDVIQLPAFLAR_0000000000000000000000000000000000000"/>
<PeptideEvidence id="YLQKEHLIQHGISVTESVAVPSNDEQSLIEIGNK_000000000000000000000000000000000000_1_PUR6_DEBOC_105_138" start="105" end="138" pre="K" post="F" isDecoy="false" dBSequence_ref="DBSeq_1_PUR6_DEBOC" peptide_ref = "YLQKEHLIQHGISVTESVAVPSNDEQSLIEIGNK_000000000000000000000000000000000000"/>
</SequenceCollection>
<AnalysisCollection>
<SpectrumIdentification id="SI" spectrumIdentificationProtocol_ref="SIP" spectrumIdentificationList_ref="SIL_1" activityDate="2011-05-26T12:08:33">
<InputSpectra spectraData_ref="SD_1"/>
<SearchDatabaseRef searchDatabase_ref="SDB_SwissProt"/>
</SpectrumIdentification>
<ProteinDetection id="PD_1" proteinDetectionProtocol_ref="PDP_MascotParser_1" proteinDetectionList_ref="PDL_1" activityDate="2011-05-26T13:27:42">
<InputSpectrumIdentifications spectrumIdentificationList_ref="SIL_1"/>
</ProteinDetection>
</AnalysisCollection>
<AnalysisProtocolCollection>
<SpectrumIdentificationProtocol id="SIP" analysisSoftware_ref="AS_mascot_server">
<SearchType>
<cvParam accession="MS:1001081" name="pmf search" cvRef="PSI-MS" value=""/>
</SearchType>
<AdditionalSearchParams>
<userParam name="Mascot User Comment" value="PMF 1 Example Mascot Course"/>
<cvParam accession="MS:1001211" name="parent mass type mono" cvRef="PSI-MS"/>
</AdditionalSearchParams>
<Enzymes>
<Enzyme id="ENZ_0" cTermGain="OH" nTermGain="H" semiSpecific="0">
<SiteRegexp><![CDATA[(?<=[KR])(?!P)]]></SiteRegexp>
<EnzymeName>
<cvParam accession="MS:1001251" name="Trypsin" cvRef="PSI-MS" />
</EnzymeName>
</Enzyme>
</Enzymes>
<MassTable id="MT" msLevel="1 2">
<Residue code="A" mass="71.037114"/>
<Residue code="C" mass="103.009185"/>
<Residue code="D" mass="115.026943"/>
<Residue code="E" mass="129.042593"/>
<Residue code="F" mass="147.068414"/>
<Residue code="G" mass="57.021464"/>
<Residue code="H" mass="137.058912"/>
<Residue code="I" mass="113.084064"/>
<Residue code="K" mass="128.094963"/>
<Residue code="L" mass="113.084064"/>
<Residue code="M" mass="131.040485"/>
<Residue code="N" mass="114.042927"/>
<Residue code="P" mass="97.052764"/>
<Residue code="Q" mass="128.058578"/>
<Residue code="R" mass="156.101111"/>
<Residue code="S" mass="87.032028"/>
<Residue code="T" mass="101.047679"/>
<Residue code="U" mass="150.95363"/>
<Residue code="V" mass="99.068414"/>
<Residue code="W" mass="186.079313"/>
<Residue code="Y" mass="163.063329"/>
<AmbiguousResidue code="B">
<cvParam accession="MS:1001360" name="alternate single letter codes" cvRef="PSI-MS" value="D N"/>
</AmbiguousResidue>
<AmbiguousResidue code="Z">
<cvParam accession="MS:1001360" name="alternate single letter codes" cvRef="PSI-MS" value="E Q"/>
</AmbiguousResidue>
<AmbiguousResidue code="X">
<cvParam accession="MS:1001360" name="alternate single letter codes" cvRef="PSI-MS" value="A C D E F G H I K L M N O P Q R S T U V W Y"/>
</AmbiguousResidue>
</MassTable>
<ParentTolerance>
<cvParam accession="MS:1001412" name="search tolerance plus value" value="100" cvRef="PSI-MS" unitAccession="UO:0000169" unitName="parts per million" unitCvRef="UO" />
<cvParam accession="MS:1001413" name="search tolerance minus value" value="100" cvRef="PSI-MS" unitAccession="UO:0000169" unitName="parts per million" unitCvRef="UO" />
</ParentTolerance>
<Threshold>
<cvParam accession="MS:1001494" name="no threshold" cvRef="PSI-MS" />
</Threshold>
<DatabaseFilters>
<Filter>
<FilterType>
<cvParam accession="MS:1001020" name="DB filter taxonomy" cvRef="PSI-MS" />
</FilterType>
</Filter>
</DatabaseFilters>
</SpectrumIdentificationProtocol>
<ProteinDetectionProtocol id="PDP_MascotParser_1" analysisSoftware_ref="AS_mascot_parser">
<AnalysisParams>
<cvParam accession="MS:1001316" name="mascot:SigThreshold" cvRef="PSI-MS" value="0.05"/>
<cvParam accession="MS:1001317" name="mascot:MaxProteinHits" cvRef="PSI-MS" value="Auto"/>
<cvParam accession="MS:1001320" name="mascot:ShowHomologousProteinsWithSamePeptides" cvRef="PSI-MS" value="1"/>
<cvParam accession="MS:1001321" name="mascot:ShowHomologousProteinsWithSubsetOfPeptides" cvRef="PSI-MS" value="0"/>
<cvParam accession="MS:1001325" name="mascot:ShowDecoyMatches" cvRef="PSI-MS" value="0"/>
</AnalysisParams>
<Threshold>
<cvParam accession="MS:1001316" name="mascot:SigThreshold" cvRef="PSI-MS" value="0.05"/>
</Threshold>
</ProteinDetectionProtocol>
</AnalysisProtocolCollection>
<DataCollection>
<Inputs>
<SourceFile location="file:///../data/20110526/F001276.dat" id="SF_1" >
<FileFormat>
<cvParam accession="MS:1001199" name="Mascot DAT file" cvRef="PSI-MS" />
</FileFormat>
</SourceFile>
<SearchDatabase location="file:////usr/local/mascot/sequence/SwissProt/current/SwissProt_57.15.fasta" id="SDB_SwissProt" name="SwissProt" numDatabaseSequences="515203" numResidues="181334896" version="SwissProt_57.15.fasta">
<FileFormat>
<cvParam accession="MS:1001348" name="FASTA format" cvRef="PSI-MS" />
</FileFormat>
<DatabaseName>
<userParam name="SwissProt_57.15.fasta" />
</DatabaseName>
<cvParam accession="MS:1001073" name="database type amino acid" cvRef="PSI-MS" />
</SearchDatabase>
<SpectraData location="file:///" id="SD_1">
<FileFormat>
<cvParam accession="MS:1001369" name="text file" cvRef="PSI-MS" />
</FileFormat>
<SpectrumIDFormat>
<cvParam accession="MS:1000775" name="single peak list nativeID format" cvRef="PSI-MS" />
</SpectrumIDFormat>
</SpectraData>
</Inputs>
<AnalysisData>
<SpectrumIdentificationList id="SIL_1" numSequencesSearched="515203">
<SpectrumIdentificationResult id="SIR_1" spectrumID="file=" spectraData_ref="SD_1">
<SpectrumIdentificationItem id="SII_4_29" calculatedMassToCharge="534.306806" chargeState="1" experimentalMassToCharge="534.35" peptide_ref="MKQK_000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="MKQK_000000_1_KDSA_ENT38_1_4"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_6_26" calculatedMassToCharge="569.340558" chargeState="1" experimentalMassToCharge="569.29" peptide_ref="SLPPR_0000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SLPPR_0000000_1_APLP_LOCMI_498_502"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_11_5" calculatedMassToCharge="678.356946" chargeState="1" experimentalMassToCharge="678.3" peptide_ref="AGFEVR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AGFEVR_00000000_1_RPOB_CLOTH_520_525"/>
<PeptideEvidenceRef peptideEvidence_ref="AGFEVR_00000000_1_RPOB_DECAR_618_623"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_11_7" calculatedMassToCharge="678.356946" chargeState="1" experimentalMassToCharge="678.3" peptide_ref="AGFEVR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AGFEVR_00000000_1_RPOB_CLOTH_520_525"/>
<PeptideEvidenceRef peptideEvidence_ref="AGFEVR_00000000_1_RPOB_DECAR_618_623"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_12_26" calculatedMassToCharge="679.388578" chargeState="1" experimentalMassToCharge="679.41" peptide_ref="TFRQK_0000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="TFRQK_0000000_1_APLP_LOCMI_715_719"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_12_29" calculatedMassToCharge="679.377363" chargeState="1" experimentalMassToCharge="679.41" peptide_ref="QTFGVK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="QTFGVK_00000000_1_KDSA_ENT38_86_91"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_12_33" calculatedMassToCharge="679.377347" chargeState="1" experimentalMassToCharge="679.41" peptide_ref="GNYVVK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GNYVVK_00000000_1_PUR6_DEBOC_156_161"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_13_3" calculatedMassToCharge="682.315458" chargeState="1" experimentalMassToCharge="682.29" peptide_ref="YQSER_0000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="YQSER_0000000_1_TRUB_LACS1_293_297"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_13_5" calculatedMassToCharge="682.35185" chargeState="1" experimentalMassToCharge="682.29" peptide_ref="RDTYK_0000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="RDTYK_0000000_1_RPOB_CLOTH_721_725"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_13_26" calculatedMassToCharge="682.34062" chargeState="1" experimentalMassToCharge="682.29" peptide_ref="LSYDGK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="LSYDGK_00000000_1_APLP_LOCMI_3153_3158"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_14_34" calculatedMassToCharge="691.252912" chargeState="1" experimentalMassToCharge="691.25" peptide_ref="EENDNA_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="EENDNA_00000000_1_FABD_BACSU_312_317"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_17_4" calculatedMassToCharge="766.394102" chargeState="1" experimentalMassToCharge="766.34" peptide_ref="STSEKSK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="STSEKSK_000000000_1_PLEC1_HUMAN_1917_1923"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_17_12" calculatedMassToCharge="766.413404" chargeState="1" experimentalMassToCharge="766.34" peptide_ref="DFFLPK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DFFLPK_00000000_1_CP2A6_HUMAN_382_387"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_17_37" calculatedMassToCharge="766.384199" chargeState="1" experimentalMassToCharge="766.34" peptide_ref="ENGYRK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="ENGYRK_00000000_1_KPRS_PYRFU_71_76"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_17_43" calculatedMassToCharge="766.409376" chargeState="1" experimentalMassToCharge="766.34" peptide_ref="DYVITR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DYVITR_00000000_1_PBPA_RICCN_227_232"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_17_47" calculatedMassToCharge="766.366468" chargeState="1" experimentalMassToCharge="766.34" peptide_ref="GFQGAMR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GFQGAMR_000000000_1_RL3_AKKM8_120_126"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_18_2" calculatedMassToCharge="779.440992" chargeState="1" experimentalMassToCharge="779.45" peptide_ref="KIGGYNK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="KIGGYNK_000000000_1_MATK_CERBE_81_87"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_18_4" calculatedMassToCharge="779.441007" chargeState="1" experimentalMassToCharge="779.45" peptide_ref="LSFSGLR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="LSFSGLR_000000000_1_PLEC1_HUMAN_3440_3446"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_18_15" calculatedMassToCharge="779.429761" chargeState="1" experimentalMassToCharge="779.45" peptide_ref="LDIYQK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="LDIYQK_00000000_1_SYE_STRSY_66_71"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_18_30" calculatedMassToCharge="779.477369" chargeState="1" experimentalMassToCharge="779.45" peptide_ref="SLYRIK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SLYRIK_00000000_1_MATK_FRAVE_419_424"/>
<PeptideEvidenceRef peptideEvidence_ref="SLYRIK_00000000_1_MATK_SPICA_421_426"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_18_32" calculatedMassToCharge="779.375638" chargeState="1" experimentalMassToCharge="779.45" peptide_ref="WTDMVK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="WTDMVK_00000000_1_SYE_STREM_168_173"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_18_41" calculatedMassToCharge="779.477369" chargeState="1" experimentalMassToCharge="779.45" peptide_ref="SLYRIK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SLYRIK_00000000_1_MATK_FRAVE_419_424"/>
<PeptideEvidenceRef peptideEvidence_ref="SLYRIK_00000000_1_MATK_SPICA_421_426"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_18_45" calculatedMassToCharge="779.389356" chargeState="1" experimentalMassToCharge="779.45" peptide_ref="NSSKDTK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="NSSKDTK_000000000_1_RMD6_YEAST_18_24"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_2" calculatedMassToCharge="793.450132" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="FVRICR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FVRICR_00000000_1_MATK_CERBE_403_408"/>
<PeptideEvidenceRef peptideEvidence_ref="FVRICR_00000000_1_MATK_SPICA_402_407"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_4" calculatedMassToCharge="793.409025" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="FIEQEK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FIEQEK_00000000_1_PLEC1_HUMAN_2645_2650"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_6" calculatedMassToCharge="793.456678" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="TVAVTFR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="TVAVTFR_000000000_1_BRIX_AERPE_149_155"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_12" calculatedMassToCharge="793.339612" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="MQEEEK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="MQEEEK_00000000_1_CP2A6_HUMAN_275_280"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_17" calculatedMassToCharge="793.456647" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="YKGIAGGK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="YKGIAGGK_0000000000_1_PP438_ARATH_169_176"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_32" calculatedMassToCharge="793.42024" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="AAYIAER_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AAYIAER_000000000_1_SYE_STREM_141_147"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_41" calculatedMassToCharge="793.450132" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="FVRICR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FVRICR_00000000_1_MATK_CERBE_403_408"/>
<PeptideEvidenceRef peptideEvidence_ref="FVRICR_00000000_1_MATK_SPICA_402_407"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_42" calculatedMassToCharge="793.37602" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="ALMDTDK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="ALMDTDK_000000000_1_HSLV_RHILO_139_145"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_48" calculatedMassToCharge="793.383863" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="SAPYAER_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SAPYAER_000000000_1_METE_VIBHA_412_418"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_19_50" calculatedMassToCharge="793.450117" chargeState="1" experimentalMassToCharge="793.41" peptide_ref="MLFARR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="MLFARR_00000000_1_LEPA_LEGPA_1_6"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_20_1" calculatedMassToCharge="823.446088" chargeState="1" experimentalMassToCharge="823.43" peptide_ref="VISYWR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VISYWR_00000000_1_HYEP_HUMAN_93_98"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_20_2" calculatedMassToCharge="823.467206" chargeState="1" experimentalMassToCharge="823.43" peptide_ref="NKSIFSK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="NKSIFSK_000000000_1_MATK_CERBE_193_199"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_20_5" calculatedMassToCharge="823.430829" chargeState="1" experimentalMassToCharge="823.43" peptide_ref="SILYDGR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SILYDGR_000000000_1_RPOB_CLOTH_1029_1035"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_20_15" calculatedMassToCharge="823.430814" chargeState="1" experimentalMassToCharge="823.43" peptide_ref="TAYIAER_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="TAYIAER_000000000_1_SYE_STRSY_121_127"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_20_34" calculatedMassToCharge="823.430845" chargeState="1" experimentalMassToCharge="823.43" peptide_ref="DAVYTVR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DAVYTVR_000000000_1_FABD_BACSU_108_114"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_20_42" calculatedMassToCharge="823.44206" chargeState="1" experimentalMassToCharge="823.43" peptide_ref="TDRYLR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="TDRYLR_00000000_1_HSLV_RHILO_88_93"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_20_43" calculatedMassToCharge="823.474607" chargeState="1" experimentalMassToCharge="823.43" peptide_ref="SLLFCLK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SLLFCLK_000000000_1_PBPA_RICCN_4_10"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_9" calculatedMassToCharge="827.477399" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="WPIGLGGK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="WPIGLGGK_0000000000_1_PSTS_ECOLI_193_200"/>
<PeptideEvidenceRef peptideEvidence_ref="WPIGLGGK_0000000000_1_PSTS_SHIFL_193_200"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_10" calculatedMassToCharge="827.477399" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="WPIGLGGK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="WPIGLGGK_0000000000_1_PSTS_ECOLI_193_200"/>
<PeptideEvidenceRef peptideEvidence_ref="WPIGLGGK_0000000000_1_PSTS_SHIFL_193_200"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_19" calculatedMassToCharge="827.429792" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="GEFVFTK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GEFVFTK_000000000_1_VMTH_LAMBD_754_760"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_26" calculatedMassToCharge="827.441007" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="FEKTFR_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FEKTFR_00000000_1_APLP_LOCMI_712_717"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_30" calculatedMassToCharge="827.466138" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="FYEKIK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FYEKIK_00000000_1_MATK_FRAVE_244_249"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_40" calculatedMassToCharge="827.520978" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="VAVRNLR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VAVRNLR_000000000_1_RRF_BORA1_127_133"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_44" calculatedMassToCharge="827.429761" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="AALDFYK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AALDFYK_000000000_1_PTH_SPHAL_74_80"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_21_48" calculatedMassToCharge="827.498517" chargeState="1" experimentalMassToCharge="827.45" peptide_ref="LQPVKDK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="LQPVKDK_000000000_1_METE_VIBHA_309_315"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_22_1" calculatedMassToCharge="835.467222" chargeState="1" experimentalMassToCharge="835.46" peptide_ref="FLGLTER_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FLGLTER_000000000_1_HYEP_HUMAN_271_277"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_23_1" calculatedMassToCharge="838.372983" chargeState="1" experimentalMassToCharge="838.37" peptide_ref="NEFDWK_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="NEFDWK_00000000_1_HYEP_HUMAN_99_104"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_23_19" calculatedMassToCharge="838.368986" chargeState="1" experimentalMassToCharge="838.37" peptide_ref="GFDDQTR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GFDDQTR_000000000_1_VMTH_LAMBD_279_285"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_23_32" calculatedMassToCharge="838.416562" chargeState="1" experimentalMassToCharge="838.37" peptide_ref="YRQSER_00000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="YRQSER_00000000_1_SYE_STREM_80_85"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_23_43" calculatedMassToCharge="838.441724" chargeState="1" experimentalMassToCharge="838.37" peptide_ref="IYSRDGK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="IYSRDGK_000000000_1_PBPA_RICCN_51_57"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_23_45" calculatedMassToCharge="838.452955" chargeState="1" experimentalMassToCharge="838.37" peptide_ref="ELGNHRL_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="ELGNHRL_000000000_1_RMD6_YEAST_225_231"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_23_48" calculatedMassToCharge="838.45297" chargeState="1" experimentalMassToCharge="838.37" peptide_ref="GHIADAVR_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GHIADAVR_0000000000_1_METE_VIBHA_468_475"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_1" calculatedMassToCharge="863.498517" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="FLSVLER_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FLSVLER_000000000_1_HYEP_HUMAN_448_454"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_4" calculatedMassToCharge="863.462125" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="AQFEQLK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AQFEQLK_000000000_1_PLEC1_HUMAN_3463_3469"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_5" calculatedMassToCharge="863.509748" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="VYVAQKR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VYVAQKR_000000000_1_RPOB_CLOTH_925_931"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_15" calculatedMassToCharge="863.425748" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="SPAAFDQK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SPAAFDQK_0000000000_1_SYE_STRSY_295_302"/>
<PeptideEvidenceRef peptideEvidence_ref="SPAAFDQK_0000000000_1_SYE_STREM_315_322"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_26" calculatedMassToCharge="863.436979" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="NIQFGER_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="NIQFGER_000000000_1_APLP_LOCMI_3161_3167"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_32" calculatedMassToCharge="863.425748" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="SPAAFDQK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SPAAFDQK_0000000000_1_SYE_STRSY_295_302"/>
<PeptideEvidenceRef peptideEvidence_ref="SPAAFDQK_0000000000_1_SYE_STREM_315_322"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_43" calculatedMassToCharge="863.509733" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="NGKIIYR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="NGKIIYR_000000000_1_PBPA_RICCN_590_596"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_26_48" calculatedMassToCharge="863.484601" chargeState="1" experimentalMassToCharge="863.49" peptide_ref="VQRSAFR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VQRSAFR_000000000_1_METE_VIBHA_447_453"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_27_1" calculatedMassToCharge="871.49957" chargeState="1" experimentalMassToCharge="871.49" peptide_ref="QVEILNR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="QVEILNR_000000000_1_HYEP_HUMAN_106_112"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_27_19" calculatedMassToCharge="871.535932" chargeState="1" experimentalMassToCharge="871.49" peptide_ref="LALEAARK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="LALEAARK_0000000000_1_VMTH_LAMBD_365_372"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_27_20" calculatedMassToCharge="871.467206" chargeState="1" experimentalMassToCharge="871.49" peptide_ref="YLYLSGR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="YLYLSGR_000000000_1_STAD_SOLTU_183_189"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_27_24" calculatedMassToCharge="871.430845" chargeState="1" experimentalMassToCharge="871.49" peptide_ref="VFYDATR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VFYDATR_000000000_1_TPL_CITFR_211_217"/>
<PeptideEvidenceRef peptideEvidence_ref="VFYDATR_000000000_1_TPL_ESCIN_211_217"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_27_25" calculatedMassToCharge="871.430845" chargeState="1" experimentalMassToCharge="871.49" peptide_ref="VFYDATR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VFYDATR_000000000_1_TPL_CITFR_211_217"/>
<PeptideEvidenceRef peptideEvidence_ref="VFYDATR_000000000_1_TPL_ESCIN_211_217"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_27_37" calculatedMassToCharge="871.488325" chargeState="1" experimentalMassToCharge="871.49" peptide_ref="AENILPSK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AENILPSK_0000000000_1_KPRS_PYRFU_133_140"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_28_1" calculatedMassToCharge="915.475675" chargeState="1" experimentalMassToCharge="915.47" peptide_ref="VFYSLMR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VFYSLMR_000000000_1_HYEP_HUMAN_289_295"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_28_4" calculatedMassToCharge="915.525785" chargeState="1" experimentalMassToCharge="915.47" peptide_ref="GLLSAEVAR_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GLLSAEVAR_00000000000_1_PLEC1_HUMAN_3850_3858"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_28_8" calculatedMassToCharge="915.533185" chargeState="1" experimentalMassToCharge="915.47" peptide_ref="CLQLPLTK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="CLQLPLTK_0000000000_1_RUVB_HAMD5_200_207"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_28_44" calculatedMassToCharge="915.515912" chargeState="1" experimentalMassToCharge="915.47" peptide_ref="IGIGHPGHK_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="IGIGHPGHK_00000000000_1_PTH_SPHAL_130_138"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_3" calculatedMassToCharge="918.529478" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="DGILPLYK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DGILPLYK_0000000000_1_TRUB_LACS1_2_9"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_4" calculatedMassToCharge="918.504346" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="VPVDVAYR_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="VPVDVAYR_0000000000_1_PLEC1_HUMAN_2961_2968"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_14" calculatedMassToCharge="918.463911" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="RDANSDLK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="RDANSDLK_0000000000_1_RRF_ALCBS_133_140"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_17" calculatedMassToCharge="918.489072" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="EVDSNVKK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="EVDSNVKK_0000000000_1_PP438_ARATH_480_487"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_33" calculatedMassToCharge="918.482526" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="ELEICRR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="ELEICRR_000000000_1_PUR6_DEBOC_328_334"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_38" calculatedMassToCharge="918.53671" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="QVKSTVTR_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="QVKSTVTR_0000000000_1_FABP_CLOSI_80_87"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_43" calculatedMassToCharge="918.467939" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="FGINNEPK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="FGINNEPK_0000000000_1_PBPA_RICCN_540_547"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_46" calculatedMassToCharge="918.452695" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="GDINSEVGK_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GDINSEVGK_00000000000_1_EF2_ARCFU_271_279"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_29_49" calculatedMassToCharge="918.463895" chargeState="1" experimentalMassToCharge="918.46" peptide_ref="EIRSEER_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="EIRSEER_000000000_1_IF2P_METTP_300_306"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_30_1" calculatedMassToCharge="922.474103" chargeState="1" experimentalMassToCharge="922.49" peptide_ref="GFNSVATAR_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GFNSVATAR_00000000000_1_HYEP_HUMAN_198_206"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_30_14" calculatedMassToCharge="922.441068" chargeState="1" experimentalMassToCharge="922.49" peptide_ref="SDAQSRMK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SDAQSRMK_0000000000_1_RRF_ALCBS_7_14"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_30_19" calculatedMassToCharge="922.49925" chargeState="1" experimentalMassToCharge="922.49" peptide_ref="AGISVGQYK_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AGISVGQYK_00000000000_1_VMTH_LAMBD_58_66"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_30_26" calculatedMassToCharge="922.499235" chargeState="1" experimentalMassToCharge="922.49" peptide_ref="ITERFEK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="ITERFEK_000000000_1_APLP_LOCMI_708_714"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_30_43" calculatedMassToCharge="922.51048" chargeState="1" experimentalMassToCharge="922.49" peptide_ref="RDYVITR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="RDYVITR_000000000_1_PBPA_RICCN_226_232"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_30_47" calculatedMassToCharge="922.467573" chargeState="1" experimentalMassToCharge="922.49" peptide_ref="GFQGAMRR_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GFQGAMRR_0000000000_1_RL3_AKKM8_120_127"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_2" calculatedMassToCharge="931.491712" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DTPLLMNK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_CERBE_287_294"/>
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_FRAVE_284_291"/>
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_SPICA_286_293"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_3" calculatedMassToCharge="931.434186" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="CIYQYNK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="CIYQYNK_000000000_1_TRUB_LACS1_282_288"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_4" calculatedMassToCharge="931.520688" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DKLLSAER_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DKLLSAER_0000000000_1_PLEC1_HUMAN_4139_4146"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_8" calculatedMassToCharge="931.509489" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="TTSGPVLEK_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="TTSGPVLEK_00000000000_1_RUVB_HAMD5_86_94"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_9" calculatedMassToCharge="931.535947" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="AAWKTNIK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AAWKTNIK_0000000000_1_PSTS_ECOLI_331_338"/>
<PeptideEvidenceRef peptideEvidence_ref="AAWKTNIK_0000000000_1_PSTS_SHIFL_331_338"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_10" calculatedMassToCharge="931.535947" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="AAWKTNIK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="AAWKTNIK_0000000000_1_PSTS_ECOLI_331_338"/>
<PeptideEvidenceRef peptideEvidence_ref="AAWKTNIK_0000000000_1_PSTS_SHIFL_331_338"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_18" calculatedMassToCharge="931.509458" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DAEELKVK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DAEELKVK_0000000000_1_AROA_STRP4_332_339"/>
<PeptideEvidenceRef peptideEvidence_ref="DAEELKVK_0000000000_1_AROA_STRPN_332_339"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_21" calculatedMassToCharge="931.509458" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DAEELKVK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DAEELKVK_0000000000_1_AROA_STRP4_332_339"/>
<PeptideEvidenceRef peptideEvidence_ref="DAEELKVK_0000000000_1_AROA_STRPN_332_339"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_30" calculatedMassToCharge="931.491712" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DTPLLMNK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_CERBE_287_294"/>
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_FRAVE_284_291"/>
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_SPICA_286_293"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_36" calculatedMassToCharge="931.520688" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="EVESLKAR_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="EVESLKAR_0000000000_1_SYA_THET2_761_768"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_41" calculatedMassToCharge="931.491712" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DTPLLMNK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_CERBE_287_294"/>
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_FRAVE_284_291"/>
<PeptideEvidenceRef peptideEvidence_ref="DTPLLMNK_0000000000_1_MATK_SPICA_286_293"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_42" calculatedMassToCharge="931.484296" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DAEEIARK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DAEEIARK_0000000000_1_HSLV_RHILO_146_153"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_43" calculatedMassToCharge="931.524732" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="DKPSLPFK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DKPSLPFK_0000000000_1_PBPA_RICCN_719_726"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_31_46" calculatedMassToCharge="931.506956" chargeState="1" experimentalMassToCharge="931.48" peptide_ref="ELMWKPK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="ELMWKPK_000000000_1_EF2_ARCFU_12_18"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_1" calculatedMassToCharge="951.541044" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="KVISYWR_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="KVISYWR_000000000_1_HYEP_HUMAN_92_98"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_2" calculatedMassToCharge="951.562192" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="STVRTFLK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_CERBE_444_451"/>
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_FRAVE_441_448"/>
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_SPICA_443_450"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_7" calculatedMassToCharge="951.5258" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="GLTFASSLR_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GLTFASSLR_00000000000_1_RPOB_DECAR_93_101"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_9" calculatedMassToCharge="951.489393" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="QNNLAYTK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="QNNLAYTK_0000000000_1_PSTS_ECOLI_226_233"/>
<PeptideEvidenceRef peptideEvidence_ref="QNNLAYTK_0000000000_1_PSTS_SHIFL_226_233"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_10" calculatedMassToCharge="951.489393" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="QNNLAYTK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="QNNLAYTK_0000000000_1_PSTS_ECOLI_226_233"/>
<PeptideEvidenceRef peptideEvidence_ref="QNNLAYTK_0000000000_1_PSTS_SHIFL_226_233"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_18" calculatedMassToCharge="951.598554" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="DLPPLRLK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DLPPLRLK_0000000000_1_AROA_STRP4_143_150"/>
<PeptideEvidenceRef peptideEvidence_ref="DLPPLRLK_0000000000_1_AROA_STRPN_143_150"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_21" calculatedMassToCharge="951.598554" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="DLPPLRLK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DLPPLRLK_0000000000_1_AROA_STRP4_143_150"/>
<PeptideEvidenceRef peptideEvidence_ref="DLPPLRLK_0000000000_1_AROA_STRPN_143_150"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_30" calculatedMassToCharge="951.562192" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="STVRTFLK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_CERBE_444_451"/>
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_FRAVE_441_448"/>
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_SPICA_443_450"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_34" calculatedMassToCharge="951.5258" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="DAVYTVRK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="DAVYTVRK_0000000000_1_FABD_BACSU_108_115"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_41" calculatedMassToCharge="951.562192" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="STVRTFLK_0000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_CERBE_444_451"/>
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_FRAVE_441_448"/>
<PeptideEvidenceRef peptideEvidence_ref="STVRTFLK_0000000000_1_MATK_SPICA_443_450"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_32_47" calculatedMassToCharge="951.482892" chargeState="1" experimentalMassToCharge="951.53" peptide_ref="GKGFQGAMR_00000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="GKGFQGAMR_00000000000_1_RL3_AKKM8_118_126"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_33_1" calculatedMassToCharge="966.467939" chargeState="1" experimentalMassToCharge="966.48" peptide_ref="NEFDWKK_000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="NEFDWKK_000000000_1_HYEP_HUMAN_99_105"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_33_11" calculatedMassToCharge="966.485059" chargeState="1" experimentalMassToCharge="966.48" peptide_ref="SVSSSSSLGR_000000000000" rank="0" passThreshold="true">
<PeptideEvidenceRef peptideEvidence_ref="SVSSSSSLGR_000000000000_1_YQB6_CAEEL_1028_1037"/>
</SpectrumIdentificationItem>
<SpectrumIdentificationItem id="SII_33_12" calculatedMassToCharge=