diff --git a/INSCRIPTION.md b/INSCRIPTION.md
index 409526e05..25a9ee288 100644
--- a/INSCRIPTION.md
+++ b/INSCRIPTION.md
@@ -15,6 +15,9 @@ type Deployment struct {
 	// the version must be 1
 	Version uint8 `json:"version"`
 
+	// operation must be deploy
+	Operation string `json:"operation"`
+
 	// 1 distribute tokens per inscription
 	// 2 distribute tokens after inscription progress done
 	Mode uint8 `json:"mode"`
diff --git a/go.mod b/go.mod
index fdfffe6dd..d39518788 100644
--- a/go.mod
+++ b/go.mod
@@ -10,7 +10,7 @@ require (
 	github.com/dgraph-io/ristretto v0.1.1
 	github.com/pelletier/go-toml v1.9.5
 	github.com/quic-go/quic-go v0.42.0
-	github.com/shopspring/decimal v1.3.1
+	github.com/shopspring/decimal v1.4.0
 	github.com/stretchr/testify v1.9.0
 	github.com/urfave/cli/v2 v2.27.1
 	github.com/zeebo/blake3 v0.2.3
@@ -18,30 +18,30 @@ require (
 )
 
 require (
-	github.com/cespare/xxhash/v2 v2.2.0 // indirect
-	github.com/cpuguy83/go-md2man/v2 v2.0.2 // indirect
+	github.com/cespare/xxhash/v2 v2.3.0 // indirect
+	github.com/cpuguy83/go-md2man/v2 v2.0.4 // indirect
 	github.com/davecgh/go-spew v1.1.1 // indirect
 	github.com/dustin/go-humanize v1.0.1 // indirect
 	github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 // indirect
 	github.com/gogo/protobuf v1.3.2 // indirect
-	github.com/golang/glog v1.1.1 // indirect
-	github.com/golang/protobuf v1.5.3 // indirect
+	github.com/golang/glog v1.2.1 // indirect
+	github.com/golang/protobuf v1.5.4 // indirect
 	github.com/golang/snappy v0.0.4 // indirect
-	github.com/google/flatbuffers v23.5.26+incompatible // indirect
-	github.com/google/pprof v0.0.0-20210407192527-94a9f03dee38 // indirect
-	github.com/klauspost/compress v1.16.7 // indirect
-	github.com/klauspost/cpuid/v2 v2.0.12 // indirect
-	github.com/onsi/ginkgo/v2 v2.9.5 // indirect
+	github.com/google/flatbuffers v24.3.25+incompatible // indirect
+	github.com/google/pprof v0.0.0-20240424215950-a892ee059fd6 // indirect
+	github.com/klauspost/compress v1.17.8 // indirect
+	github.com/klauspost/cpuid/v2 v2.2.7 // indirect
+	github.com/onsi/ginkgo/v2 v2.17.1 // indirect
 	github.com/pkg/errors v0.9.1 // indirect
 	github.com/pmezard/go-difflib v1.0.0 // indirect
 	github.com/russross/blackfriday/v2 v2.1.0 // indirect
-	github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 // indirect
+	github.com/xrash/smetrics v0.0.0-20240312152122-5f08fbb34913 // indirect
 	go.uber.org/mock v0.4.0 // indirect
-	golang.org/x/exp v0.0.0-20221205204356-47842c84f3db // indirect
-	golang.org/x/mod v0.11.0 // indirect
-	golang.org/x/net v0.21.0 // indirect
+	golang.org/x/exp v0.0.0-20240416160154-fe59bbe5cc7f // indirect
+	golang.org/x/mod v0.17.0 // indirect
+	golang.org/x/net v0.24.0 // indirect
 	golang.org/x/sys v0.19.0 // indirect
-	golang.org/x/tools v0.9.1 // indirect
-	google.golang.org/protobuf v1.31.0 // indirect
+	golang.org/x/tools v0.20.0 // indirect
+	google.golang.org/protobuf v1.33.0 // indirect
 	gopkg.in/yaml.v3 v3.0.1 // indirect
 )
diff --git a/go.sum b/go.sum
index 8bf6fc606..d17ff59b2 100644
--- a/go.sum
+++ b/go.sum
@@ -3,13 +3,10 @@ filippo.io/edwards25519 v1.1.0/go.mod h1:BxyFTGdWcka3PhytdK4V28tE5sGfRvvvRV7EaN4
 github.com/MixinNetwork/badger/v4 v4.2.0-F1 h1:C8K6AYHsfqTPv7eSiSv4wl1awrW2dgkM6EQU8Sbwq7w=
 github.com/MixinNetwork/badger/v4 v4.2.0-F1/go.mod h1:eoudq8Vt4sWtlqwVp9XZ1Keww3/rjYZHoffiMV4IEuY=
 github.com/cespare/xxhash/v2 v2.1.1/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs=
-github.com/cespare/xxhash/v2 v2.2.0 h1:DC2CZ1Ep5Y4k3ZQ899DldepgrayRUGE6BBZ/cd9Cj44=
-github.com/cespare/xxhash/v2 v2.2.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs=
-github.com/chzyer/logex v1.1.10/go.mod h1:+Ywpsq7O8HXn0nuIou7OrIPyXbp3wmkHB+jjWRnGsAI=
-github.com/chzyer/readline v0.0.0-20180603132655-2972be24d48e/go.mod h1:nSuG5e5PlCu98SY8svDHJxuZscDgtXS6KTTbou5AhLI=
-github.com/chzyer/test v0.0.0-20180213035817-a1ea475d72b1/go.mod h1:Q3SI9o4m/ZMnBNeIyt5eFwwo7qiLfzFZmjNmxjkiQlU=
-github.com/cpuguy83/go-md2man/v2 v2.0.2 h1:p1EgwI/C7NhT0JmVkwCD2ZBK8j4aeHQX2pMHHBfMQ6w=
-github.com/cpuguy83/go-md2man/v2 v2.0.2/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o=
+github.com/cespare/xxhash/v2 v2.3.0 h1:UL815xU9SqsFlibzuggzjXhog7bL6oX9BbNZnL2UFvs=
+github.com/cespare/xxhash/v2 v2.3.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs=
+github.com/cpuguy83/go-md2man/v2 v2.0.4 h1:wfIWP927BUkWJb2NmU/kNDYIBTh/ziUX91+lVfRxZq4=
+github.com/cpuguy83/go-md2man/v2 v2.0.4/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o=
 github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
 github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
@@ -24,27 +21,25 @@ github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572/go.mod h1:9Pwr4
 github.com/gogo/protobuf v1.3.2 h1:Ov1cvc58UF3b5XjBnZv7+opcTcQFZebYjWzi34vdm4Q=
 github.com/gogo/protobuf v1.3.2/go.mod h1:P1XiOD3dCwIKUDQYPy72D8LYyHL2YPYrpS2s69NZV8Q=
 github.com/golang/glog v0.0.0-20160126235308-23def4e6c14b/go.mod h1:SBH7ygxi8pfUlaOkMMuAQtPIUF8ecWP5IEl/CR7VP2Q=
-github.com/golang/glog v1.1.1 h1:jxpi2eWoU84wbX9iIEyAeeoac3FLuifZpY9tcNUD9kw=
-github.com/golang/glog v1.1.1/go.mod h1:zR+okUeTbrL6EL3xHUDxZuEtGv04p5shwip1+mL/rLQ=
-github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaSAoJOfIk=
-github.com/golang/protobuf v1.5.3 h1:KhyjKVUg7Usr/dYsdSqoFveMYd5ko72D+zANwlG1mmg=
-github.com/golang/protobuf v1.5.3/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY=
+github.com/golang/glog v1.2.1 h1:OptwRhECazUx5ix5TTWC3EZhsZEHWcYWY4FQHTIubm4=
+github.com/golang/glog v1.2.1/go.mod h1:6AhwSGph0fcJtXVM/PEHPqZlFeoLxhs7/t5UDAwmO+w=
+github.com/golang/protobuf v1.5.4 h1:i7eJL8qZTpSEXOPTxNKhASYpMn+8e5Q6AdndVa1dWek=
+github.com/golang/protobuf v1.5.4/go.mod h1:lnTiLA8Wa4RWRcIUkrtSVa5nRhsEGBg48fD6rSs7xps=
 github.com/golang/snappy v0.0.4 h1:yAGX7huGHXlcLOEtBnF4w7FQwA26wojNCwOYAEhLjQM=
 github.com/golang/snappy v0.0.4/go.mod h1:/XxbfmMg8lxefKM7IXC3fBNl/7bRcc72aCRzEWrmP2Q=
-github.com/google/flatbuffers v23.5.26+incompatible h1:M9dgRyhJemaM4Sw8+66GHBu8ioaQmyPLg1b8VwK5WJg=
-github.com/google/flatbuffers v23.5.26+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
-github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
-github.com/google/pprof v0.0.0-20210407192527-94a9f03dee38 h1:yAJXTCF9TqKcTiHJAE8dj7HMvPfh66eeA2JYW7eFpSE=
-github.com/google/pprof v0.0.0-20210407192527-94a9f03dee38/go.mod h1:kpwsk12EmLew5upagYY7GY0pfYCcupk39gWOCRROcvE=
-github.com/ianlancetaylor/demangle v0.0.0-20200824232613-28f6c0f3b639/go.mod h1:aSSvb/t6k1mPoxDqO4vJh6VOCGPwU4O0C2/Eqndh1Sc=
+github.com/google/flatbuffers v24.3.25+incompatible h1:CX395cjN9Kke9mmalRoL3d81AtFUxJM+yDthflgJGkI=
+github.com/google/flatbuffers v24.3.25+incompatible/go.mod h1:1AeVuKshWv4vARoZatz6mlQ0JxURH0Kv5+zNeJKJCa8=
+github.com/google/pprof v0.0.0-20240424215950-a892ee059fd6 h1:k7nVchz72niMH6YLQNvHSdIE7iqsQxK1P41mySCvssg=
+github.com/google/pprof v0.0.0-20240424215950-a892ee059fd6/go.mod h1:kf6iHlnVGwgKolg33glAes7Yg/8iWP8ukqeldJSO7jw=
 github.com/kisielk/errcheck v1.5.0/go.mod h1:pFxgyoBC7bSaBwPgfKdkLd5X25qrDl4LWUI2bnpBCr8=
 github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck=
-github.com/klauspost/compress v1.16.7 h1:2mk3MPGNzKyxErAw8YaohYh69+pa4sIQSC0fPGCFR9I=
-github.com/klauspost/compress v1.16.7/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE=
-github.com/klauspost/cpuid/v2 v2.0.12 h1:p9dKCg8i4gmOxtv35DvrYoWqYzQrvEVdjQ762Y0OqZE=
+github.com/klauspost/compress v1.17.8 h1:YcnTYrq7MikUT7k0Yb5eceMmALQPYBW/Xltxn0NAMnU=
+github.com/klauspost/compress v1.17.8/go.mod h1:Di0epgTjJY877eYKx5yC51cX2A2Vl2ibi7bDH9ttBbw=
 github.com/klauspost/cpuid/v2 v2.0.12/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c=
-github.com/onsi/ginkgo/v2 v2.9.5 h1:+6Hr4uxzP4XIUyAkg61dWBw8lb/gc4/X5luuxN/EC+Q=
-github.com/onsi/ginkgo/v2 v2.9.5/go.mod h1:tvAoo1QUJwNEU2ITftXTpR7R1RbCzoZUOs3RonqW57k=
+github.com/klauspost/cpuid/v2 v2.2.7 h1:ZWSB3igEs+d0qvnxR/ZBzXVmxkgt8DdzP6m9pfuVLDM=
+github.com/klauspost/cpuid/v2 v2.2.7/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
+github.com/onsi/ginkgo/v2 v2.17.1 h1:V++EzdbhI4ZV4ev0UTIj0PzhzOcReJFyJaLjtSF55M8=
+github.com/onsi/ginkgo/v2 v2.17.1/go.mod h1:llBI3WDLL9Z6taip6f33H76YcWtJv+7R3HigUjbIBOs=
 github.com/pelletier/go-toml v1.9.5 h1:4yBQzkHv+7BHq2PQUZF3Mx0IYxG7LsP222s7Agd3ve8=
 github.com/pelletier/go-toml v1.9.5/go.mod h1:u1nR/EPcESfeI/szUZKdtJ0xRNbUoANCkoOuaOx1Y+c=
 github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
@@ -55,8 +50,8 @@ github.com/quic-go/quic-go v0.42.0 h1:uSfdap0eveIl8KXnipv9K7nlwZ5IqLlYOpJ58u5utp
 github.com/quic-go/quic-go v0.42.0/go.mod h1:132kz4kL3F9vxhW3CtQJLDVwcFe5wdWeJXXijhsO57M=
 github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf35Ld67mk=
 github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM=
-github.com/shopspring/decimal v1.3.1 h1:2Usl1nmF/WZucqkFZhnfFYxxxu8LG21F6nPQBE5gKV8=
-github.com/shopspring/decimal v1.3.1/go.mod h1:DKyhrW/HYNuLGql+MJL6WCR6knT2jwCFRcu2hWCYk4o=
+github.com/shopspring/decimal v1.4.0 h1:bxl37RwXBklmTi0C79JfXCEBD1cqqHt0bbgBAGFp81k=
+github.com/shopspring/decimal v1.4.0/go.mod h1:gawqmDU56v4yIKSwfBSFip1HdCCXN8/+DMd9qYNcwME=
 github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
 github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
 github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg=
@@ -64,8 +59,8 @@ github.com/stretchr/testify v1.9.0 h1:HtqpIVDClZ4nwg75+f6Lvsy/wHu+3BoSGCbBAcpTsT
 github.com/stretchr/testify v1.9.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
 github.com/urfave/cli/v2 v2.27.1 h1:8xSQ6szndafKVRmfyeUMxkNUJQMjL1F2zmsZ+qHpfho=
 github.com/urfave/cli/v2 v2.27.1/go.mod h1:8qnjx1vcq5s2/wpsqoZFndg2CE5tNFyrTvS6SinrnYQ=
-github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 h1:bAn7/zixMGCfxrRTfdpNzjtPYqr8smhKouy9mxVdGPU=
-github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673/go.mod h1:N3UwUGtsrSj3ccvlPHLoLsHnpR27oXr4ZE984MbSER8=
+github.com/xrash/smetrics v0.0.0-20240312152122-5f08fbb34913 h1:+qGGcbkzsfDQNPPe9UDgpxAWQrhbbBXOYJFQDq/dtJw=
+github.com/xrash/smetrics v0.0.0-20240312152122-5f08fbb34913/go.mod h1:4aEEwZQutDLsQv2Deui4iYQ6DWTxR14g6m8Wv88+Xqk=
 github.com/yuin/goldmark v1.1.27/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74=
 github.com/yuin/goldmark v1.2.1/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74=
 github.com/zeebo/assert v1.1.0/go.mod h1:Pq9JiuJQpG8JLJdtkwrJESF0Foym2/D9XMU5ciN/wJ0=
@@ -79,26 +74,26 @@ golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8U
 golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
 golang.org/x/crypto v0.22.0 h1:g1v0xeRhjcugydODzvb3mEM9SQ0HGp9s/nh3COQ/C30=
 golang.org/x/crypto v0.22.0/go.mod h1:vr6Su+7cTlO45qkww3VDJlzDn0ctJvRgYbC2NvXHt+M=
-golang.org/x/exp v0.0.0-20221205204356-47842c84f3db h1:D/cFflL63o2KSLJIwjlcIt8PR064j/xsmdEJL/YvY/o=
-golang.org/x/exp v0.0.0-20221205204356-47842c84f3db/go.mod h1:CxIveKay+FTh1D0yPZemJVgC/95VzuuOLq5Qi4xnoYc=
+golang.org/x/exp v0.0.0-20240416160154-fe59bbe5cc7f h1:99ci1mjWVBWwJiEKYY6jWa4d2nTQVIEhZIptnrVb1XY=
+golang.org/x/exp v0.0.0-20240416160154-fe59bbe5cc7f/go.mod h1:/lliqkxwWAhPjf5oSOIJup2XcqJaw8RGS6k3TGEc7GI=
 golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
 golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
-golang.org/x/mod v0.11.0 h1:bUO06HqtnRcc/7l71XBe4WcqTZ+3AH1J59zWDDwLKgU=
-golang.org/x/mod v0.11.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
+golang.org/x/mod v0.17.0 h1:zY54UmvipHiNd+pm+m0x9KhZ9hl1/7QNMyxXbc6ICqA=
+golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
 golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
 golang.org/x/net v0.0.0-20200226121028-0de0cce0169b/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
 golang.org/x/net v0.0.0-20201021035429-f5854403a974/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU=
-golang.org/x/net v0.21.0 h1:AQyQV4dYCvJ7vGmJyKki9+PBdyvhkSd8EIx/qb0AYv4=
-golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
+golang.org/x/net v0.24.0 h1:1PcaxkF854Fu3+lvBIx5SYn9wRlBzzcnHZSiaFFAb0w=
+golang.org/x/net v0.24.0/go.mod h1:2Q7sJY5mzlzWjKtYUEXSlBWCdyaioyXzRB2RtU8KVE8=
 golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
-golang.org/x/sys v0.0.0-20191204072324-ce4227a45e2e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20221010170243-090e33056c14/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.19.0 h1:q5f1RH2jigJ1MoAWp2KTp3gm5zAGFUTarQZ5U386+4o=
 golang.org/x/sys v0.19.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
@@ -107,16 +102,14 @@ golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGm
 golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
 golang.org/x/tools v0.0.0-20200619180055-7c47624df98f/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE=
 golang.org/x/tools v0.0.0-20210106214847-113979e3529a/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA=
-golang.org/x/tools v0.9.1 h1:8WMNJAz3zrtPmnYC7ISf5dEn3MT0gY7jBJfw27yrrLo=
-golang.org/x/tools v0.9.1/go.mod h1:owI94Op576fPu3cIGQeHs3joujW/2Oc6MtlxbF5dfNc=
+golang.org/x/tools v0.20.0 h1:hz/CVckiOxybQvFw6h7b/q80NTr9IUQb4s1IIzW7KNY=
+golang.org/x/tools v0.20.0/go.mod h1:WvitBU7JJf6A4jOdg4S1tviW9bhUxkgeCui/0JHctQg=
 golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 golang.org/x/xerrors v0.0.0-20200804184101-5ec99f83aff1/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
-google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw=
-google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc=
-google.golang.org/protobuf v1.31.0 h1:g0LDEJHgrBl9N9r17Ru3sqWhkIx2NB67okBHPwC7hs8=
-google.golang.org/protobuf v1.31.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
+google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI=
+google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos=
 gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
 gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
diff --git a/vendor/github.com/cespare/xxhash/v2/README.md b/vendor/github.com/cespare/xxhash/v2/README.md
index 8bf0e5b78..33c88305c 100644
--- a/vendor/github.com/cespare/xxhash/v2/README.md
+++ b/vendor/github.com/cespare/xxhash/v2/README.md
@@ -70,3 +70,5 @@ benchstat <(go test -benchtime 500ms -count 15 -bench 'Sum64$')
 - [VictoriaMetrics](https://github.com/VictoriaMetrics/VictoriaMetrics)
 - [FreeCache](https://github.com/coocood/freecache)
 - [FastCache](https://github.com/VictoriaMetrics/fastcache)
+- [Ristretto](https://github.com/dgraph-io/ristretto)
+- [Badger](https://github.com/dgraph-io/badger)
diff --git a/vendor/github.com/cespare/xxhash/v2/xxhash.go b/vendor/github.com/cespare/xxhash/v2/xxhash.go
index a9e0d45c9..78bddf1ce 100644
--- a/vendor/github.com/cespare/xxhash/v2/xxhash.go
+++ b/vendor/github.com/cespare/xxhash/v2/xxhash.go
@@ -19,10 +19,13 @@ const (
 // Store the primes in an array as well.
 //
 // The consts are used when possible in Go code to avoid MOVs but we need a
-// contiguous array of the assembly code.
+// contiguous array for the assembly code.
 var primes = [...]uint64{prime1, prime2, prime3, prime4, prime5}
 
 // Digest implements hash.Hash64.
+//
+// Note that a zero-valued Digest is not ready to receive writes.
+// Call Reset or create a Digest using New before calling other methods.
 type Digest struct {
 	v1    uint64
 	v2    uint64
@@ -33,19 +36,31 @@ type Digest struct {
 	n     int // how much of mem is used
 }
 
-// New creates a new Digest that computes the 64-bit xxHash algorithm.
+// New creates a new Digest with a zero seed.
 func New() *Digest {
+	return NewWithSeed(0)
+}
+
+// NewWithSeed creates a new Digest with the given seed.
+func NewWithSeed(seed uint64) *Digest {
 	var d Digest
-	d.Reset()
+	d.ResetWithSeed(seed)
 	return &d
 }
 
 // Reset clears the Digest's state so that it can be reused.
+// It uses a seed value of zero.
 func (d *Digest) Reset() {
-	d.v1 = primes[0] + prime2
-	d.v2 = prime2
-	d.v3 = 0
-	d.v4 = -primes[0]
+	d.ResetWithSeed(0)
+}
+
+// ResetWithSeed clears the Digest's state so that it can be reused.
+// It uses the given seed to initialize the state.
+func (d *Digest) ResetWithSeed(seed uint64) {
+	d.v1 = seed + prime1 + prime2
+	d.v2 = seed + prime2
+	d.v3 = seed
+	d.v4 = seed - prime1
 	d.total = 0
 	d.n = 0
 }
diff --git a/vendor/github.com/cespare/xxhash/v2/xxhash_asm.go b/vendor/github.com/cespare/xxhash/v2/xxhash_asm.go
index 9216e0a40..78f95f256 100644
--- a/vendor/github.com/cespare/xxhash/v2/xxhash_asm.go
+++ b/vendor/github.com/cespare/xxhash/v2/xxhash_asm.go
@@ -6,7 +6,7 @@
 
 package xxhash
 
-// Sum64 computes the 64-bit xxHash digest of b.
+// Sum64 computes the 64-bit xxHash digest of b with a zero seed.
 //
 //go:noescape
 func Sum64(b []byte) uint64
diff --git a/vendor/github.com/cespare/xxhash/v2/xxhash_other.go b/vendor/github.com/cespare/xxhash/v2/xxhash_other.go
index 26df13bba..118e49e81 100644
--- a/vendor/github.com/cespare/xxhash/v2/xxhash_other.go
+++ b/vendor/github.com/cespare/xxhash/v2/xxhash_other.go
@@ -3,7 +3,7 @@
 
 package xxhash
 
-// Sum64 computes the 64-bit xxHash digest of b.
+// Sum64 computes the 64-bit xxHash digest of b with a zero seed.
 func Sum64(b []byte) uint64 {
 	// A simpler version would be
 	//   d := New()
diff --git a/vendor/github.com/cespare/xxhash/v2/xxhash_safe.go b/vendor/github.com/cespare/xxhash/v2/xxhash_safe.go
index e86f1b5fd..05f5e7dfe 100644
--- a/vendor/github.com/cespare/xxhash/v2/xxhash_safe.go
+++ b/vendor/github.com/cespare/xxhash/v2/xxhash_safe.go
@@ -5,7 +5,7 @@
 
 package xxhash
 
-// Sum64String computes the 64-bit xxHash digest of s.
+// Sum64String computes the 64-bit xxHash digest of s with a zero seed.
 func Sum64String(s string) uint64 {
 	return Sum64([]byte(s))
 }
diff --git a/vendor/github.com/cespare/xxhash/v2/xxhash_unsafe.go b/vendor/github.com/cespare/xxhash/v2/xxhash_unsafe.go
index 1c1638fd8..cf9d42aed 100644
--- a/vendor/github.com/cespare/xxhash/v2/xxhash_unsafe.go
+++ b/vendor/github.com/cespare/xxhash/v2/xxhash_unsafe.go
@@ -33,7 +33,7 @@ import (
 //
 // See https://github.com/golang/go/issues/42739 for discussion.
 
-// Sum64String computes the 64-bit xxHash digest of s.
+// Sum64String computes the 64-bit xxHash digest of s with a zero seed.
 // It may be faster than Sum64([]byte(s)) by avoiding a copy.
 func Sum64String(s string) uint64 {
 	b := *(*[]byte)(unsafe.Pointer(&sliceHeader{s, len(s)}))
diff --git a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go
index b48005673..42bf32aab 100644
--- a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go
+++ b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go
@@ -9,6 +9,8 @@ func Render(doc []byte) []byte {
 	renderer := NewRoffRenderer()
 
 	return blackfriday.Run(doc,
-		[]blackfriday.Option{blackfriday.WithRenderer(renderer),
-			blackfriday.WithExtensions(renderer.GetExtensions())}...)
+		[]blackfriday.Option{
+			blackfriday.WithRenderer(renderer),
+			blackfriday.WithExtensions(renderer.GetExtensions()),
+		}...)
 }
diff --git a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go
index be2b34360..8a290f197 100644
--- a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go
+++ b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go
@@ -1,6 +1,8 @@
 package md2man
 
 import (
+	"bufio"
+	"bytes"
 	"fmt"
 	"io"
 	"os"
@@ -20,34 +22,35 @@ type roffRenderer struct {
 }
 
 const (
-	titleHeader      = ".TH "
-	topLevelHeader   = "\n\n.SH "
-	secondLevelHdr   = "\n.SH "
-	otherHeader      = "\n.SS "
-	crTag            = "\n"
-	emphTag          = "\\fI"
-	emphCloseTag     = "\\fP"
-	strongTag        = "\\fB"
-	strongCloseTag   = "\\fP"
-	breakTag         = "\n.br\n"
-	paraTag          = "\n.PP\n"
-	hruleTag         = "\n.ti 0\n\\l'\\n(.lu'\n"
-	linkTag          = "\n\\[la]"
-	linkCloseTag     = "\\[ra]"
-	codespanTag      = "\\fB\\fC"
-	codespanCloseTag = "\\fR"
-	codeTag          = "\n.PP\n.RS\n\n.nf\n"
-	codeCloseTag     = "\n.fi\n.RE\n"
-	quoteTag         = "\n.PP\n.RS\n"
-	quoteCloseTag    = "\n.RE\n"
-	listTag          = "\n.RS\n"
-	listCloseTag     = "\n.RE\n"
-	dtTag            = "\n.TP\n"
-	dd2Tag           = "\n"
-	tableStart       = "\n.TS\nallbox;\n"
-	tableEnd         = ".TE\n"
-	tableCellStart   = "T{\n"
-	tableCellEnd     = "\nT}\n"
+	titleHeader       = ".TH "
+	topLevelHeader    = "\n\n.SH "
+	secondLevelHdr    = "\n.SH "
+	otherHeader       = "\n.SS "
+	crTag             = "\n"
+	emphTag           = "\\fI"
+	emphCloseTag      = "\\fP"
+	strongTag         = "\\fB"
+	strongCloseTag    = "\\fP"
+	breakTag          = "\n.br\n"
+	paraTag           = "\n.PP\n"
+	hruleTag          = "\n.ti 0\n\\l'\\n(.lu'\n"
+	linkTag           = "\n\\[la]"
+	linkCloseTag      = "\\[ra]"
+	codespanTag       = "\\fB"
+	codespanCloseTag  = "\\fR"
+	codeTag           = "\n.EX\n"
+	codeCloseTag      = ".EE\n" // Do not prepend a newline character since code blocks, by definition, include a newline already (or at least as how blackfriday gives us on).
+	quoteTag          = "\n.PP\n.RS\n"
+	quoteCloseTag     = "\n.RE\n"
+	listTag           = "\n.RS\n"
+	listCloseTag      = "\n.RE\n"
+	dtTag             = "\n.TP\n"
+	dd2Tag            = "\n"
+	tableStart        = "\n.TS\nallbox;\n"
+	tableEnd          = ".TE\n"
+	tableCellStart    = "T{\n"
+	tableCellEnd      = "\nT}\n"
+	tablePreprocessor = `'\" t`
 )
 
 // NewRoffRenderer creates a new blackfriday Renderer for generating roff documents
@@ -74,6 +77,16 @@ func (r *roffRenderer) GetExtensions() blackfriday.Extensions {
 
 // RenderHeader handles outputting the header at document start
 func (r *roffRenderer) RenderHeader(w io.Writer, ast *blackfriday.Node) {
+	// We need to walk the tree to check if there are any tables.
+	// If there are, we need to enable the roff table preprocessor.
+	ast.Walk(func(node *blackfriday.Node, entering bool) blackfriday.WalkStatus {
+		if node.Type == blackfriday.Table {
+			out(w, tablePreprocessor+"\n")
+			return blackfriday.Terminate
+		}
+		return blackfriday.GoToNext
+	})
+
 	// disable hyphenation
 	out(w, ".nh\n")
 }
@@ -86,8 +99,7 @@ func (r *roffRenderer) RenderFooter(w io.Writer, ast *blackfriday.Node) {
 // RenderNode is called for each node in a markdown document; based on the node
 // type the equivalent roff output is sent to the writer
 func (r *roffRenderer) RenderNode(w io.Writer, node *blackfriday.Node, entering bool) blackfriday.WalkStatus {
-
-	var walkAction = blackfriday.GoToNext
+	walkAction := blackfriday.GoToNext
 
 	switch node.Type {
 	case blackfriday.Text:
@@ -109,9 +121,16 @@ func (r *roffRenderer) RenderNode(w io.Writer, node *blackfriday.Node, entering
 			out(w, strongCloseTag)
 		}
 	case blackfriday.Link:
-		if !entering {
-			out(w, linkTag+string(node.LinkData.Destination)+linkCloseTag)
+		// Don't render the link text for automatic links, because this
+		// will only duplicate the URL in the roff output.
+		// See https://daringfireball.net/projects/markdown/syntax#autolink
+		if !bytes.Equal(node.LinkData.Destination, node.FirstChild.Literal) {
+			out(w, string(node.FirstChild.Literal))
 		}
+		// Hyphens in a link must be escaped to avoid word-wrap in the rendered man page.
+		escapedLink := strings.ReplaceAll(string(node.LinkData.Destination), "-", "\\-")
+		out(w, linkTag+escapedLink+linkCloseTag)
+		walkAction = blackfriday.SkipChildren
 	case blackfriday.Image:
 		// ignore images
 		walkAction = blackfriday.SkipChildren
@@ -160,6 +179,11 @@ func (r *roffRenderer) RenderNode(w io.Writer, node *blackfriday.Node, entering
 		r.handleTableCell(w, node, entering)
 	case blackfriday.HTMLSpan:
 		// ignore other HTML tags
+	case blackfriday.HTMLBlock:
+		if bytes.HasPrefix(node.Literal, []byte("<!--")) {
+			break // ignore comments, no warning
+		}
+		fmt.Fprintln(os.Stderr, "WARNING: go-md2man does not handle node type "+node.Type.String())
 	default:
 		fmt.Fprintln(os.Stderr, "WARNING: go-md2man does not handle node type "+node.Type.String())
 	}
@@ -254,7 +278,7 @@ func (r *roffRenderer) handleTableCell(w io.Writer, node *blackfriday.Node, ente
 			start = "\t"
 		}
 		if node.IsHeader {
-			start += codespanTag
+			start += strongTag
 		} else if nodeLiteralSize(node) > 30 {
 			start += tableCellStart
 		}
@@ -262,7 +286,7 @@ func (r *roffRenderer) handleTableCell(w io.Writer, node *blackfriday.Node, ente
 	} else {
 		var end string
 		if node.IsHeader {
-			end = codespanCloseTag
+			end = strongCloseTag
 		} else if nodeLiteralSize(node) > 30 {
 			end = tableCellEnd
 		}
@@ -310,6 +334,28 @@ func out(w io.Writer, output string) {
 }
 
 func escapeSpecialChars(w io.Writer, text []byte) {
+	scanner := bufio.NewScanner(bytes.NewReader(text))
+
+	// count the number of lines in the text
+	// we need to know this to avoid adding a newline after the last line
+	n := bytes.Count(text, []byte{'\n'})
+	idx := 0
+
+	for scanner.Scan() {
+		dt := scanner.Bytes()
+		if idx < n {
+			idx++
+			dt = append(dt, '\n')
+		}
+		escapeSpecialCharsLine(w, dt)
+	}
+
+	if err := scanner.Err(); err != nil {
+		panic(err)
+	}
+}
+
+func escapeSpecialCharsLine(w io.Writer, text []byte) {
 	for i := 0; i < len(text); i++ {
 		// escape initial apostrophe or period
 		if len(text) >= 1 && (text[0] == '\'' || text[0] == '.') {
diff --git a/vendor/github.com/golang/glog/glog.go b/vendor/github.com/golang/glog/glog.go
index dd0ed1015..8c00e737a 100644
--- a/vendor/github.com/golang/glog/glog.go
+++ b/vendor/github.com/golang/glog/glog.go
@@ -15,8 +15,26 @@
 // limitations under the License.
 
 // Package glog implements logging analogous to the Google-internal C++ INFO/ERROR/V setup.
-// It provides functions Info, Warning, Error, Fatal, plus formatting variants such as
-// Infof. It also provides V-style logging controlled by the -v and -vmodule=file=2 flags.
+// It provides functions that have a name matched by regex:
+//
+//	(Info|Warning|Error|Fatal)(Context)?(Depth)?(f)?
+//
+// If Context is present, function takes context.Context argument. The
+// context is used to pass through the Trace Context to log sinks that can make use
+// of it.
+// It is recommended to use the context variant of the functions over the non-context
+// variants if a context is available to make sure the Trace Contexts are present
+// in logs.
+//
+// If Depth is present, this function calls log from a different depth in the call stack.
+// This enables a callee to emit logs that use the callsite information of its caller
+// or any other callers in the stack. When depth == 0, the original callee's line
+// information is emitted. When depth > 0, depth frames are skipped in the call stack
+// and the final frame is treated like the original callee to Info.
+//
+// If 'f' is present, function formats according to a format specifier.
+//
+// This package also provides V-style logging controlled by the -v and -vmodule=file=2 flags.
 //
 // Basic examples:
 //
@@ -82,6 +100,7 @@ package glog
 
 import (
 	"bytes"
+	"context"
 	"errors"
 	"fmt"
 	stdLog "log"
@@ -182,9 +201,14 @@ func appendBacktrace(depth int, format string, args []any) (string, []any) {
 	return format, args
 }
 
-// logf writes a log message for a log function call (or log function wrapper)
-// at the given depth in the current goroutine's stack.
+// logf acts as ctxlogf, but doesn't expect a context.
 func logf(depth int, severity logsink.Severity, verbose bool, stack stack, format string, args ...any) {
+	ctxlogf(nil, depth+1, severity, verbose, stack, format, args...)
+}
+
+// ctxlogf writes a log message for a log function call (or log function wrapper)
+// at the given depth in the current goroutine's stack.
+func ctxlogf(ctx context.Context, depth int, severity logsink.Severity, verbose bool, stack stack, format string, args ...any) {
 	now := timeNow()
 	_, file, line, ok := runtime.Caller(depth + 1)
 	if !ok {
@@ -198,6 +222,7 @@ func logf(depth int, severity logsink.Severity, verbose bool, stack stack, forma
 
 	metai, meta := metaPoolGet()
 	*meta = logsink.Meta{
+		Context:  ctx,
 		Time:     now,
 		File:     file,
 		Line:     line,
@@ -207,6 +232,9 @@ func logf(depth int, severity logsink.Severity, verbose bool, stack stack, forma
 		Thread:   int64(pid),
 	}
 	sinkf(meta, format, args...)
+	// Clear pointer fields so they can be garbage collected early.
+	meta.Context = nil
+	meta.Stack = nil
 	metaPool.Put(metai)
 }
 
@@ -418,6 +446,36 @@ func (v Verbose) Infof(format string, args ...any) {
 	}
 }
 
+// InfoContext is equivalent to the global InfoContext function, guarded by the value of v.
+// See the documentation of V for usage.
+func (v Verbose) InfoContext(ctx context.Context, args ...any) {
+	v.InfoContextDepth(ctx, 1, args...)
+}
+
+// InfoContextf is equivalent to the global InfoContextf function, guarded by the value of v.
+// See the documentation of V for usage.
+func (v Verbose) InfoContextf(ctx context.Context, format string, args ...any) {
+	if v {
+		ctxlogf(ctx, 1, logsink.Info, true, noStack, format, args...)
+	}
+}
+
+// InfoContextDepth is equivalent to the global InfoContextDepth function, guarded by the value of v.
+// See the documentation of V for usage.
+func (v Verbose) InfoContextDepth(ctx context.Context, depth int, args ...any) {
+	if v {
+		ctxlogf(ctx, depth+1, logsink.Info, true, noStack, defaultFormat(args), args...)
+	}
+}
+
+// InfoContextDepthf is equivalent to the global InfoContextDepthf function, guarded by the value of v.
+// See the documentation of V for usage.
+func (v Verbose) InfoContextDepthf(ctx context.Context, depth int, format string, args ...any) {
+	if v {
+		ctxlogf(ctx, depth+1, logsink.Info, true, noStack, format, args...)
+	}
+}
+
 // Info logs to the INFO log.
 // Arguments are handled in the manner of fmt.Print; a newline is appended if missing.
 func Info(args ...any) {
@@ -450,6 +508,30 @@ func Infof(format string, args ...any) {
 	logf(1, logsink.Info, false, noStack, format, args...)
 }
 
+// InfoContext is like [Info], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func InfoContext(ctx context.Context, args ...any) {
+	InfoContextDepth(ctx, 1, args...)
+}
+
+// InfoContextf is like [Infof], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func InfoContextf(ctx context.Context, format string, args ...any) {
+	ctxlogf(ctx, 1, logsink.Info, false, noStack, format, args...)
+}
+
+// InfoContextDepth is like [InfoDepth], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func InfoContextDepth(ctx context.Context, depth int, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Info, false, noStack, defaultFormat(args), args...)
+}
+
+// InfoContextDepthf is like [InfoDepthf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func InfoContextDepthf(ctx context.Context, depth int, format string, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Info, false, noStack, format, args...)
+}
+
 // Warning logs to the WARNING and INFO logs.
 // Arguments are handled in the manner of fmt.Print; a newline is appended if missing.
 func Warning(args ...any) {
@@ -480,6 +562,30 @@ func Warningf(format string, args ...any) {
 	logf(1, logsink.Warning, false, noStack, format, args...)
 }
 
+// WarningContext is like [Warning], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func WarningContext(ctx context.Context, args ...any) {
+	WarningContextDepth(ctx, 1, args...)
+}
+
+// WarningContextf is like [Warningf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func WarningContextf(ctx context.Context, format string, args ...any) {
+	ctxlogf(ctx, 1, logsink.Warning, false, noStack, format, args...)
+}
+
+// WarningContextDepth is like [WarningDepth], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func WarningContextDepth(ctx context.Context, depth int, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Warning, false, noStack, defaultFormat(args), args...)
+}
+
+// WarningContextDepthf is like [WarningDepthf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func WarningContextDepthf(ctx context.Context, depth int, format string, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Warning, false, noStack, format, args...)
+}
+
 // Error logs to the ERROR, WARNING, and INFO logs.
 // Arguments are handled in the manner of fmt.Print; a newline is appended if missing.
 func Error(args ...any) {
@@ -510,8 +616,32 @@ func Errorf(format string, args ...any) {
 	logf(1, logsink.Error, false, noStack, format, args...)
 }
 
-func fatalf(depth int, format string, args ...any) {
-	logf(depth+1, logsink.Fatal, false, withStack, format, args...)
+// ErrorContext is like [Error], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ErrorContext(ctx context.Context, args ...any) {
+	ErrorContextDepth(ctx, 1, args...)
+}
+
+// ErrorContextf is like [Errorf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ErrorContextf(ctx context.Context, format string, args ...any) {
+	ctxlogf(ctx, 1, logsink.Error, false, noStack, format, args...)
+}
+
+// ErrorContextDepth is like [ErrorDepth], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ErrorContextDepth(ctx context.Context, depth int, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Error, false, noStack, defaultFormat(args), args...)
+}
+
+// ErrorContextDepthf is like [ErrorDepthf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ErrorContextDepthf(ctx context.Context, depth int, format string, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Error, false, noStack, format, args...)
+}
+
+func ctxfatalf(ctx context.Context, depth int, format string, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Fatal, false, withStack, format, args...)
 	sinks.file.Flush()
 
 	err := abortProcess() // Should not return.
@@ -523,6 +653,10 @@ func fatalf(depth int, format string, args ...any) {
 	os.Exit(2) // Exit with the same code as the default SIGABRT handler.
 }
 
+func fatalf(depth int, format string, args ...any) {
+	ctxfatalf(nil, depth+1, format, args...)
+}
+
 // Fatal logs to the FATAL, ERROR, WARNING, and INFO logs,
 // including a stack trace of all running goroutines, then calls os.Exit(2).
 // Arguments are handled in the manner of fmt.Print; a newline is appended if missing.
@@ -556,12 +690,39 @@ func Fatalf(format string, args ...any) {
 	fatalf(1, format, args...)
 }
 
-func exitf(depth int, format string, args ...any) {
-	logf(depth+1, logsink.Fatal, false, noStack, format, args...)
+// FatalContext is like [Fatal], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func FatalContext(ctx context.Context, args ...any) {
+	FatalContextDepth(ctx, 1, args...)
+}
+
+// FatalContextf is like [Fatalf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func FatalContextf(ctx context.Context, format string, args ...any) {
+	ctxfatalf(ctx, 1, format, args...)
+}
+
+// FatalContextDepth is like [FatalDepth], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func FatalContextDepth(ctx context.Context, depth int, args ...any) {
+	ctxfatalf(ctx, depth+1, defaultFormat(args), args...)
+}
+
+// FatalContextDepthf is like [FatalDepthf], but with an extra [context.Context] parameter.
+func FatalContextDepthf(ctx context.Context, depth int, format string, args ...any) {
+	ctxfatalf(ctx, depth+1, format, args...)
+}
+
+func ctxexitf(ctx context.Context, depth int, format string, args ...any) {
+	ctxlogf(ctx, depth+1, logsink.Fatal, false, noStack, format, args...)
 	sinks.file.Flush()
 	os.Exit(1)
 }
 
+func exitf(depth int, format string, args ...any) {
+	ctxexitf(nil, depth+1, format, args...)
+}
+
 // Exit logs to the FATAL, ERROR, WARNING, and INFO logs, then calls os.Exit(1).
 // Arguments are handled in the manner of fmt.Print; a newline is appended if missing.
 func Exit(args ...any) {
@@ -590,3 +751,27 @@ func Exitln(args ...any) {
 func Exitf(format string, args ...any) {
 	exitf(1, format, args...)
 }
+
+// ExitContext is like [Exit], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ExitContext(ctx context.Context, args ...any) {
+	ExitContextDepth(ctx, 1, args...)
+}
+
+// ExitContextf is like [Exitf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ExitContextf(ctx context.Context, format string, args ...any) {
+	ctxexitf(ctx, 1, format, args...)
+}
+
+// ExitContextDepth is like [ExitDepth], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ExitContextDepth(ctx context.Context, depth int, args ...any) {
+	ctxexitf(ctx, depth+1, defaultFormat(args), args...)
+}
+
+// ExitContextDepthf is like [ExitDepthf], but with an extra [context.Context] parameter. The
+// context is used to pass the Trace Context to log sinks.
+func ExitContextDepthf(ctx context.Context, depth int, format string, args ...any) {
+	ctxexitf(ctx, depth+1, format, args...)
+}
diff --git a/vendor/github.com/golang/glog/glog_file.go b/vendor/github.com/golang/glog/glog_file.go
index a2e8439b2..a1551dbc8 100644
--- a/vendor/github.com/golang/glog/glog_file.go
+++ b/vendor/github.com/golang/glog/glog_file.go
@@ -132,6 +132,11 @@ func create(tag string, t time.Time) (f *os.File, filename string, err error) {
 			symlink := filepath.Join(dir, link)
 			os.Remove(symlink)        // ignore err
 			os.Symlink(name, symlink) // ignore err
+			if *logLink != "" {
+				lsymlink := filepath.Join(*logLink, link)
+				os.Remove(lsymlink)         // ignore err
+				os.Symlink(fname, lsymlink) // ignore err
+			}
 			return f, fname, nil
 		}
 		lastErr = err
@@ -364,9 +369,6 @@ func (s *fileSink) Flush() error {
 
 // flush flushes all logs of severity threshold or greater.
 func (s *fileSink) flush(threshold logsink.Severity) error {
-	s.mu.Lock()
-	defer s.mu.Unlock()
-
 	var firstErr error
 	updateErr := func(err error) {
 		if err != nil && firstErr == nil {
@@ -374,13 +376,23 @@ func (s *fileSink) flush(threshold logsink.Severity) error {
 		}
 	}
 
-	// Flush from fatal down, in case there's trouble flushing.
-	for sev := logsink.Fatal; sev >= threshold; sev-- {
-		file := s.file[sev]
-		if file != nil {
-			updateErr(file.Flush())
-			updateErr(file.Sync())
+	// Remember where we flushed, so we can call sync without holding
+	// the lock.
+	var files []flushSyncWriter
+	func() {
+		s.mu.Lock()
+		defer s.mu.Unlock()
+		// Flush from fatal down, in case there's trouble flushing.
+		for sev := logsink.Fatal; sev >= threshold; sev-- {
+			if file := s.file[sev]; file != nil {
+				updateErr(file.Flush())
+				files = append(files, file)
+			}
 		}
+	}()
+
+	for _, file := range files {
+		updateErr(file.Sync())
 	}
 
 	return firstErr
diff --git a/vendor/github.com/golang/glog/internal/logsink/logsink.go b/vendor/github.com/golang/glog/internal/logsink/logsink.go
index 53758e1c9..28c38a6ab 100644
--- a/vendor/github.com/golang/glog/internal/logsink/logsink.go
+++ b/vendor/github.com/golang/glog/internal/logsink/logsink.go
@@ -16,6 +16,7 @@ package logsink
 
 import (
 	"bytes"
+	"context"
 	"fmt"
 	"strconv"
 	"strings"
@@ -77,6 +78,11 @@ func ParseSeverity(name string) (Severity, error) {
 
 // Meta is metadata about a logging call.
 type Meta struct {
+	// The context with which the log call was made (or nil). If set, the context
+	// is only valid during the logsink.Structured.Printf call, it should not be
+	// retained.
+	Context context.Context
+
 	// Time is the time at which the log call was made.
 	Time time.Time
 
diff --git a/vendor/github.com/google/pprof/profile/encode.go b/vendor/github.com/google/pprof/profile/encode.go
index ab7f03ae2..860bb304c 100644
--- a/vendor/github.com/google/pprof/profile/encode.go
+++ b/vendor/github.com/google/pprof/profile/encode.go
@@ -17,6 +17,7 @@ package profile
 import (
 	"errors"
 	"sort"
+	"strings"
 )
 
 func (p *Profile) decoder() []decoder {
@@ -183,12 +184,13 @@ var profileDecoder = []decoder{
 	// repeated Location location = 4
 	func(b *buffer, m message) error {
 		x := new(Location)
-		x.Line = make([]Line, 0, 8) // Pre-allocate Line buffer
+		x.Line = b.tmpLines[:0] // Use shared space temporarily
 		pp := m.(*Profile)
 		pp.Location = append(pp.Location, x)
 		err := decodeMessage(b, x)
-		var tmp []Line
-		x.Line = append(tmp, x.Line...) // Shrink to allocated size
+		b.tmpLines = x.Line[:0]
+		// Copy to shrink size and detach from shared space.
+		x.Line = append([]Line(nil), x.Line...)
 		return err
 	},
 	// repeated Function function = 5
@@ -252,6 +254,14 @@ func (p *Profile) postDecode() error {
 		} else {
 			mappings[m.ID] = m
 		}
+
+		// If this a main linux kernel mapping with a relocation symbol suffix
+		// ("[kernel.kallsyms]_text"), extract said suffix.
+		// It is fairly hacky to handle at this level, but the alternatives appear even worse.
+		const prefix = "[kernel.kallsyms]"
+		if strings.HasPrefix(m.File, prefix) {
+			m.KernelRelocationSymbol = m.File[len(prefix):]
+		}
 	}
 
 	functions := make(map[uint64]*Function, len(p.Function))
@@ -298,41 +308,52 @@ func (p *Profile) postDecode() error {
 		st.Unit, err = getString(p.stringTable, &st.unitX, err)
 	}
 
+	// Pre-allocate space for all locations.
+	numLocations := 0
+	for _, s := range p.Sample {
+		numLocations += len(s.locationIDX)
+	}
+	locBuffer := make([]*Location, numLocations)
+
 	for _, s := range p.Sample {
-		labels := make(map[string][]string, len(s.labelX))
-		numLabels := make(map[string][]int64, len(s.labelX))
-		numUnits := make(map[string][]string, len(s.labelX))
-		for _, l := range s.labelX {
-			var key, value string
-			key, err = getString(p.stringTable, &l.keyX, err)
-			if l.strX != 0 {
-				value, err = getString(p.stringTable, &l.strX, err)
-				labels[key] = append(labels[key], value)
-			} else if l.numX != 0 || l.unitX != 0 {
-				numValues := numLabels[key]
-				units := numUnits[key]
-				if l.unitX != 0 {
-					var unit string
-					unit, err = getString(p.stringTable, &l.unitX, err)
-					units = padStringArray(units, len(numValues))
-					numUnits[key] = append(units, unit)
+		if len(s.labelX) > 0 {
+			labels := make(map[string][]string, len(s.labelX))
+			numLabels := make(map[string][]int64, len(s.labelX))
+			numUnits := make(map[string][]string, len(s.labelX))
+			for _, l := range s.labelX {
+				var key, value string
+				key, err = getString(p.stringTable, &l.keyX, err)
+				if l.strX != 0 {
+					value, err = getString(p.stringTable, &l.strX, err)
+					labels[key] = append(labels[key], value)
+				} else if l.numX != 0 || l.unitX != 0 {
+					numValues := numLabels[key]
+					units := numUnits[key]
+					if l.unitX != 0 {
+						var unit string
+						unit, err = getString(p.stringTable, &l.unitX, err)
+						units = padStringArray(units, len(numValues))
+						numUnits[key] = append(units, unit)
+					}
+					numLabels[key] = append(numLabels[key], l.numX)
 				}
-				numLabels[key] = append(numLabels[key], l.numX)
 			}
-		}
-		if len(labels) > 0 {
-			s.Label = labels
-		}
-		if len(numLabels) > 0 {
-			s.NumLabel = numLabels
-			for key, units := range numUnits {
-				if len(units) > 0 {
-					numUnits[key] = padStringArray(units, len(numLabels[key]))
+			if len(labels) > 0 {
+				s.Label = labels
+			}
+			if len(numLabels) > 0 {
+				s.NumLabel = numLabels
+				for key, units := range numUnits {
+					if len(units) > 0 {
+						numUnits[key] = padStringArray(units, len(numLabels[key]))
+					}
 				}
+				s.NumUnit = numUnits
 			}
-			s.NumUnit = numUnits
 		}
-		s.Location = make([]*Location, len(s.locationIDX))
+
+		s.Location = locBuffer[:len(s.locationIDX)]
+		locBuffer = locBuffer[len(s.locationIDX):]
 		for i, lid := range s.locationIDX {
 			if lid < uint64(len(locationIds)) {
 				s.Location[i] = locationIds[lid]
@@ -509,6 +530,7 @@ func (p *Line) decoder() []decoder {
 func (p *Line) encode(b *buffer) {
 	encodeUint64Opt(b, 1, p.functionIDX)
 	encodeInt64Opt(b, 2, p.Line)
+	encodeInt64Opt(b, 3, p.Column)
 }
 
 var lineDecoder = []decoder{
@@ -517,6 +539,8 @@ var lineDecoder = []decoder{
 	func(b *buffer, m message) error { return decodeUint64(b, &m.(*Line).functionIDX) },
 	// optional int64 line = 2
 	func(b *buffer, m message) error { return decodeInt64(b, &m.(*Line).Line) },
+	// optional int64 column = 3
+	func(b *buffer, m message) error { return decodeInt64(b, &m.(*Line).Column) },
 }
 
 func (p *Function) decoder() []decoder {
diff --git a/vendor/github.com/google/pprof/profile/filter.go b/vendor/github.com/google/pprof/profile/filter.go
index ea8e66c68..c794b9390 100644
--- a/vendor/github.com/google/pprof/profile/filter.go
+++ b/vendor/github.com/google/pprof/profile/filter.go
@@ -22,6 +22,10 @@ import "regexp"
 // samples where at least one frame matches focus but none match ignore.
 // Returns true is the corresponding regexp matched at least one sample.
 func (p *Profile) FilterSamplesByName(focus, ignore, hide, show *regexp.Regexp) (fm, im, hm, hnm bool) {
+	if focus == nil && ignore == nil && hide == nil && show == nil {
+		fm = true // Missing focus implies a match
+		return
+	}
 	focusOrIgnore := make(map[uint64]bool)
 	hidden := make(map[uint64]bool)
 	for _, l := range p.Location {
diff --git a/vendor/github.com/google/pprof/profile/legacy_java_profile.go b/vendor/github.com/google/pprof/profile/legacy_java_profile.go
index 91f45e53c..4580bab18 100644
--- a/vendor/github.com/google/pprof/profile/legacy_java_profile.go
+++ b/vendor/github.com/google/pprof/profile/legacy_java_profile.go
@@ -56,7 +56,7 @@ func javaCPUProfile(b []byte, period int64, parse func(b []byte) (uint64, []byte
 	}
 
 	// Strip out addresses for better merge.
-	if err = p.Aggregate(true, true, true, true, false); err != nil {
+	if err = p.Aggregate(true, true, true, true, false, false); err != nil {
 		return nil, err
 	}
 
@@ -99,7 +99,7 @@ func parseJavaProfile(b []byte) (*Profile, error) {
 	}
 
 	// Strip out addresses for better merge.
-	if err = p.Aggregate(true, true, true, true, false); err != nil {
+	if err = p.Aggregate(true, true, true, true, false, false); err != nil {
 		return nil, err
 	}
 
diff --git a/vendor/github.com/google/pprof/profile/legacy_profile.go b/vendor/github.com/google/pprof/profile/legacy_profile.go
index 0c8f3bb5b..8d07fd6c2 100644
--- a/vendor/github.com/google/pprof/profile/legacy_profile.go
+++ b/vendor/github.com/google/pprof/profile/legacy_profile.go
@@ -295,11 +295,12 @@ func get64b(b []byte) (uint64, []byte) {
 //
 // The general format for profilez samples is a sequence of words in
 // binary format. The first words are a header with the following data:
-//   1st word -- 0
-//   2nd word -- 3
-//   3rd word -- 0 if a c++ application, 1 if a java application.
-//   4th word -- Sampling period (in microseconds).
-//   5th word -- Padding.
+//
+//	1st word -- 0
+//	2nd word -- 3
+//	3rd word -- 0 if a c++ application, 1 if a java application.
+//	4th word -- Sampling period (in microseconds).
+//	5th word -- Padding.
 func parseCPU(b []byte) (*Profile, error) {
 	var parse func([]byte) (uint64, []byte)
 	var n1, n2, n3, n4, n5 uint64
@@ -403,15 +404,18 @@ func cleanupDuplicateLocations(p *Profile) {
 //
 // profilez samples are a repeated sequence of stack frames of the
 // form:
-//    1st word -- The number of times this stack was encountered.
-//    2nd word -- The size of the stack (StackSize).
-//    3rd word -- The first address on the stack.
-//    ...
-//    StackSize + 2 -- The last address on the stack
+//
+//	1st word -- The number of times this stack was encountered.
+//	2nd word -- The size of the stack (StackSize).
+//	3rd word -- The first address on the stack.
+//	...
+//	StackSize + 2 -- The last address on the stack
+//
 // The last stack trace is of the form:
-//   1st word -- 0
-//   2nd word -- 1
-//   3rd word -- 0
+//
+//	1st word -- 0
+//	2nd word -- 1
+//	3rd word -- 0
 //
 // Addresses from stack traces may point to the next instruction after
 // each call. Optionally adjust by -1 to land somewhere on the actual
@@ -861,7 +865,6 @@ func parseThread(b []byte) (*Profile, error) {
 	// Recognize each thread and populate profile samples.
 	for !isMemoryMapSentinel(line) {
 		if strings.HasPrefix(line, "---- no stack trace for") {
-			line = ""
 			break
 		}
 		if t := threadStartRE.FindStringSubmatch(line); len(t) != 4 {
diff --git a/vendor/github.com/google/pprof/profile/merge.go b/vendor/github.com/google/pprof/profile/merge.go
index 9978e7330..eee0132e7 100644
--- a/vendor/github.com/google/pprof/profile/merge.go
+++ b/vendor/github.com/google/pprof/profile/merge.go
@@ -15,6 +15,7 @@
 package profile
 
 import (
+	"encoding/binary"
 	"fmt"
 	"sort"
 	"strconv"
@@ -58,7 +59,7 @@ func Merge(srcs []*Profile) (*Profile, error) {
 
 	for _, src := range srcs {
 		// Clear the profile-specific hash tables
-		pm.locationsByID = make(map[uint64]*Location, len(src.Location))
+		pm.locationsByID = makeLocationIDMap(len(src.Location))
 		pm.functionsByID = make(map[uint64]*Function, len(src.Function))
 		pm.mappingsByID = make(map[uint64]mapInfo, len(src.Mapping))
 
@@ -136,7 +137,7 @@ type profileMerger struct {
 	p *Profile
 
 	// Memoization tables within a profile.
-	locationsByID map[uint64]*Location
+	locationsByID locationIDMap
 	functionsByID map[uint64]*Function
 	mappingsByID  map[uint64]mapInfo
 
@@ -153,6 +154,16 @@ type mapInfo struct {
 }
 
 func (pm *profileMerger) mapSample(src *Sample) *Sample {
+	// Check memoization table
+	k := pm.sampleKey(src)
+	if ss, ok := pm.samples[k]; ok {
+		for i, v := range src.Value {
+			ss.Value[i] += v
+		}
+		return ss
+	}
+
+	// Make new sample.
 	s := &Sample{
 		Location: make([]*Location, len(src.Location)),
 		Value:    make([]int64, len(src.Value)),
@@ -177,52 +188,98 @@ func (pm *profileMerger) mapSample(src *Sample) *Sample {
 		s.NumLabel[k] = vv
 		s.NumUnit[k] = uu
 	}
-	// Check memoization table. Must be done on the remapped location to
-	// account for the remapped mapping. Add current values to the
-	// existing sample.
-	k := s.key()
-	if ss, ok := pm.samples[k]; ok {
-		for i, v := range src.Value {
-			ss.Value[i] += v
-		}
-		return ss
-	}
 	copy(s.Value, src.Value)
 	pm.samples[k] = s
 	pm.p.Sample = append(pm.p.Sample, s)
 	return s
 }
 
-// key generates sampleKey to be used as a key for maps.
-func (sample *Sample) key() sampleKey {
-	ids := make([]string, len(sample.Location))
-	for i, l := range sample.Location {
-		ids[i] = strconv.FormatUint(l.ID, 16)
+func (pm *profileMerger) sampleKey(sample *Sample) sampleKey {
+	// Accumulate contents into a string.
+	var buf strings.Builder
+	buf.Grow(64) // Heuristic to avoid extra allocs
+
+	// encode a number
+	putNumber := func(v uint64) {
+		var num [binary.MaxVarintLen64]byte
+		n := binary.PutUvarint(num[:], v)
+		buf.Write(num[:n])
+	}
+
+	// encode a string prefixed with its length.
+	putDelimitedString := func(s string) {
+		putNumber(uint64(len(s)))
+		buf.WriteString(s)
+	}
+
+	for _, l := range sample.Location {
+		// Get the location in the merged profile, which may have a different ID.
+		if loc := pm.mapLocation(l); loc != nil {
+			putNumber(loc.ID)
+		}
 	}
+	putNumber(0) // Delimiter
 
-	labels := make([]string, 0, len(sample.Label))
-	for k, v := range sample.Label {
-		labels = append(labels, fmt.Sprintf("%q%q", k, v))
+	for _, l := range sortedKeys1(sample.Label) {
+		putDelimitedString(l)
+		values := sample.Label[l]
+		putNumber(uint64(len(values)))
+		for _, v := range values {
+			putDelimitedString(v)
+		}
 	}
-	sort.Strings(labels)
 
-	numlabels := make([]string, 0, len(sample.NumLabel))
-	for k, v := range sample.NumLabel {
-		numlabels = append(numlabels, fmt.Sprintf("%q%x%x", k, v, sample.NumUnit[k]))
+	for _, l := range sortedKeys2(sample.NumLabel) {
+		putDelimitedString(l)
+		values := sample.NumLabel[l]
+		putNumber(uint64(len(values)))
+		for _, v := range values {
+			putNumber(uint64(v))
+		}
+		units := sample.NumUnit[l]
+		putNumber(uint64(len(units)))
+		for _, v := range units {
+			putDelimitedString(v)
+		}
 	}
-	sort.Strings(numlabels)
 
-	return sampleKey{
-		strings.Join(ids, "|"),
-		strings.Join(labels, ""),
-		strings.Join(numlabels, ""),
+	return sampleKey(buf.String())
+}
+
+type sampleKey string
+
+// sortedKeys1 returns the sorted keys found in a string->[]string map.
+//
+// Note: this is currently non-generic since github pprof runs golint,
+// which does not support generics. When that issue is fixed, it can
+// be merged with sortedKeys2 and made into a generic function.
+func sortedKeys1(m map[string][]string) []string {
+	if len(m) == 0 {
+		return nil
 	}
+	keys := make([]string, 0, len(m))
+	for k := range m {
+		keys = append(keys, k)
+	}
+	sort.Strings(keys)
+	return keys
 }
 
-type sampleKey struct {
-	locations string
-	labels    string
-	numlabels string
+// sortedKeys2 returns the sorted keys found in a string->[]int64 map.
+//
+// Note: this is currently non-generic since github pprof runs golint,
+// which does not support generics. When that issue is fixed, it can
+// be merged with sortedKeys1 and made into a generic function.
+func sortedKeys2(m map[string][]int64) []string {
+	if len(m) == 0 {
+		return nil
+	}
+	keys := make([]string, 0, len(m))
+	for k := range m {
+		keys = append(keys, k)
+	}
+	sort.Strings(keys)
+	return keys
 }
 
 func (pm *profileMerger) mapLocation(src *Location) *Location {
@@ -230,7 +287,7 @@ func (pm *profileMerger) mapLocation(src *Location) *Location {
 		return nil
 	}
 
-	if l, ok := pm.locationsByID[src.ID]; ok {
+	if l := pm.locationsByID.get(src.ID); l != nil {
 		return l
 	}
 
@@ -249,10 +306,10 @@ func (pm *profileMerger) mapLocation(src *Location) *Location {
 	// account for the remapped mapping ID.
 	k := l.key()
 	if ll, ok := pm.locations[k]; ok {
-		pm.locationsByID[src.ID] = ll
+		pm.locationsByID.set(src.ID, ll)
 		return ll
 	}
-	pm.locationsByID[src.ID] = l
+	pm.locationsByID.set(src.ID, l)
 	pm.locations[k] = l
 	pm.p.Location = append(pm.p.Location, l)
 	return l
@@ -269,12 +326,13 @@ func (l *Location) key() locationKey {
 		key.addr -= l.Mapping.Start
 		key.mappingID = l.Mapping.ID
 	}
-	lines := make([]string, len(l.Line)*2)
+	lines := make([]string, len(l.Line)*3)
 	for i, line := range l.Line {
 		if line.Function != nil {
 			lines[i*2] = strconv.FormatUint(line.Function.ID, 16)
 		}
 		lines[i*2+1] = strconv.FormatInt(line.Line, 16)
+		lines[i*2+2] = strconv.FormatInt(line.Column, 16)
 	}
 	key.lines = strings.Join(lines, "|")
 	return key
@@ -303,16 +361,17 @@ func (pm *profileMerger) mapMapping(src *Mapping) mapInfo {
 		return mi
 	}
 	m := &Mapping{
-		ID:              uint64(len(pm.p.Mapping) + 1),
-		Start:           src.Start,
-		Limit:           src.Limit,
-		Offset:          src.Offset,
-		File:            src.File,
-		BuildID:         src.BuildID,
-		HasFunctions:    src.HasFunctions,
-		HasFilenames:    src.HasFilenames,
-		HasLineNumbers:  src.HasLineNumbers,
-		HasInlineFrames: src.HasInlineFrames,
+		ID:                     uint64(len(pm.p.Mapping) + 1),
+		Start:                  src.Start,
+		Limit:                  src.Limit,
+		Offset:                 src.Offset,
+		File:                   src.File,
+		KernelRelocationSymbol: src.KernelRelocationSymbol,
+		BuildID:                src.BuildID,
+		HasFunctions:           src.HasFunctions,
+		HasFilenames:           src.HasFilenames,
+		HasLineNumbers:         src.HasLineNumbers,
+		HasInlineFrames:        src.HasInlineFrames,
 	}
 	pm.p.Mapping = append(pm.p.Mapping, m)
 
@@ -360,6 +419,7 @@ func (pm *profileMerger) mapLine(src Line) Line {
 	ln := Line{
 		Function: pm.mapFunction(src.Function),
 		Line:     src.Line,
+		Column:   src.Column,
 	}
 	return ln
 }
@@ -479,3 +539,131 @@ func (p *Profile) compatible(pb *Profile) error {
 func equalValueType(st1, st2 *ValueType) bool {
 	return st1.Type == st2.Type && st1.Unit == st2.Unit
 }
+
+// locationIDMap is like a map[uint64]*Location, but provides efficiency for
+// ids that are densely numbered, which is often the case.
+type locationIDMap struct {
+	dense  []*Location          // indexed by id for id < len(dense)
+	sparse map[uint64]*Location // indexed by id for id >= len(dense)
+}
+
+func makeLocationIDMap(n int) locationIDMap {
+	return locationIDMap{
+		dense:  make([]*Location, n),
+		sparse: map[uint64]*Location{},
+	}
+}
+
+func (lm locationIDMap) get(id uint64) *Location {
+	if id < uint64(len(lm.dense)) {
+		return lm.dense[int(id)]
+	}
+	return lm.sparse[id]
+}
+
+func (lm locationIDMap) set(id uint64, loc *Location) {
+	if id < uint64(len(lm.dense)) {
+		lm.dense[id] = loc
+		return
+	}
+	lm.sparse[id] = loc
+}
+
+// CompatibilizeSampleTypes makes profiles compatible to be compared/merged. It
+// keeps sample types that appear in all profiles only and drops/reorders the
+// sample types as necessary.
+//
+// In the case of sample types order is not the same for given profiles the
+// order is derived from the first profile.
+//
+// Profiles are modified in-place.
+//
+// It returns an error if the sample type's intersection is empty.
+func CompatibilizeSampleTypes(ps []*Profile) error {
+	sTypes := commonSampleTypes(ps)
+	if len(sTypes) == 0 {
+		return fmt.Errorf("profiles have empty common sample type list")
+	}
+	for _, p := range ps {
+		if err := compatibilizeSampleTypes(p, sTypes); err != nil {
+			return err
+		}
+	}
+	return nil
+}
+
+// commonSampleTypes returns sample types that appear in all profiles in the
+// order how they ordered in the first profile.
+func commonSampleTypes(ps []*Profile) []string {
+	if len(ps) == 0 {
+		return nil
+	}
+	sTypes := map[string]int{}
+	for _, p := range ps {
+		for _, st := range p.SampleType {
+			sTypes[st.Type]++
+		}
+	}
+	var res []string
+	for _, st := range ps[0].SampleType {
+		if sTypes[st.Type] == len(ps) {
+			res = append(res, st.Type)
+		}
+	}
+	return res
+}
+
+// compatibilizeSampleTypes drops sample types that are not present in sTypes
+// list and reorder them if needed.
+//
+// It sets DefaultSampleType to sType[0] if it is not in sType list.
+//
+// It assumes that all sample types from the sTypes list are present in the
+// given profile otherwise it returns an error.
+func compatibilizeSampleTypes(p *Profile, sTypes []string) error {
+	if len(sTypes) == 0 {
+		return fmt.Errorf("sample type list is empty")
+	}
+	defaultSampleType := sTypes[0]
+	reMap, needToModify := make([]int, len(sTypes)), false
+	for i, st := range sTypes {
+		if st == p.DefaultSampleType {
+			defaultSampleType = p.DefaultSampleType
+		}
+		idx := searchValueType(p.SampleType, st)
+		if idx < 0 {
+			return fmt.Errorf("%q sample type is not found in profile", st)
+		}
+		reMap[i] = idx
+		if idx != i {
+			needToModify = true
+		}
+	}
+	if !needToModify && len(sTypes) == len(p.SampleType) {
+		return nil
+	}
+	p.DefaultSampleType = defaultSampleType
+	oldSampleTypes := p.SampleType
+	p.SampleType = make([]*ValueType, len(sTypes))
+	for i, idx := range reMap {
+		p.SampleType[i] = oldSampleTypes[idx]
+	}
+	values := make([]int64, len(sTypes))
+	for _, s := range p.Sample {
+		for i, idx := range reMap {
+			values[i] = s.Value[idx]
+		}
+		s.Value = s.Value[:len(values)]
+		copy(s.Value, values)
+	}
+	return nil
+}
+
+func searchValueType(vts []*ValueType, s string) int {
+	for i, vt := range vts {
+		if vt.Type == s {
+			return i
+		}
+	}
+	return -1
+}
diff --git a/vendor/github.com/google/pprof/profile/profile.go b/vendor/github.com/google/pprof/profile/profile.go
index 2590c8ddb..62df80a55 100644
--- a/vendor/github.com/google/pprof/profile/profile.go
+++ b/vendor/github.com/google/pprof/profile/profile.go
@@ -21,7 +21,6 @@ import (
 	"compress/gzip"
 	"fmt"
 	"io"
-	"io/ioutil"
 	"math"
 	"path/filepath"
 	"regexp"
@@ -73,9 +72,23 @@ type ValueType struct {
 type Sample struct {
 	Location []*Location
 	Value    []int64
-	Label    map[string][]string
+	// Label is a per-label-key map to values for string labels.
+	//
+	// In general, having multiple values for the given label key is strongly
+	// discouraged - see docs for the sample label field in profile.proto.  The
+	// main reason this unlikely state is tracked here is to make the
+	// decoding->encoding roundtrip not lossy. But we expect that the value
+	// slices present in this map are always of length 1.
+	Label map[string][]string
+	// NumLabel is a per-label-key map to values for numeric labels. See a note
+	// above on handling multiple values for a label.
 	NumLabel map[string][]int64
-	NumUnit  map[string][]string
+	// NumUnit is a per-label-key map to the unit names of corresponding numeric
+	// label values. The unit info may be missing even if the label is in
+	// NumLabel, see the docs in profile.proto for details. When the value is
+	// slice is present and not nil, its length must be equal to the length of
+	// the corresponding value slice in NumLabel.
+	NumUnit map[string][]string
 
 	locationIDX []uint64
 	labelX      []label
@@ -106,6 +119,15 @@ type Mapping struct {
 
 	fileX    int64
 	buildIDX int64
+
+	// Name of the kernel relocation symbol ("_text" or "_stext"), extracted from File.
+	// For linux kernel mappings generated by some tools, correct symbolization depends
+	// on knowing which of the two possible relocation symbols was used for `Start`.
+	// This is given to us as a suffix in `File` (e.g. "[kernel.kallsyms]_stext").
+	//
+	// Note, this public field is not persisted in the proto. For the purposes of
+	// copying / merging / hashing profiles, it is considered subsumed by `File`.
+	KernelRelocationSymbol string
 }
 
 // Location corresponds to Profile.Location
@@ -123,6 +145,7 @@ type Location struct {
 type Line struct {
 	Function *Function
 	Line     int64
+	Column   int64
 
 	functionIDX uint64
 }
@@ -144,7 +167,7 @@ type Function struct {
 // may be a gzip-compressed encoded protobuf or one of many legacy
 // profile formats which may be unsupported in the future.
 func Parse(r io.Reader) (*Profile, error) {
-	data, err := ioutil.ReadAll(r)
+	data, err := io.ReadAll(r)
 	if err != nil {
 		return nil, err
 	}
@@ -159,7 +182,7 @@ func ParseData(data []byte) (*Profile, error) {
 	if len(data) >= 2 && data[0] == 0x1f && data[1] == 0x8b {
 		gz, err := gzip.NewReader(bytes.NewBuffer(data))
 		if err == nil {
-			data, err = ioutil.ReadAll(gz)
+			data, err = io.ReadAll(gz)
 		}
 		if err != nil {
 			return nil, fmt.Errorf("decompressing profile: %v", err)
@@ -414,7 +437,7 @@ func (p *Profile) CheckValid() error {
 // Aggregate merges the locations in the profile into equivalence
 // classes preserving the request attributes. It also updates the
 // samples to point to the merged locations.
-func (p *Profile) Aggregate(inlineFrame, function, filename, linenumber, address bool) error {
+func (p *Profile) Aggregate(inlineFrame, function, filename, linenumber, columnnumber, address bool) error {
 	for _, m := range p.Mapping {
 		m.HasInlineFrames = m.HasInlineFrames && inlineFrame
 		m.HasFunctions = m.HasFunctions && function
@@ -436,7 +459,7 @@ func (p *Profile) Aggregate(inlineFrame, function, filename, linenumber, address
 	}
 
 	// Aggregate locations
-	if !inlineFrame || !address || !linenumber {
+	if !inlineFrame || !address || !linenumber || !columnnumber {
 		for _, l := range p.Location {
 			if !inlineFrame && len(l.Line) > 1 {
 				l.Line = l.Line[len(l.Line)-1:]
@@ -444,6 +467,12 @@ func (p *Profile) Aggregate(inlineFrame, function, filename, linenumber, address
 			if !linenumber {
 				for i := range l.Line {
 					l.Line[i].Line = 0
+					l.Line[i].Column = 0
+				}
+			}
+			if !columnnumber {
+				for i := range l.Line {
+					l.Line[i].Column = 0
 				}
 			}
 			if !address {
@@ -605,10 +634,11 @@ func (l *Location) string() string {
 	for li := range l.Line {
 		lnStr := "??"
 		if fn := l.Line[li].Function; fn != nil {
-			lnStr = fmt.Sprintf("%s %s:%d s=%d",
+			lnStr = fmt.Sprintf("%s %s:%d:%d s=%d",
 				fn.Name,
 				fn.Filename,
 				l.Line[li].Line,
+				l.Line[li].Column,
 				fn.StartLine)
 			if fn.Name != fn.SystemName {
 				lnStr = lnStr + "(" + fn.SystemName + ")"
@@ -707,6 +737,35 @@ func (s *Sample) HasLabel(key, value string) bool {
 	return false
 }
 
+// SetNumLabel sets the specified key to the specified value for all samples in the
+// profile. "unit" is a slice that describes the units that each corresponding member
+// of "values" is measured in (e.g. bytes or seconds).  If there is no relevant
+// unit for a given value, that member of "unit" should be the empty string.
+// "unit" must either have the same length as "value", or be nil.
+func (p *Profile) SetNumLabel(key string, value []int64, unit []string) {
+	for _, sample := range p.Sample {
+		if sample.NumLabel == nil {
+			sample.NumLabel = map[string][]int64{key: value}
+		} else {
+			sample.NumLabel[key] = value
+		}
+		if sample.NumUnit == nil {
+			sample.NumUnit = map[string][]string{key: unit}
+		} else {
+			sample.NumUnit[key] = unit
+		}
+	}
+}
+
+// RemoveNumLabel removes all numerical labels associated with the specified key for all
+// samples in the profile.
+func (p *Profile) RemoveNumLabel(key string) {
+	for _, sample := range p.Sample {
+		delete(sample.NumLabel, key)
+		delete(sample.NumUnit, key)
+	}
+}
+
 // DiffBaseSample returns true if a sample belongs to the diff base and false
 // otherwise.
 func (s *Sample) DiffBaseSample() bool {
diff --git a/vendor/github.com/google/pprof/profile/proto.go b/vendor/github.com/google/pprof/profile/proto.go
index 539ad3ab3..a15696ba1 100644
--- a/vendor/github.com/google/pprof/profile/proto.go
+++ b/vendor/github.com/google/pprof/profile/proto.go
@@ -39,11 +39,12 @@ import (
 )
 
 type buffer struct {
-	field int // field tag
-	typ   int // proto wire type code for field
-	u64   uint64
-	data  []byte
-	tmp   [16]byte
+	field    int // field tag
+	typ      int // proto wire type code for field
+	u64      uint64
+	data     []byte
+	tmp      [16]byte
+	tmpLines []Line // temporary storage used while decoding "repeated Line".
 }
 
 type decoder func(*buffer, message) error
@@ -286,7 +287,6 @@ func decodeInt64s(b *buffer, x *[]int64) error {
 	if b.typ == 2 {
 		// Packed encoding
 		data := b.data
-		tmp := make([]int64, 0, len(data)) // Maximally sized
 		for len(data) > 0 {
 			var u uint64
 			var err error
@@ -294,9 +294,8 @@ func decodeInt64s(b *buffer, x *[]int64) error {
 			if u, data, err = decodeVarint(data); err != nil {
 				return err
 			}
-			tmp = append(tmp, int64(u))
+			*x = append(*x, int64(u))
 		}
-		*x = append(*x, tmp...)
 		return nil
 	}
 	var i int64
@@ -319,7 +318,6 @@ func decodeUint64s(b *buffer, x *[]uint64) error {
 	if b.typ == 2 {
 		data := b.data
 		// Packed encoding
-		tmp := make([]uint64, 0, len(data)) // Maximally sized
 		for len(data) > 0 {
 			var u uint64
 			var err error
@@ -327,9 +325,8 @@ func decodeUint64s(b *buffer, x *[]uint64) error {
 			if u, data, err = decodeVarint(data); err != nil {
 				return err
 			}
-			tmp = append(tmp, u)
+			*x = append(*x, u)
 		}
-		*x = append(*x, tmp...)
 		return nil
 	}
 	var u uint64
diff --git a/vendor/github.com/google/pprof/profile/prune.go b/vendor/github.com/google/pprof/profile/prune.go
index 02d21a818..b2f9fd546 100644
--- a/vendor/github.com/google/pprof/profile/prune.go
+++ b/vendor/github.com/google/pprof/profile/prune.go
@@ -62,15 +62,31 @@ func (p *Profile) Prune(dropRx, keepRx *regexp.Regexp) {
 	prune := make(map[uint64]bool)
 	pruneBeneath := make(map[uint64]bool)
 
+	// simplifyFunc can be expensive, so cache results.
+	// Note that the same function name can be encountered many times due
+	// different lines and addresses in the same function.
+	pruneCache := map[string]bool{} // Map from function to whether or not to prune
+	pruneFromHere := func(s string) bool {
+		if r, ok := pruneCache[s]; ok {
+			return r
+		}
+		funcName := simplifyFunc(s)
+		if dropRx.MatchString(funcName) {
+			if keepRx == nil || !keepRx.MatchString(funcName) {
+				pruneCache[s] = true
+				return true
+			}
+		}
+		pruneCache[s] = false
+		return false
+	}
+
 	for _, loc := range p.Location {
 		var i int
 		for i = len(loc.Line) - 1; i >= 0; i-- {
 			if fn := loc.Line[i].Function; fn != nil && fn.Name != "" {
-				funcName := simplifyFunc(fn.Name)
-				if dropRx.MatchString(funcName) {
-					if keepRx == nil || !keepRx.MatchString(funcName) {
-						break
-					}
+				if pruneFromHere(fn.Name) {
+					break
 				}
 			}
 		}
diff --git a/vendor/github.com/klauspost/compress/.goreleaser.yml b/vendor/github.com/klauspost/compress/.goreleaser.yml
index 7a008a4d2..a22953805 100644
--- a/vendor/github.com/klauspost/compress/.goreleaser.yml
+++ b/vendor/github.com/klauspost/compress/.goreleaser.yml
@@ -3,7 +3,6 @@
 before:
   hooks:
     - ./gen.sh
-    - go install mvdan.cc/garble@v0.9.3
 
 builds:
   -
@@ -32,7 +31,6 @@ builds:
       - mips64le
     goarm:
       - 7
-    gobinary: garble
   -
     id: "s2d"
     binary: s2d
@@ -59,7 +57,6 @@ builds:
       - mips64le
     goarm:
       - 7
-    gobinary: garble
   -
     id: "s2sx"
     binary: s2sx
@@ -87,21 +84,11 @@ builds:
       - mips64le
     goarm:
       - 7
-    gobinary: garble
 
 archives:
   -
     id: s2-binaries
-    name_template: "s2-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
-    replacements:
-      aix: AIX
-      darwin: OSX
-      linux: Linux
-      windows: Windows
-      386: i386
-      amd64: x86_64
-      freebsd: FreeBSD
-      netbsd: NetBSD
+    name_template: "s2-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
     format_overrides:
       - goos: windows
         format: zip
@@ -125,7 +112,7 @@ changelog:
 
 nfpms:
   -
-    file_name_template: "s2_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
+    file_name_template: "s2_package__{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
     vendor: Klaus Post
     homepage: https://github.com/klauspost/compress
     maintainer: Klaus Post <klauspost@gmail.com>
@@ -134,8 +121,3 @@ nfpms:
     formats:
       - deb
       - rpm
-    replacements:
-      darwin: Darwin
-      linux: Linux
-      freebsd: FreeBSD
-      amd64: x86_64
diff --git a/vendor/github.com/klauspost/compress/README.md b/vendor/github.com/klauspost/compress/README.md
index 4002a16a6..05c7359e4 100644
--- a/vendor/github.com/klauspost/compress/README.md
+++ b/vendor/github.com/klauspost/compress/README.md
@@ -16,6 +16,54 @@ This package provides various compression algorithms.
 
 # changelog
 
+* Feb 5th, 2024 - [1.17.6](https://github.com/klauspost/compress/releases/tag/v1.17.6)
+	* zstd: Fix incorrect repeat coding in best mode https://github.com/klauspost/compress/pull/923
+	* s2: Fix DecodeConcurrent deadlock on errors https://github.com/klauspost/compress/pull/925
+  
+* Jan 26th, 2024 - [v1.17.5](https://github.com/klauspost/compress/releases/tag/v1.17.5)
+	* flate: Fix reset with dictionary on custom window encodes https://github.com/klauspost/compress/pull/912
+	* zstd: Add Frame header encoding and stripping https://github.com/klauspost/compress/pull/908
+	* zstd: Limit better/best default window to 8MB https://github.com/klauspost/compress/pull/913
+	* zstd: Speed improvements by @greatroar in https://github.com/klauspost/compress/pull/896 https://github.com/klauspost/compress/pull/910
+	* s2: Fix callbacks for skippable blocks and disallow 0xfe (Padding) by @Jille in https://github.com/klauspost/compress/pull/916 https://github.com/klauspost/compress/pull/917
+https://github.com/klauspost/compress/pull/919 https://github.com/klauspost/compress/pull/918
+
+* Dec 1st, 2023 - [v1.17.4](https://github.com/klauspost/compress/releases/tag/v1.17.4)
+	* huff0: Speed up symbol counting by @greatroar in https://github.com/klauspost/compress/pull/887
+	* huff0: Remove byteReader by @greatroar in https://github.com/klauspost/compress/pull/886
+	* gzhttp: Allow overriding decompression on transport https://github.com/klauspost/compress/pull/892
+	* gzhttp: Clamp compression level https://github.com/klauspost/compress/pull/890
+	* gzip: Error out if reserved bits are set https://github.com/klauspost/compress/pull/891
+
+* Nov 15th, 2023 - [v1.17.3](https://github.com/klauspost/compress/releases/tag/v1.17.3)
+	* fse: Fix max header size https://github.com/klauspost/compress/pull/881
+	* zstd: Improve better/best compression https://github.com/klauspost/compress/pull/877
+	* gzhttp: Fix missing content type on Close https://github.com/klauspost/compress/pull/883
+
+* Oct 22nd, 2023 - [v1.17.2](https://github.com/klauspost/compress/releases/tag/v1.17.2)
+	* zstd: Fix rare *CORRUPTION* output in "best" mode. See https://github.com/klauspost/compress/pull/876
+
+* Oct 14th, 2023 - [v1.17.1](https://github.com/klauspost/compress/releases/tag/v1.17.1)
+	* s2: Fix S2 "best" dictionary wrong encoding by @klauspost in https://github.com/klauspost/compress/pull/871
+	* flate: Reduce allocations in decompressor and minor code improvements by @fakefloordiv in https://github.com/klauspost/compress/pull/869
+	* s2: Fix EstimateBlockSize on 6&7 length input by @klauspost in https://github.com/klauspost/compress/pull/867
+
+* Sept 19th, 2023 - [v1.17.0](https://github.com/klauspost/compress/releases/tag/v1.17.0)
+	* Add experimental dictionary builder  https://github.com/klauspost/compress/pull/853
+	* Add xerial snappy read/writer https://github.com/klauspost/compress/pull/838
+	* flate: Add limited window compression https://github.com/klauspost/compress/pull/843
+	* s2: Do 2 overlapping match checks https://github.com/klauspost/compress/pull/839
+	* flate: Add amd64 assembly matchlen https://github.com/klauspost/compress/pull/837
+	* gzip: Copy bufio.Reader on Reset by @thatguystone in https://github.com/klauspost/compress/pull/860
+
+<details>
+	<summary>See changes to v1.16.x</summary>
+
+   
+* July 1st, 2023 - [v1.16.7](https://github.com/klauspost/compress/releases/tag/v1.16.7)
+	* zstd: Fix default level first dictionary encode https://github.com/klauspost/compress/pull/829
+	* s2: add GetBufferCapacity() method by @GiedriusS in https://github.com/klauspost/compress/pull/832
+
 * June 13, 2023 - [v1.16.6](https://github.com/klauspost/compress/releases/tag/v1.16.6)
 	* zstd: correctly ignore WithEncoderPadding(1) by @ianlancetaylor in https://github.com/klauspost/compress/pull/806
 	* zstd: Add amd64 match length assembly https://github.com/klauspost/compress/pull/824
@@ -49,7 +97,11 @@ This package provides various compression algorithms.
 	* s2: Add LZ4 block converter. https://github.com/klauspost/compress/pull/748
 	* s2: Support io.ReaderAt in ReadSeeker. https://github.com/klauspost/compress/pull/747
 	* s2c/s2sx: Use concurrent decoding. https://github.com/klauspost/compress/pull/746
+</details>
 
+<details>
+	<summary>See changes to v1.15.x</summary>
+	
 * Jan 21st, 2023 (v1.15.15)
 	* deflate: Improve level 7-9 by @klauspost in https://github.com/klauspost/compress/pull/739
 	* zstd: Add delta encoding support by @greatroar in https://github.com/klauspost/compress/pull/728
@@ -176,6 +228,8 @@ Stream decompression is now faster on asynchronous, since the goroutine allocati
 
 While the release has been extensively tested, it is recommended to testing when upgrading.
 
+</details>
+
 <details>
 	<summary>See changes to v1.14.x</summary>
 	
@@ -511,6 +565,8 @@ the stateless compress described below.
 
 For compression performance, see: [this spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing).
 
+To disable all assembly add `-tags=noasm`. This works across all packages.
+
 # Stateless compression
 
 This package offers stateless compression as a special option for gzip/deflate. 
@@ -529,7 +585,7 @@ For direct deflate use, NewStatelessWriter and StatelessDeflate are available. S
 
 A `bufio.Writer` can of course be used to control write sizes. For example, to use a 4KB buffer:
 
-```
+```go
 	// replace 'ioutil.Discard' with your output.
 	gzw, err := gzip.NewWriterLevel(ioutil.Discard, gzip.StatelessCompression)
 	if err != nil {
@@ -636,6 +692,8 @@ Here are other packages of good quality and pure Go (no cgo wrappers or autoconv
 * [github.com/dsnet/compress](https://github.com/dsnet/compress) - brotli decompression, bzip2 writer.
 * [github.com/ronanh/intcomp](https://github.com/ronanh/intcomp) - Integer compression.
 * [github.com/spenczar/fpc](https://github.com/spenczar/fpc) - Float compression.
+* [github.com/minio/zipindex](https://github.com/minio/zipindex) - External ZIP directory index.
+* [github.com/ybirader/pzip](https://github.com/ybirader/pzip) - Fast concurrent zip archiver and extractor.
 
 # license
 
diff --git a/vendor/github.com/klauspost/compress/fse/bitwriter.go b/vendor/github.com/klauspost/compress/fse/bitwriter.go
index 43e463611..e82fa3bb7 100644
--- a/vendor/github.com/klauspost/compress/fse/bitwriter.go
+++ b/vendor/github.com/klauspost/compress/fse/bitwriter.go
@@ -152,12 +152,11 @@ func (b *bitWriter) flushAlign() {
 
 // close will write the alignment bit and write the final byte(s)
 // to the output.
-func (b *bitWriter) close() error {
+func (b *bitWriter) close() {
 	// End mark
 	b.addBits16Clean(1, 1)
 	// flush until next byte.
 	b.flushAlign()
-	return nil
 }
 
 // reset and continue writing by appending to out.
diff --git a/vendor/github.com/klauspost/compress/fse/compress.go b/vendor/github.com/klauspost/compress/fse/compress.go
index dac97e58a..074018d8f 100644
--- a/vendor/github.com/klauspost/compress/fse/compress.go
+++ b/vendor/github.com/klauspost/compress/fse/compress.go
@@ -199,7 +199,8 @@ func (s *Scratch) compress(src []byte) error {
 	c2.flush(s.actualTableLog)
 	c1.flush(s.actualTableLog)
 
-	return s.bw.close()
+	s.bw.close()
+	return nil
 }
 
 // writeCount will write the normalized histogram count to header.
@@ -211,7 +212,7 @@ func (s *Scratch) writeCount() error {
 		previous0 bool
 		charnum   uint16
 
-		maxHeaderSize = ((int(s.symbolLen) * int(tableLog)) >> 3) + 3
+		maxHeaderSize = ((int(s.symbolLen)*int(tableLog) + 4 + 2) >> 3) + 3
 
 		// Write Table Size
 		bitStream = uint32(tableLog - minTablelog)
diff --git a/vendor/github.com/klauspost/compress/huff0/bitwriter.go b/vendor/github.com/klauspost/compress/huff0/bitwriter.go
index b4d7164e3..0ebc9aaac 100644
--- a/vendor/github.com/klauspost/compress/huff0/bitwriter.go
+++ b/vendor/github.com/klauspost/compress/huff0/bitwriter.go
@@ -94,10 +94,9 @@ func (b *bitWriter) flushAlign() {
 
 // close will write the alignment bit and write the final byte(s)
 // to the output.
-func (b *bitWriter) close() error {
+func (b *bitWriter) close() {
 	// End mark
 	b.addBits16Clean(1, 1)
 	// flush until next byte.
 	b.flushAlign()
-	return nil
 }
diff --git a/vendor/github.com/klauspost/compress/huff0/bytereader.go b/vendor/github.com/klauspost/compress/huff0/bytereader.go
deleted file mode 100644
index 4dcab8d23..000000000
--- a/vendor/github.com/klauspost/compress/huff0/bytereader.go
+++ /dev/null
@@ -1,44 +0,0 @@
-// Copyright 2018 Klaus Post. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-// Based on work Copyright (c) 2013, Yann Collet, released under BSD License.
-
-package huff0
-
-// byteReader provides a byte reader that reads
-// little endian values from a byte stream.
-// The input stream is manually advanced.
-// The reader performs no bounds checks.
-type byteReader struct {
-	b   []byte
-	off int
-}
-
-// init will initialize the reader and set the input.
-func (b *byteReader) init(in []byte) {
-	b.b = in
-	b.off = 0
-}
-
-// Int32 returns a little endian int32 starting at current offset.
-func (b byteReader) Int32() int32 {
-	v3 := int32(b.b[b.off+3])
-	v2 := int32(b.b[b.off+2])
-	v1 := int32(b.b[b.off+1])
-	v0 := int32(b.b[b.off])
-	return (v3 << 24) | (v2 << 16) | (v1 << 8) | v0
-}
-
-// Uint32 returns a little endian uint32 starting at current offset.
-func (b byteReader) Uint32() uint32 {
-	v3 := uint32(b.b[b.off+3])
-	v2 := uint32(b.b[b.off+2])
-	v1 := uint32(b.b[b.off+1])
-	v0 := uint32(b.b[b.off])
-	return (v3 << 24) | (v2 << 16) | (v1 << 8) | v0
-}
-
-// remain will return the number of bytes remaining.
-func (b byteReader) remain() int {
-	return len(b.b) - b.off
-}
diff --git a/vendor/github.com/klauspost/compress/huff0/compress.go b/vendor/github.com/klauspost/compress/huff0/compress.go
index 4ee4fa18d..84aa3d12f 100644
--- a/vendor/github.com/klauspost/compress/huff0/compress.go
+++ b/vendor/github.com/klauspost/compress/huff0/compress.go
@@ -227,10 +227,10 @@ func EstimateSizes(in []byte, s *Scratch) (tableSz, dataSz, reuseSz int, err err
 }
 
 func (s *Scratch) compress1X(src []byte) ([]byte, error) {
-	return s.compress1xDo(s.Out, src)
+	return s.compress1xDo(s.Out, src), nil
 }
 
-func (s *Scratch) compress1xDo(dst, src []byte) ([]byte, error) {
+func (s *Scratch) compress1xDo(dst, src []byte) []byte {
 	var bw = bitWriter{out: dst}
 
 	// N is length divisible by 4.
@@ -260,8 +260,8 @@ func (s *Scratch) compress1xDo(dst, src []byte) ([]byte, error) {
 			bw.encTwoSymbols(cTable, tmp[1], tmp[0])
 		}
 	}
-	err := bw.close()
-	return bw.out, err
+	bw.close()
+	return bw.out
 }
 
 var sixZeros [6]byte
@@ -283,12 +283,8 @@ func (s *Scratch) compress4X(src []byte) ([]byte, error) {
 		}
 		src = src[len(toDo):]
 
-		var err error
 		idx := len(s.Out)
-		s.Out, err = s.compress1xDo(s.Out, toDo)
-		if err != nil {
-			return nil, err
-		}
+		s.Out = s.compress1xDo(s.Out, toDo)
 		if len(s.Out)-idx > math.MaxUint16 {
 			// We cannot store the size in the jump table
 			return nil, ErrIncompressible
@@ -315,7 +311,6 @@ func (s *Scratch) compress4Xp(src []byte) ([]byte, error) {
 
 	segmentSize := (len(src) + 3) / 4
 	var wg sync.WaitGroup
-	var errs [4]error
 	wg.Add(4)
 	for i := 0; i < 4; i++ {
 		toDo := src
@@ -326,15 +321,12 @@ func (s *Scratch) compress4Xp(src []byte) ([]byte, error) {
 
 		// Separate goroutine for each block.
 		go func(i int) {
-			s.tmpOut[i], errs[i] = s.compress1xDo(s.tmpOut[i][:0], toDo)
+			s.tmpOut[i] = s.compress1xDo(s.tmpOut[i][:0], toDo)
 			wg.Done()
 		}(i)
 	}
 	wg.Wait()
 	for i := 0; i < 4; i++ {
-		if errs[i] != nil {
-			return nil, errs[i]
-		}
 		o := s.tmpOut[i]
 		if len(o) > math.MaxUint16 {
 			// We cannot store the size in the jump table
@@ -358,6 +350,7 @@ func (s *Scratch) compress4Xp(src []byte) ([]byte, error) {
 // Does not update s.clearCount.
 func (s *Scratch) countSimple(in []byte) (max int, reuse bool) {
 	reuse = true
+	_ = s.count // Assert that s != nil to speed up the following loop.
 	for _, v := range in {
 		s.count[v]++
 	}
@@ -423,7 +416,7 @@ func (s *Scratch) validateTable(c cTable) bool {
 
 // minTableLog provides the minimum logSize to safely represent a distribution.
 func (s *Scratch) minTableLog() uint8 {
-	minBitsSrc := highBit32(uint32(s.br.remain())) + 1
+	minBitsSrc := highBit32(uint32(s.srcLen)) + 1
 	minBitsSymbols := highBit32(uint32(s.symbolLen-1)) + 2
 	if minBitsSrc < minBitsSymbols {
 		return uint8(minBitsSrc)
@@ -435,7 +428,7 @@ func (s *Scratch) minTableLog() uint8 {
 func (s *Scratch) optimalTableLog() {
 	tableLog := s.TableLog
 	minBits := s.minTableLog()
-	maxBitsSrc := uint8(highBit32(uint32(s.br.remain()-1))) - 1
+	maxBitsSrc := uint8(highBit32(uint32(s.srcLen-1))) - 1
 	if maxBitsSrc < tableLog {
 		// Accuracy can be reduced
 		tableLog = maxBitsSrc
diff --git a/vendor/github.com/klauspost/compress/huff0/huff0.go b/vendor/github.com/klauspost/compress/huff0/huff0.go
index e8ad17ad0..77ecd68e0 100644
--- a/vendor/github.com/klauspost/compress/huff0/huff0.go
+++ b/vendor/github.com/klauspost/compress/huff0/huff0.go
@@ -88,7 +88,7 @@ type Scratch struct {
 	// Decoders will return ErrMaxDecodedSizeExceeded is this limit is exceeded.
 	MaxDecodedSize int
 
-	br byteReader
+	srcLen int
 
 	// MaxSymbolValue will override the maximum symbol value of the next block.
 	MaxSymbolValue uint8
@@ -170,7 +170,7 @@ func (s *Scratch) prepare(in []byte) (*Scratch, error) {
 	if s.fse == nil {
 		s.fse = &fse.Scratch{}
 	}
-	s.br.init(in)
+	s.srcLen = len(in)
 
 	return s, nil
 }
diff --git a/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go
index 2aa6a95a0..2754bac6f 100644
--- a/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go
+++ b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go
@@ -51,7 +51,7 @@ func emitCopy(dst []byte, offset, length int) int {
 	i := 0
 	// The maximum length for a single tagCopy1 or tagCopy2 op is 64 bytes. The
 	// threshold for this loop is a little higher (at 68 = 64 + 4), and the
-	// length emitted down below is is a little lower (at 60 = 64 - 4), because
+	// length emitted down below is a little lower (at 60 = 64 - 4), because
 	// it's shorter to encode a length 67 copy as a length 60 tagCopy2 followed
 	// by a length 7 tagCopy1 (which encodes as 3+2 bytes) than to encode it as
 	// a length 64 tagCopy2 followed by a length 3 tagCopy2 (which encodes as
diff --git a/vendor/github.com/klauspost/compress/s2sx.mod b/vendor/github.com/klauspost/compress/s2sx.mod
index 2263853fc..5a4412f90 100644
--- a/vendor/github.com/klauspost/compress/s2sx.mod
+++ b/vendor/github.com/klauspost/compress/s2sx.mod
@@ -1,4 +1,4 @@
 module github.com/klauspost/compress
 
-go 1.16
+go 1.19
 
diff --git a/vendor/github.com/klauspost/compress/zstd/README.md b/vendor/github.com/klauspost/compress/zstd/README.md
index bdd49c8b2..92e2347bb 100644
--- a/vendor/github.com/klauspost/compress/zstd/README.md
+++ b/vendor/github.com/klauspost/compress/zstd/README.md
@@ -259,7 +259,7 @@ nyc-taxi-data-10M.csv   gzkp    1   3325605752  922273214   13929   227.68
 
 ## Decompressor
 
-Staus: STABLE - there may still be subtle bugs, but a wide variety of content has been tested.
+Status: STABLE - there may still be subtle bugs, but a wide variety of content has been tested.
 
 This library is being continuously [fuzz-tested](https://github.com/klauspost/compress-fuzz),
 kindly supplied by [fuzzit.dev](https://fuzzit.dev/). 
diff --git a/vendor/github.com/klauspost/compress/zstd/bitreader.go b/vendor/github.com/klauspost/compress/zstd/bitreader.go
index 97299d499..25ca98394 100644
--- a/vendor/github.com/klauspost/compress/zstd/bitreader.go
+++ b/vendor/github.com/klauspost/compress/zstd/bitreader.go
@@ -17,7 +17,6 @@ import (
 // for aligning the input.
 type bitReader struct {
 	in       []byte
-	off      uint   // next byte to read is at in[off - 1]
 	value    uint64 // Maybe use [16]byte, but shifting is awkward.
 	bitsRead uint8
 }
@@ -28,7 +27,6 @@ func (b *bitReader) init(in []byte) error {
 		return errors.New("corrupt stream: too short")
 	}
 	b.in = in
-	b.off = uint(len(in))
 	// The highest bit of the last byte indicates where to start
 	v := in[len(in)-1]
 	if v == 0 {
@@ -69,21 +67,19 @@ func (b *bitReader) fillFast() {
 	if b.bitsRead < 32 {
 		return
 	}
-	// 2 bounds checks.
-	v := b.in[b.off-4:]
-	v = v[:4]
+	v := b.in[len(b.in)-4:]
+	b.in = b.in[:len(b.in)-4]
 	low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24)
 	b.value = (b.value << 32) | uint64(low)
 	b.bitsRead -= 32
-	b.off -= 4
 }
 
 // fillFastStart() assumes the bitreader is empty and there is at least 8 bytes to read.
 func (b *bitReader) fillFastStart() {
-	// Do single re-slice to avoid bounds checks.
-	b.value = binary.LittleEndian.Uint64(b.in[b.off-8:])
+	v := b.in[len(b.in)-8:]
+	b.in = b.in[:len(b.in)-8]
+	b.value = binary.LittleEndian.Uint64(v)
 	b.bitsRead = 0
-	b.off -= 8
 }
 
 // fill() will make sure at least 32 bits are available.
@@ -91,25 +87,25 @@ func (b *bitReader) fill() {
 	if b.bitsRead < 32 {
 		return
 	}
-	if b.off >= 4 {
-		v := b.in[b.off-4:]
-		v = v[:4]
+	if len(b.in) >= 4 {
+		v := b.in[len(b.in)-4:]
+		b.in = b.in[:len(b.in)-4]
 		low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24)
 		b.value = (b.value << 32) | uint64(low)
 		b.bitsRead -= 32
-		b.off -= 4
 		return
 	}
-	for b.off > 0 {
-		b.value = (b.value << 8) | uint64(b.in[b.off-1])
-		b.bitsRead -= 8
-		b.off--
+
+	b.bitsRead -= uint8(8 * len(b.in))
+	for len(b.in) > 0 {
+		b.value = (b.value << 8) | uint64(b.in[len(b.in)-1])
+		b.in = b.in[:len(b.in)-1]
 	}
 }
 
 // finished returns true if all bits have been read from the bit stream.
 func (b *bitReader) finished() bool {
-	return b.off == 0 && b.bitsRead >= 64
+	return len(b.in) == 0 && b.bitsRead >= 64
 }
 
 // overread returns true if more bits have been requested than is on the stream.
@@ -119,7 +115,7 @@ func (b *bitReader) overread() bool {
 
 // remain returns the number of bits remaining.
 func (b *bitReader) remain() uint {
-	return b.off*8 + 64 - uint(b.bitsRead)
+	return 8*uint(len(b.in)) + 64 - uint(b.bitsRead)
 }
 
 // close the bitstream and returns an error if out-of-buffer reads occurred.
diff --git a/vendor/github.com/klauspost/compress/zstd/bitwriter.go b/vendor/github.com/klauspost/compress/zstd/bitwriter.go
index 78b3c61be..1952f175b 100644
--- a/vendor/github.com/klauspost/compress/zstd/bitwriter.go
+++ b/vendor/github.com/klauspost/compress/zstd/bitwriter.go
@@ -97,12 +97,11 @@ func (b *bitWriter) flushAlign() {
 
 // close will write the alignment bit and write the final byte(s)
 // to the output.
-func (b *bitWriter) close() error {
+func (b *bitWriter) close() {
 	// End mark
 	b.addBits16Clean(1, 1)
 	// flush until next byte.
 	b.flushAlign()
-	return nil
 }
 
 // reset and continue writing by appending to out.
diff --git a/vendor/github.com/klauspost/compress/zstd/blockdec.go b/vendor/github.com/klauspost/compress/zstd/blockdec.go
index 9f17ce601..03744fbc7 100644
--- a/vendor/github.com/klauspost/compress/zstd/blockdec.go
+++ b/vendor/github.com/klauspost/compress/zstd/blockdec.go
@@ -554,6 +554,9 @@ func (b *blockDec) prepareSequences(in []byte, hist *history) (err error) {
 		if debugDecoder {
 			printf("Compression modes: 0b%b", compMode)
 		}
+		if compMode&3 != 0 {
+			return errors.New("corrupt block: reserved bits not zero")
+		}
 		for i := uint(0); i < 3; i++ {
 			mode := seqCompMode((compMode >> (6 - i*2)) & 3)
 			if debugDecoder {
diff --git a/vendor/github.com/klauspost/compress/zstd/blockenc.go b/vendor/github.com/klauspost/compress/zstd/blockenc.go
index fd4a36f73..32a7f401d 100644
--- a/vendor/github.com/klauspost/compress/zstd/blockenc.go
+++ b/vendor/github.com/klauspost/compress/zstd/blockenc.go
@@ -361,14 +361,21 @@ func (b *blockEnc) encodeLits(lits []byte, raw bool) error {
 	if len(lits) >= 1024 {
 		// Use 4 Streams.
 		out, reUsed, err = huff0.Compress4X(lits, b.litEnc)
-	} else if len(lits) > 32 {
+	} else if len(lits) > 16 {
 		// Use 1 stream
 		single = true
 		out, reUsed, err = huff0.Compress1X(lits, b.litEnc)
 	} else {
 		err = huff0.ErrIncompressible
 	}
-
+	if err == nil && len(out)+5 > len(lits) {
+		// If we are close, we may still be worse or equal to raw.
+		var lh literalsHeader
+		lh.setSizes(len(out), len(lits), single)
+		if len(out)+lh.size() >= len(lits) {
+			err = huff0.ErrIncompressible
+		}
+	}
 	switch err {
 	case huff0.ErrIncompressible:
 		if debugEncoder {
@@ -420,6 +427,16 @@ func (b *blockEnc) encodeLits(lits []byte, raw bool) error {
 	return nil
 }
 
+// encodeRLE will encode an RLE block.
+func (b *blockEnc) encodeRLE(val byte, length uint32) {
+	var bh blockHeader
+	bh.setLast(b.last)
+	bh.setSize(length)
+	bh.setType(blockTypeRLE)
+	b.output = bh.appendTo(b.output)
+	b.output = append(b.output, val)
+}
+
 // fuzzFseEncoder can be used to fuzz the FSE encoder.
 func fuzzFseEncoder(data []byte) int {
 	if len(data) > maxSequences || len(data) < 2 {
@@ -472,6 +489,16 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error {
 	if len(b.sequences) == 0 {
 		return b.encodeLits(b.literals, rawAllLits)
 	}
+	if len(b.sequences) == 1 && len(org) > 0 && len(b.literals) <= 1 {
+		// Check common RLE cases.
+		seq := b.sequences[0]
+		if seq.litLen == uint32(len(b.literals)) && seq.offset-3 == 1 {
+			// Offset == 1 and 0 or 1 literals.
+			b.encodeRLE(org[0], b.sequences[0].matchLen+zstdMinMatch+seq.litLen)
+			return nil
+		}
+	}
+
 	// We want some difference to at least account for the headers.
 	saved := b.size - len(b.literals) - (b.size >> 6)
 	if saved < 16 {
@@ -503,7 +530,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error {
 	if len(b.literals) >= 1024 && !raw {
 		// Use 4 Streams.
 		out, reUsed, err = huff0.Compress4X(b.literals, b.litEnc)
-	} else if len(b.literals) > 32 && !raw {
+	} else if len(b.literals) > 16 && !raw {
 		// Use 1 stream
 		single = true
 		out, reUsed, err = huff0.Compress1X(b.literals, b.litEnc)
@@ -511,6 +538,17 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error {
 		err = huff0.ErrIncompressible
 	}
 
+	if err == nil && len(out)+5 > len(b.literals) {
+		// If we are close, we may still be worse or equal to raw.
+		var lh literalsHeader
+		lh.setSize(len(b.literals))
+		szRaw := lh.size()
+		lh.setSizes(len(out), len(b.literals), single)
+		szComp := lh.size()
+		if len(out)+szComp >= len(b.literals)+szRaw {
+			err = huff0.ErrIncompressible
+		}
+	}
 	switch err {
 	case huff0.ErrIncompressible:
 		lh.setType(literalsBlockRaw)
@@ -773,10 +811,7 @@ func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error {
 	ml.flush(mlEnc.actualTableLog)
 	of.flush(ofEnc.actualTableLog)
 	ll.flush(llEnc.actualTableLog)
-	err = wr.close()
-	if err != nil {
-		return err
-	}
+	wr.close()
 	b.output = wr.out
 
 	// Maybe even add a bigger margin.
diff --git a/vendor/github.com/klauspost/compress/zstd/decodeheader.go b/vendor/github.com/klauspost/compress/zstd/decodeheader.go
index f6a240970..6a5a2988b 100644
--- a/vendor/github.com/klauspost/compress/zstd/decodeheader.go
+++ b/vendor/github.com/klauspost/compress/zstd/decodeheader.go
@@ -95,42 +95,54 @@ type Header struct {
 // If there isn't enough input, io.ErrUnexpectedEOF is returned.
 // The FirstBlock.OK will indicate if enough information was available to decode the first block header.
 func (h *Header) Decode(in []byte) error {
+	_, err := h.DecodeAndStrip(in)
+	return err
+}
+
+// DecodeAndStrip will decode the header from the beginning of the stream
+// and on success return the remaining bytes.
+// This will decode the frame header and the first block header if enough bytes are provided.
+// It is recommended to provide at least HeaderMaxSize bytes.
+// If the frame header cannot be read an error will be returned.
+// If there isn't enough input, io.ErrUnexpectedEOF is returned.
+// The FirstBlock.OK will indicate if enough information was available to decode the first block header.
+func (h *Header) DecodeAndStrip(in []byte) (remain []byte, err error) {
 	*h = Header{}
 	if len(in) < 4 {
-		return io.ErrUnexpectedEOF
+		return nil, io.ErrUnexpectedEOF
 	}
 	h.HeaderSize += 4
 	b, in := in[:4], in[4:]
 	if string(b) != frameMagic {
 		if string(b[1:4]) != skippableFrameMagic || b[0]&0xf0 != 0x50 {
-			return ErrMagicMismatch
+			return nil, ErrMagicMismatch
 		}
 		if len(in) < 4 {
-			return io.ErrUnexpectedEOF
+			return nil, io.ErrUnexpectedEOF
 		}
 		h.HeaderSize += 4
 		h.Skippable = true
 		h.SkippableID = int(b[0] & 0xf)
 		h.SkippableSize = binary.LittleEndian.Uint32(in)
-		return nil
+		return in[4:], nil
 	}
 
 	// Read Window_Descriptor
 	// https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#window_descriptor
 	if len(in) < 1 {
-		return io.ErrUnexpectedEOF
+		return nil, io.ErrUnexpectedEOF
 	}
 	fhd, in := in[0], in[1:]
 	h.HeaderSize++
 	h.SingleSegment = fhd&(1<<5) != 0
 	h.HasCheckSum = fhd&(1<<2) != 0
 	if fhd&(1<<3) != 0 {
-		return errors.New("reserved bit set on frame header")
+		return nil, errors.New("reserved bit set on frame header")
 	}
 
 	if !h.SingleSegment {
 		if len(in) < 1 {
-			return io.ErrUnexpectedEOF
+			return nil, io.ErrUnexpectedEOF
 		}
 		var wd byte
 		wd, in = in[0], in[1:]
@@ -148,7 +160,7 @@ func (h *Header) Decode(in []byte) error {
 			size = 4
 		}
 		if len(in) < int(size) {
-			return io.ErrUnexpectedEOF
+			return nil, io.ErrUnexpectedEOF
 		}
 		b, in = in[:size], in[size:]
 		h.HeaderSize += int(size)
@@ -178,7 +190,7 @@ func (h *Header) Decode(in []byte) error {
 	if fcsSize > 0 {
 		h.HasFCS = true
 		if len(in) < fcsSize {
-			return io.ErrUnexpectedEOF
+			return nil, io.ErrUnexpectedEOF
 		}
 		b, in = in[:fcsSize], in[fcsSize:]
 		h.HeaderSize += int(fcsSize)
@@ -199,7 +211,7 @@ func (h *Header) Decode(in []byte) error {
 
 	// Frame Header done, we will not fail from now on.
 	if len(in) < 3 {
-		return nil
+		return in, nil
 	}
 	tmp := in[:3]
 	bh := uint32(tmp[0]) | (uint32(tmp[1]) << 8) | (uint32(tmp[2]) << 16)
@@ -209,7 +221,7 @@ func (h *Header) Decode(in []byte) error {
 	cSize := int(bh >> 3)
 	switch blockType {
 	case blockTypeReserved:
-		return nil
+		return in, nil
 	case blockTypeRLE:
 		h.FirstBlock.Compressed = true
 		h.FirstBlock.DecompressedSize = cSize
@@ -225,5 +237,25 @@ func (h *Header) Decode(in []byte) error {
 	}
 
 	h.FirstBlock.OK = true
-	return nil
+	return in, nil
+}
+
+// AppendTo will append the encoded header to the dst slice.
+// There is no error checking performed on the header values.
+func (h *Header) AppendTo(dst []byte) ([]byte, error) {
+	if h.Skippable {
+		magic := [4]byte{0x50, 0x2a, 0x4d, 0x18}
+		magic[0] |= byte(h.SkippableID & 0xf)
+		dst = append(dst, magic[:]...)
+		f := h.SkippableSize
+		return append(dst, uint8(f), uint8(f>>8), uint8(f>>16), uint8(f>>24)), nil
+	}
+	f := frameHeader{
+		ContentSize:   h.FrameContentSize,
+		WindowSize:    uint32(h.WindowSize),
+		SingleSegment: h.SingleSegment,
+		Checksum:      h.HasCheckSum,
+		DictID:        h.DictionaryID,
+	}
+	return f.appendTo(dst), nil
 }
diff --git a/vendor/github.com/klauspost/compress/zstd/decoder.go b/vendor/github.com/klauspost/compress/zstd/decoder.go
index f04aaa21e..bbca17234 100644
--- a/vendor/github.com/klauspost/compress/zstd/decoder.go
+++ b/vendor/github.com/klauspost/compress/zstd/decoder.go
@@ -82,7 +82,7 @@ var (
 // can run multiple concurrent stateless decodes. It is even possible to
 // use stateless decodes while a stream is being decoded.
 //
-// The Reset function can be used to initiate a new stream, which is will considerably
+// The Reset function can be used to initiate a new stream, which will considerably
 // reduce the allocations normally caused by NewReader.
 func NewReader(r io.Reader, opts ...DOption) (*Decoder, error) {
 	initPredefined()
diff --git a/vendor/github.com/klauspost/compress/zstd/dict.go b/vendor/github.com/klauspost/compress/zstd/dict.go
index ca0951452..8d5567fe6 100644
--- a/vendor/github.com/klauspost/compress/zstd/dict.go
+++ b/vendor/github.com/klauspost/compress/zstd/dict.go
@@ -1,10 +1,13 @@
 package zstd
 
 import (
+	"bytes"
 	"encoding/binary"
 	"errors"
 	"fmt"
 	"io"
+	"math"
+	"sort"
 
 	"github.com/klauspost/compress/huff0"
 )
@@ -14,9 +17,8 @@ type dict struct {
 
 	litEnc              *huff0.Scratch
 	llDec, ofDec, mlDec sequenceDec
-	//llEnc, ofEnc, mlEnc []*fseEncoder
-	offsets [3]int
-	content []byte
+	offsets             [3]int
+	content             []byte
 }
 
 const dictMagic = "\x37\xa4\x30\xec"
@@ -159,3 +161,374 @@ func InspectDictionary(b []byte) (interface {
 	d, err := loadDict(b)
 	return d, err
 }
+
+type BuildDictOptions struct {
+	// Dictionary ID.
+	ID uint32
+
+	// Content to use to create dictionary tables.
+	Contents [][]byte
+
+	// History to use for all blocks.
+	History []byte
+
+	// Offsets to use.
+	Offsets [3]int
+
+	// CompatV155 will make the dictionary compatible with Zstd v1.5.5 and earlier.
+	// See https://github.com/facebook/zstd/issues/3724
+	CompatV155 bool
+
+	// Use the specified encoder level.
+	// The dictionary will be built using the specified encoder level,
+	// which will reflect speed and make the dictionary tailored for that level.
+	// If not set SpeedBestCompression will be used.
+	Level EncoderLevel
+
+	// DebugOut will write stats and other details here if set.
+	DebugOut io.Writer
+}
+
+func BuildDict(o BuildDictOptions) ([]byte, error) {
+	initPredefined()
+	hist := o.History
+	contents := o.Contents
+	debug := o.DebugOut != nil
+	println := func(args ...interface{}) {
+		if o.DebugOut != nil {
+			fmt.Fprintln(o.DebugOut, args...)
+		}
+	}
+	printf := func(s string, args ...interface{}) {
+		if o.DebugOut != nil {
+			fmt.Fprintf(o.DebugOut, s, args...)
+		}
+	}
+	print := func(args ...interface{}) {
+		if o.DebugOut != nil {
+			fmt.Fprint(o.DebugOut, args...)
+		}
+	}
+
+	if int64(len(hist)) > dictMaxLength {
+		return nil, fmt.Errorf("dictionary of size %d > %d", len(hist), int64(dictMaxLength))
+	}
+	if len(hist) < 8 {
+		return nil, fmt.Errorf("dictionary of size %d < %d", len(hist), 8)
+	}
+	if len(contents) == 0 {
+		return nil, errors.New("no content provided")
+	}
+	d := dict{
+		id:      o.ID,
+		litEnc:  nil,
+		llDec:   sequenceDec{},
+		ofDec:   sequenceDec{},
+		mlDec:   sequenceDec{},
+		offsets: o.Offsets,
+		content: hist,
+	}
+	block := blockEnc{lowMem: false}
+	block.init()
+	enc := encoder(&bestFastEncoder{fastBase: fastBase{maxMatchOff: int32(maxMatchLen), bufferReset: math.MaxInt32 - int32(maxMatchLen*2), lowMem: false}})
+	if o.Level != 0 {
+		eOpts := encoderOptions{
+			level:      o.Level,
+			blockSize:  maxMatchLen,
+			windowSize: maxMatchLen,
+			dict:       &d,
+			lowMem:     false,
+		}
+		enc = eOpts.encoder()
+	} else {
+		o.Level = SpeedBestCompression
+	}
+	var (
+		remain [256]int
+		ll     [256]int
+		ml     [256]int
+		of     [256]int
+	)
+	addValues := func(dst *[256]int, src []byte) {
+		for _, v := range src {
+			dst[v]++
+		}
+	}
+	addHist := func(dst *[256]int, src *[256]uint32) {
+		for i, v := range src {
+			dst[i] += int(v)
+		}
+	}
+	seqs := 0
+	nUsed := 0
+	litTotal := 0
+	newOffsets := make(map[uint32]int, 1000)
+	for _, b := range contents {
+		block.reset(nil)
+		if len(b) < 8 {
+			continue
+		}
+		nUsed++
+		enc.Reset(&d, true)
+		enc.Encode(&block, b)
+		addValues(&remain, block.literals)
+		litTotal += len(block.literals)
+		seqs += len(block.sequences)
+		block.genCodes()
+		addHist(&ll, block.coders.llEnc.Histogram())
+		addHist(&ml, block.coders.mlEnc.Histogram())
+		addHist(&of, block.coders.ofEnc.Histogram())
+		for i, seq := range block.sequences {
+			if i > 3 {
+				break
+			}
+			offset := seq.offset
+			if offset == 0 {
+				continue
+			}
+			if offset > 3 {
+				newOffsets[offset-3]++
+			} else {
+				newOffsets[uint32(o.Offsets[offset-1])]++
+			}
+		}
+	}
+	// Find most used offsets.
+	var sortedOffsets []uint32
+	for k := range newOffsets {
+		sortedOffsets = append(sortedOffsets, k)
+	}
+	sort.Slice(sortedOffsets, func(i, j int) bool {
+		a, b := sortedOffsets[i], sortedOffsets[j]
+		if a == b {
+			// Prefer the longer offset
+			return sortedOffsets[i] > sortedOffsets[j]
+		}
+		return newOffsets[sortedOffsets[i]] > newOffsets[sortedOffsets[j]]
+	})
+	if len(sortedOffsets) > 3 {
+		if debug {
+			print("Offsets:")
+			for i, v := range sortedOffsets {
+				if i > 20 {
+					break
+				}
+				printf("[%d: %d],", v, newOffsets[v])
+			}
+			println("")
+		}
+
+		sortedOffsets = sortedOffsets[:3]
+	}
+	for i, v := range sortedOffsets {
+		o.Offsets[i] = int(v)
+	}
+	if debug {
+		println("New repeat offsets", o.Offsets)
+	}
+
+	if nUsed == 0 || seqs == 0 {
+		return nil, fmt.Errorf("%d blocks, %d sequences found", nUsed, seqs)
+	}
+	if debug {
+		println("Sequences:", seqs, "Blocks:", nUsed, "Literals:", litTotal)
+	}
+	if seqs/nUsed < 512 {
+		// Use 512 as minimum.
+		nUsed = seqs / 512
+	}
+	copyHist := func(dst *fseEncoder, src *[256]int) ([]byte, error) {
+		hist := dst.Histogram()
+		var maxSym uint8
+		var maxCount int
+		var fakeLength int
+		for i, v := range src {
+			if v > 0 {
+				v = v / nUsed
+				if v == 0 {
+					v = 1
+				}
+			}
+			if v > maxCount {
+				maxCount = v
+			}
+			if v != 0 {
+				maxSym = uint8(i)
+			}
+			fakeLength += v
+			hist[i] = uint32(v)
+		}
+		dst.HistogramFinished(maxSym, maxCount)
+		dst.reUsed = false
+		dst.useRLE = false
+		err := dst.normalizeCount(fakeLength)
+		if err != nil {
+			return nil, err
+		}
+		if debug {
+			println("RAW:", dst.count[:maxSym+1], "NORM:", dst.norm[:maxSym+1], "LEN:", fakeLength)
+		}
+		return dst.writeCount(nil)
+	}
+	if debug {
+		print("Literal lengths: ")
+	}
+	llTable, err := copyHist(block.coders.llEnc, &ll)
+	if err != nil {
+		return nil, err
+	}
+	if debug {
+		print("Match lengths: ")
+	}
+	mlTable, err := copyHist(block.coders.mlEnc, &ml)
+	if err != nil {
+		return nil, err
+	}
+	if debug {
+		print("Offsets: ")
+	}
+	ofTable, err := copyHist(block.coders.ofEnc, &of)
+	if err != nil {
+		return nil, err
+	}
+
+	// Literal table
+	avgSize := litTotal
+	if avgSize > huff0.BlockSizeMax/2 {
+		avgSize = huff0.BlockSizeMax / 2
+	}
+	huffBuff := make([]byte, 0, avgSize)
+	// Target size
+	div := litTotal / avgSize
+	if div < 1 {
+		div = 1
+	}
+	if debug {
+		println("Huffman weights:")
+	}
+	for i, n := range remain[:] {
+		if n > 0 {
+			n = n / div
+			// Allow all entries to be represented.
+			if n == 0 {
+				n = 1
+			}
+			huffBuff = append(huffBuff, bytes.Repeat([]byte{byte(i)}, n)...)
+			if debug {
+				printf("[%d: %d], ", i, n)
+			}
+		}
+	}
+	if o.CompatV155 && remain[255]/div == 0 {
+		huffBuff = append(huffBuff, 255)
+	}
+	scratch := &huff0.Scratch{TableLog: 11}
+	for tries := 0; tries < 255; tries++ {
+		scratch = &huff0.Scratch{TableLog: 11}
+		_, _, err = huff0.Compress1X(huffBuff, scratch)
+		if err == nil {
+			break
+		}
+		if debug {
+			printf("Try %d: Huffman error: %v\n", tries+1, err)
+		}
+		huffBuff = huffBuff[:0]
+		if tries == 250 {
+			if debug {
+				println("Huffman: Bailing out with predefined table")
+			}
+
+			// Bail out.... Just generate something
+			huffBuff = append(huffBuff, bytes.Repeat([]byte{255}, 10000)...)
+			for i := 0; i < 128; i++ {
+				huffBuff = append(huffBuff, byte(i))
+			}
+			continue
+		}
+		if errors.Is(err, huff0.ErrIncompressible) {
+			// Try truncating least common.
+			for i, n := range remain[:] {
+				if n > 0 {
+					n = n / (div * (i + 1))
+					if n > 0 {
+						huffBuff = append(huffBuff, bytes.Repeat([]byte{byte(i)}, n)...)
+					}
+				}
+			}
+			if o.CompatV155 && len(huffBuff) > 0 && huffBuff[len(huffBuff)-1] != 255 {
+				huffBuff = append(huffBuff, 255)
+			}
+			if len(huffBuff) == 0 {
+				huffBuff = append(huffBuff, 0, 255)
+			}
+		}
+		if errors.Is(err, huff0.ErrUseRLE) {
+			for i, n := range remain[:] {
+				n = n / (div * (i + 1))
+				// Allow all entries to be represented.
+				if n == 0 {
+					n = 1
+				}
+				huffBuff = append(huffBuff, bytes.Repeat([]byte{byte(i)}, n)...)
+			}
+		}
+	}
+
+	var out bytes.Buffer
+	out.Write([]byte(dictMagic))
+	out.Write(binary.LittleEndian.AppendUint32(nil, o.ID))
+	out.Write(scratch.OutTable)
+	if debug {
+		println("huff table:", len(scratch.OutTable), "bytes")
+		println("of table:", len(ofTable), "bytes")
+		println("ml table:", len(mlTable), "bytes")
+		println("ll table:", len(llTable), "bytes")
+	}
+	out.Write(ofTable)
+	out.Write(mlTable)
+	out.Write(llTable)
+	out.Write(binary.LittleEndian.AppendUint32(nil, uint32(o.Offsets[0])))
+	out.Write(binary.LittleEndian.AppendUint32(nil, uint32(o.Offsets[1])))
+	out.Write(binary.LittleEndian.AppendUint32(nil, uint32(o.Offsets[2])))
+	out.Write(hist)
+	if debug {
+		_, err := loadDict(out.Bytes())
+		if err != nil {
+			panic(err)
+		}
+		i, err := InspectDictionary(out.Bytes())
+		if err != nil {
+			panic(err)
+		}
+		println("ID:", i.ID())
+		println("Content size:", i.ContentSize())
+		println("Encoder:", i.LitEncoder() != nil)
+		println("Offsets:", i.Offsets())
+		var totalSize int
+		for _, b := range contents {
+			totalSize += len(b)
+		}
+
+		encWith := func(opts ...EOption) int {
+			enc, err := NewWriter(nil, opts...)
+			if err != nil {
+				panic(err)
+			}
+			defer enc.Close()
+			var dst []byte
+			var totalSize int
+			for _, b := range contents {
+				dst = enc.EncodeAll(b, dst[:0])
+				totalSize += len(dst)
+			}
+			return totalSize
+		}
+		plain := encWith(WithEncoderLevel(o.Level))
+		withDict := encWith(WithEncoderLevel(o.Level), WithEncoderDict(out.Bytes()))
+		println("Input size:", totalSize)
+		println("Plain Compressed:", plain)
+		println("Dict Compressed:", withDict)
+		println("Saved:", plain-withDict, (plain-withDict)/len(contents), "bytes per input (rounded down)")
+	}
+	return out.Bytes(), nil
+}
diff --git a/vendor/github.com/klauspost/compress/zstd/enc_best.go b/vendor/github.com/klauspost/compress/zstd/enc_best.go
index 9819d4145..4613724e9 100644
--- a/vendor/github.com/klauspost/compress/zstd/enc_best.go
+++ b/vendor/github.com/klauspost/compress/zstd/enc_best.go
@@ -43,7 +43,7 @@ func (m *match) estBits(bitsPerByte int32) {
 	if m.rep < 0 {
 		ofc = ofCode(uint32(m.s-m.offset) + 3)
 	} else {
-		ofc = ofCode(uint32(m.rep))
+		ofc = ofCode(uint32(m.rep) & 3)
 	}
 	// Cost, excluding
 	ofTT, mlTT := fsePredefEnc[tableOffsets].ct.symbolTT[ofc], fsePredefEnc[tableMatchLengths].ct.symbolTT[mlc]
@@ -135,8 +135,20 @@ func (e *bestFastEncoder) Encode(blk *blockEnc, src []byte) {
 		break
 	}
 
+	// Add block to history
 	s := e.addBlock(src)
 	blk.size = len(src)
+
+	// Check RLE first
+	if len(src) > zstdMinMatch {
+		ml := matchLen(src[1:], src)
+		if ml == len(src)-1 {
+			blk.literals = append(blk.literals, src[0])
+			blk.sequences = append(blk.sequences, seq{litLen: 1, matchLen: uint32(len(src)-1) - zstdMinMatch, offset: 1 + 3})
+			return
+		}
+	}
+
 	if len(src) < minNonLiteralBlockSize {
 		blk.extraLits = len(src)
 		blk.literals = blk.literals[:len(src)]
@@ -197,17 +209,10 @@ encodeLoop:
 
 		// Set m to a match at offset if it looks like that will improve compression.
 		improve := func(m *match, offset int32, s int32, first uint32, rep int32) {
-			if s-offset >= e.maxMatchOff || load3232(src, offset) != first {
+			delta := s - offset
+			if delta >= e.maxMatchOff || delta <= 0 || load3232(src, offset) != first {
 				return
 			}
-			if debugAsserts {
-				if offset <= 0 {
-					panic(offset)
-				}
-				if !bytes.Equal(src[s:s+4], src[offset:offset+4]) {
-					panic(fmt.Sprintf("first match mismatch: %v != %v, first: %08x", src[s:s+4], src[offset:offset+4], first))
-				}
-			}
 			// Try to quick reject if we already have a long match.
 			if m.length > 16 {
 				left := len(src) - int(m.s+m.length)
@@ -226,8 +231,10 @@ encodeLoop:
 				}
 			}
 			l := 4 + e.matchlen(s+4, offset+4, src)
-			if rep < 0 {
+			if m.rep <= 0 {
 				// Extend candidate match backwards as far as possible.
+				// Do not extend repeats as we can assume they are optimal
+				// and offsets change if s == nextEmit.
 				tMin := s - e.maxMatchOff
 				if tMin < 0 {
 					tMin = 0
@@ -238,7 +245,14 @@ encodeLoop:
 					l++
 				}
 			}
-
+			if debugAsserts {
+				if offset >= s {
+					panic(fmt.Sprintf("offset: %d - s:%d - rep: %d - cur :%d - max: %d", offset, s, rep, e.cur, e.maxMatchOff))
+				}
+				if !bytes.Equal(src[s:s+l], src[offset:offset+l]) {
+					panic(fmt.Sprintf("second match mismatch: %v != %v, first: %08x", src[s:s+4], src[offset:offset+4], first))
+				}
+			}
 			cand := match{offset: offset, s: s, length: l, rep: rep}
 			cand.estBits(bitsPerByte)
 			if m.est >= highScore || cand.est-m.est+(cand.s-m.s)*bitsPerByte>>10 < 0 {
@@ -281,6 +295,7 @@ encodeLoop:
 		// Load next and check...
 		e.longTable[nextHashL] = prevEntry{offset: s + e.cur, prev: candidateL.offset}
 		e.table[nextHashS] = prevEntry{offset: s + e.cur, prev: candidateS.offset}
+		index0 := s + 1
 
 		// Look far ahead, unless we have a really long match already...
 		if best.length < goodEnough {
@@ -334,41 +349,45 @@ encodeLoop:
 		}
 
 		if debugAsserts {
+			if best.offset >= best.s {
+				panic(fmt.Sprintf("best.offset > s: %d >= %d", best.offset, best.s))
+			}
+			if best.s < nextEmit {
+				panic(fmt.Sprintf("s %d < nextEmit %d", best.s, nextEmit))
+			}
+			if best.offset < s-e.maxMatchOff {
+				panic(fmt.Sprintf("best.offset < s-e.maxMatchOff: %d < %d", best.offset, s-e.maxMatchOff))
+			}
 			if !bytes.Equal(src[best.s:best.s+best.length], src[best.offset:best.offset+best.length]) {
 				panic(fmt.Sprintf("match mismatch: %v != %v", src[best.s:best.s+best.length], src[best.offset:best.offset+best.length]))
 			}
 		}
 
 		// We have a match, we can store the forward value
+		s = best.s
 		if best.rep > 0 {
 			var seq seq
 			seq.matchLen = uint32(best.length - zstdMinMatch)
-			if debugAsserts && s <= nextEmit {
-				panic("s <= nextEmit")
-			}
 			addLiterals(&seq, best.s)
 
 			// Repeat. If bit 4 is set, this is a non-lit repeat.
 			seq.offset = uint32(best.rep & 3)
 			if debugSequences {
-				println("repeat sequence", seq, "next s:", s)
+				println("repeat sequence", seq, "next s:", best.s, "off:", best.s-best.offset)
 			}
 			blk.sequences = append(blk.sequences, seq)
 
 			// Index old s + 1 -> s - 1
-			index0 := s + 1
 			s = best.s + best.length
-
 			nextEmit = s
-			if s >= sLimit {
-				if debugEncoder {
-					println("repeat ended", s, best.length)
-				}
-				break encodeLoop
-			}
+
 			// Index skipped...
+			end := s
+			if s > sLimit+4 {
+				end = sLimit + 4
+			}
 			off := index0 + e.cur
-			for index0 < s {
+			for index0 < end {
 				cv0 := load6432(src, index0)
 				h0 := hashLen(cv0, bestLongTableBits, bestLongLen)
 				h1 := hashLen(cv0, bestShortTableBits, bestShortLen)
@@ -377,6 +396,7 @@ encodeLoop:
 				off++
 				index0++
 			}
+
 			switch best.rep {
 			case 2, 4 | 1:
 				offset1, offset2 = offset2, offset1
@@ -385,13 +405,17 @@ encodeLoop:
 			case 4 | 3:
 				offset1, offset2, offset3 = offset1-1, offset1, offset2
 			}
+			if s >= sLimit {
+				if debugEncoder {
+					println("repeat ended", s, best.length)
+				}
+				break encodeLoop
+			}
 			continue
 		}
 
 		// A 4-byte match has been found. Update recent offsets.
 		// We'll later see if more than 4 bytes.
-		index0 := s + 1
-		s = best.s
 		t := best.offset
 		offset1, offset2, offset3 = s-t, offset1, offset2
 
@@ -418,19 +442,25 @@ encodeLoop:
 		}
 		blk.sequences = append(blk.sequences, seq)
 		nextEmit = s
-		if s >= sLimit {
-			break encodeLoop
+
+		// Index old s + 1 -> s - 1 or sLimit
+		end := s
+		if s > sLimit-4 {
+			end = sLimit - 4
 		}
 
-		// Index old s + 1 -> s - 1
-		for index0 < s {
+		off := index0 + e.cur
+		for index0 < end {
 			cv0 := load6432(src, index0)
 			h0 := hashLen(cv0, bestLongTableBits, bestLongLen)
 			h1 := hashLen(cv0, bestShortTableBits, bestShortLen)
-			off := index0 + e.cur
 			e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset}
 			e.table[h1] = prevEntry{offset: off, prev: e.table[h1].offset}
 			index0++
+			off++
+		}
+		if s >= sLimit {
+			break encodeLoop
 		}
 	}
 
diff --git a/vendor/github.com/klauspost/compress/zstd/enc_better.go b/vendor/github.com/klauspost/compress/zstd/enc_better.go
index 8582f31a7..a4f5bf91f 100644
--- a/vendor/github.com/klauspost/compress/zstd/enc_better.go
+++ b/vendor/github.com/klauspost/compress/zstd/enc_better.go
@@ -102,9 +102,20 @@ func (e *betterFastEncoder) Encode(blk *blockEnc, src []byte) {
 		e.cur = e.maxMatchOff
 		break
 	}
-
+	// Add block to history
 	s := e.addBlock(src)
 	blk.size = len(src)
+
+	// Check RLE first
+	if len(src) > zstdMinMatch {
+		ml := matchLen(src[1:], src)
+		if ml == len(src)-1 {
+			blk.literals = append(blk.literals, src[0])
+			blk.sequences = append(blk.sequences, seq{litLen: 1, matchLen: uint32(len(src)-1) - zstdMinMatch, offset: 1 + 3})
+			return
+		}
+	}
+
 	if len(src) < minNonLiteralBlockSize {
 		blk.extraLits = len(src)
 		blk.literals = blk.literals[:len(src)]
@@ -145,7 +156,7 @@ encodeLoop:
 		var t int32
 		// We allow the encoder to optionally turn off repeat offsets across blocks
 		canRepeat := len(blk.sequences) > 2
-		var matched int32
+		var matched, index0 int32
 
 		for {
 			if debugAsserts && canRepeat && offset1 == 0 {
@@ -162,6 +173,7 @@ encodeLoop:
 			off := s + e.cur
 			e.longTable[nextHashL] = prevEntry{offset: off, prev: candidateL.offset}
 			e.table[nextHashS] = tableEntry{offset: off, val: uint32(cv)}
+			index0 = s + 1
 
 			if canRepeat {
 				if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) {
@@ -258,7 +270,6 @@ encodeLoop:
 					}
 					blk.sequences = append(blk.sequences, seq)
 
-					index0 := s + repOff2
 					s += lenght + repOff2
 					nextEmit = s
 					if s >= sLimit {
@@ -498,15 +509,15 @@ encodeLoop:
 		}
 
 		// Index match start+1 (long) -> s - 1
-		index0 := s - l + 1
+		off := index0 + e.cur
 		for index0 < s-1 {
 			cv0 := load6432(src, index0)
 			cv1 := cv0 >> 8
 			h0 := hashLen(cv0, betterLongTableBits, betterLongLen)
-			off := index0 + e.cur
 			e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset}
 			e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)}
 			index0 += 2
+			off += 2
 		}
 
 		cv = load6432(src, s)
@@ -672,7 +683,7 @@ encodeLoop:
 		var t int32
 		// We allow the encoder to optionally turn off repeat offsets across blocks
 		canRepeat := len(blk.sequences) > 2
-		var matched int32
+		var matched, index0 int32
 
 		for {
 			if debugAsserts && canRepeat && offset1 == 0 {
@@ -691,6 +702,7 @@ encodeLoop:
 			e.markLongShardDirty(nextHashL)
 			e.table[nextHashS] = tableEntry{offset: off, val: uint32(cv)}
 			e.markShortShardDirty(nextHashS)
+			index0 = s + 1
 
 			if canRepeat {
 				if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) {
@@ -726,7 +738,6 @@ encodeLoop:
 					blk.sequences = append(blk.sequences, seq)
 
 					// Index match start+1 (long) -> s - 1
-					index0 := s + repOff
 					s += lenght + repOff
 
 					nextEmit = s
@@ -790,7 +801,6 @@ encodeLoop:
 					}
 					blk.sequences = append(blk.sequences, seq)
 
-					index0 := s + repOff2
 					s += lenght + repOff2
 					nextEmit = s
 					if s >= sLimit {
@@ -1024,18 +1034,18 @@ encodeLoop:
 		}
 
 		// Index match start+1 (long) -> s - 1
-		index0 := s - l + 1
+		off := index0 + e.cur
 		for index0 < s-1 {
 			cv0 := load6432(src, index0)
 			cv1 := cv0 >> 8
 			h0 := hashLen(cv0, betterLongTableBits, betterLongLen)
-			off := index0 + e.cur
 			e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset}
 			e.markLongShardDirty(h0)
 			h1 := hashLen(cv1, betterShortTableBits, betterShortLen)
 			e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)}
 			e.markShortShardDirty(h1)
 			index0 += 2
+			off += 2
 		}
 
 		cv = load6432(src, s)
diff --git a/vendor/github.com/klauspost/compress/zstd/encoder.go b/vendor/github.com/klauspost/compress/zstd/encoder.go
index 4de0aed0d..72af7ef0f 100644
--- a/vendor/github.com/klauspost/compress/zstd/encoder.go
+++ b/vendor/github.com/klauspost/compress/zstd/encoder.go
@@ -227,10 +227,7 @@ func (e *Encoder) nextBlock(final bool) error {
 			DictID:        e.o.dict.ID(),
 		}
 
-		dst, err := fh.appendTo(tmp[:0])
-		if err != nil {
-			return err
-		}
+		dst := fh.appendTo(tmp[:0])
 		s.headerWritten = true
 		s.wWg.Wait()
 		var n2 int
@@ -483,7 +480,7 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte {
 				Checksum: false,
 				DictID:   0,
 			}
-			dst, _ = fh.appendTo(dst)
+			dst = fh.appendTo(dst)
 
 			// Write raw block as last one only.
 			var blk blockHeader
@@ -518,10 +515,7 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte {
 	if len(dst) == 0 && cap(dst) == 0 && len(src) < 1<<20 && !e.o.lowMem {
 		dst = make([]byte, 0, len(src))
 	}
-	dst, err := fh.appendTo(dst)
-	if err != nil {
-		panic(err)
-	}
+	dst = fh.appendTo(dst)
 
 	// If we can do everything in one block, prefer that.
 	if len(src) <= e.o.blockSize {
@@ -581,6 +575,7 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte {
 	// Add padding with content from crypto/rand.Reader
 	if e.o.pad > 0 {
 		add := calcSkippableFrame(int64(len(dst)), int64(e.o.pad))
+		var err error
 		dst, err = skippableFrame(dst, add, rand.Reader)
 		if err != nil {
 			panic(err)
diff --git a/vendor/github.com/klauspost/compress/zstd/encoder_options.go b/vendor/github.com/klauspost/compress/zstd/encoder_options.go
index faaf81921..20671dcb9 100644
--- a/vendor/github.com/klauspost/compress/zstd/encoder_options.go
+++ b/vendor/github.com/klauspost/compress/zstd/encoder_options.go
@@ -94,7 +94,7 @@ func WithEncoderConcurrency(n int) EOption {
 // The value must be a power of two between MinWindowSize and MaxWindowSize.
 // A larger value will enable better compression but allocate more memory and,
 // for above-default values, take considerably longer.
-// The default value is determined by the compression level.
+// The default value is determined by the compression level and max 8MB.
 func WithWindowSize(n int) EOption {
 	return func(o *encoderOptions) error {
 		switch {
@@ -232,9 +232,9 @@ func WithEncoderLevel(l EncoderLevel) EOption {
 			case SpeedDefault:
 				o.windowSize = 8 << 20
 			case SpeedBetterCompression:
-				o.windowSize = 16 << 20
+				o.windowSize = 8 << 20
 			case SpeedBestCompression:
-				o.windowSize = 32 << 20
+				o.windowSize = 8 << 20
 			}
 		}
 		if !o.customALEntropy {
diff --git a/vendor/github.com/klauspost/compress/zstd/frameenc.go b/vendor/github.com/klauspost/compress/zstd/frameenc.go
index 4ef7f5a3e..667ca0679 100644
--- a/vendor/github.com/klauspost/compress/zstd/frameenc.go
+++ b/vendor/github.com/klauspost/compress/zstd/frameenc.go
@@ -22,7 +22,7 @@ type frameHeader struct {
 
 const maxHeaderSize = 14
 
-func (f frameHeader) appendTo(dst []byte) ([]byte, error) {
+func (f frameHeader) appendTo(dst []byte) []byte {
 	dst = append(dst, frameMagic...)
 	var fhd uint8
 	if f.Checksum {
@@ -76,7 +76,7 @@ func (f frameHeader) appendTo(dst []byte) ([]byte, error) {
 		if f.SingleSegment {
 			dst = append(dst, uint8(f.ContentSize))
 		}
-		// Unless SingleSegment is set, framessizes < 256 are nto stored.
+		// Unless SingleSegment is set, framessizes < 256 are not stored.
 	case 1:
 		f.ContentSize -= 256
 		dst = append(dst, uint8(f.ContentSize), uint8(f.ContentSize>>8))
@@ -88,7 +88,7 @@ func (f frameHeader) appendTo(dst []byte) ([]byte, error) {
 	default:
 		panic("invalid fcs")
 	}
-	return dst, nil
+	return dst
 }
 
 const skippableFrameHeader = 4 + 4
diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go
index 332e51fe4..8adfebb02 100644
--- a/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go
+++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go
@@ -20,10 +20,9 @@ func (s *fseDecoder) buildDtable() error {
 			if v == -1 {
 				s.dt[highThreshold].setAddBits(uint8(i))
 				highThreshold--
-				symbolNext[i] = 1
-			} else {
-				symbolNext[i] = uint16(v)
+				v = 1
 			}
+			symbolNext[i] = uint16(v)
 		}
 	}
 
@@ -35,10 +34,12 @@ func (s *fseDecoder) buildDtable() error {
 		for ss, v := range s.norm[:s.symbolLen] {
 			for i := 0; i < int(v); i++ {
 				s.dt[position].setAddBits(uint8(ss))
-				position = (position + step) & tableMask
-				for position > highThreshold {
+				for {
 					// lowprob area
 					position = (position + step) & tableMask
+					if position <= highThreshold {
+						break
+					}
 				}
 			}
 		}
diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec.go b/vendor/github.com/klauspost/compress/zstd/seqdec.go
index 9405fcf10..d7fe6d82d 100644
--- a/vendor/github.com/klauspost/compress/zstd/seqdec.go
+++ b/vendor/github.com/klauspost/compress/zstd/seqdec.go
@@ -245,7 +245,7 @@ func (s *sequenceDecs) decodeSync(hist []byte) error {
 			return io.ErrUnexpectedEOF
 		}
 		var ll, mo, ml int
-		if br.off > 4+((maxOffsetBits+16+16)>>3) {
+		if len(br.in) > 4+((maxOffsetBits+16+16)>>3) {
 			// inlined function:
 			// ll, mo, ml = s.nextFast(br, llState, mlState, ofState)
 
@@ -452,18 +452,13 @@ func (s *sequenceDecs) next(br *bitReader, llState, mlState, ofState decSymbol)
 
 	// extra bits are stored in reverse order.
 	br.fill()
-	if s.maxBits <= 32 {
-		mo += br.getBits(moB)
-		ml += br.getBits(mlB)
-		ll += br.getBits(llB)
-	} else {
-		mo += br.getBits(moB)
+	mo += br.getBits(moB)
+	if s.maxBits > 32 {
 		br.fill()
-		// matchlength+literal length, max 32 bits
-		ml += br.getBits(mlB)
-		ll += br.getBits(llB)
-
 	}
+	// matchlength+literal length, max 32 bits
+	ml += br.getBits(mlB)
+	ll += br.getBits(llB)
 	mo = s.adjustOffset(mo, ll, moB)
 	return
 }
diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s
index b6f4ba6fc..5b06174b8 100644
--- a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s
+++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s
@@ -5,11 +5,11 @@
 // func sequenceDecs_decode_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int
 // Requires: CMOV
 TEXT ·sequenceDecs_decode_amd64(SB), $8-32
-	MOVQ    br+8(FP), AX
-	MOVQ    32(AX), DX
-	MOVBQZX 40(AX), BX
-	MOVQ    24(AX), SI
-	MOVQ    (AX), AX
+	MOVQ    br+8(FP), CX
+	MOVQ    24(CX), DX
+	MOVBQZX 32(CX), BX
+	MOVQ    (CX), AX
+	MOVQ    8(CX), SI
 	ADDQ    SI, AX
 	MOVQ    AX, (SP)
 	MOVQ    ctx+16(FP), AX
@@ -157,8 +157,7 @@ sequenceDecs_decode_amd64_ll_update_zero:
 
 	// Update Literal Length State
 	MOVBQZX DI, R14
-	SHRQ    $0x10, DI
-	MOVWQZX DI, DI
+	SHRL    $0x10, DI
 	LEAQ    (BX)(R14*1), CX
 	MOVQ    DX, R15
 	MOVQ    CX, BX
@@ -177,8 +176,7 @@ sequenceDecs_decode_amd64_ll_update_zero:
 
 	// Update Match Length State
 	MOVBQZX R8, R14
-	SHRQ    $0x10, R8
-	MOVWQZX R8, R8
+	SHRL    $0x10, R8
 	LEAQ    (BX)(R14*1), CX
 	MOVQ    DX, R15
 	MOVQ    CX, BX
@@ -197,8 +195,7 @@ sequenceDecs_decode_amd64_ll_update_zero:
 
 	// Update Offset State
 	MOVBQZX R9, R14
-	SHRQ    $0x10, R9
-	MOVWQZX R9, R9
+	SHRL    $0x10, R9
 	LEAQ    (BX)(R14*1), CX
 	MOVQ    DX, R15
 	MOVQ    CX, BX
@@ -301,9 +298,9 @@ sequenceDecs_decode_amd64_match_len_ofs_ok:
 	MOVQ R12, 152(AX)
 	MOVQ R13, 160(AX)
 	MOVQ br+8(FP), AX
-	MOVQ DX, 32(AX)
-	MOVB BL, 40(AX)
-	MOVQ SI, 24(AX)
+	MOVQ DX, 24(AX)
+	MOVB BL, 32(AX)
+	MOVQ SI, 8(AX)
 
 	// Return success
 	MOVQ $0x00000000, ret+24(FP)
@@ -336,11 +333,11 @@ error_overread:
 // func sequenceDecs_decode_56_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int
 // Requires: CMOV
 TEXT ·sequenceDecs_decode_56_amd64(SB), $8-32
-	MOVQ    br+8(FP), AX
-	MOVQ    32(AX), DX
-	MOVBQZX 40(AX), BX
-	MOVQ    24(AX), SI
-	MOVQ    (AX), AX
+	MOVQ    br+8(FP), CX
+	MOVQ    24(CX), DX
+	MOVBQZX 32(CX), BX
+	MOVQ    (CX), AX
+	MOVQ    8(CX), SI
 	ADDQ    SI, AX
 	MOVQ    AX, (SP)
 	MOVQ    ctx+16(FP), AX
@@ -459,8 +456,7 @@ sequenceDecs_decode_56_amd64_ll_update_zero:
 
 	// Update Literal Length State
 	MOVBQZX DI, R14
-	SHRQ    $0x10, DI
-	MOVWQZX DI, DI
+	SHRL    $0x10, DI
 	LEAQ    (BX)(R14*1), CX
 	MOVQ    DX, R15
 	MOVQ    CX, BX
@@ -479,8 +475,7 @@ sequenceDecs_decode_56_amd64_ll_update_zero:
 
 	// Update Match Length State
 	MOVBQZX R8, R14
-	SHRQ    $0x10, R8
-	MOVWQZX R8, R8
+	SHRL    $0x10, R8
 	LEAQ    (BX)(R14*1), CX
 	MOVQ    DX, R15
 	MOVQ    CX, BX
@@ -499,8 +494,7 @@ sequenceDecs_decode_56_amd64_ll_update_zero:
 
 	// Update Offset State
 	MOVBQZX R9, R14
-	SHRQ    $0x10, R9
-	MOVWQZX R9, R9
+	SHRL    $0x10, R9
 	LEAQ    (BX)(R14*1), CX
 	MOVQ    DX, R15
 	MOVQ    CX, BX
@@ -603,9 +597,9 @@ sequenceDecs_decode_56_amd64_match_len_ofs_ok:
 	MOVQ R12, 152(AX)
 	MOVQ R13, 160(AX)
 	MOVQ br+8(FP), AX
-	MOVQ DX, 32(AX)
-	MOVB BL, 40(AX)
-	MOVQ SI, 24(AX)
+	MOVQ DX, 24(AX)
+	MOVB BL, 32(AX)
+	MOVQ SI, 8(AX)
 
 	// Return success
 	MOVQ $0x00000000, ret+24(FP)
@@ -638,11 +632,11 @@ error_overread:
 // func sequenceDecs_decode_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int
 // Requires: BMI, BMI2, CMOV
 TEXT ·sequenceDecs_decode_bmi2(SB), $8-32
-	MOVQ    br+8(FP), CX
-	MOVQ    32(CX), AX
-	MOVBQZX 40(CX), DX
-	MOVQ    24(CX), BX
-	MOVQ    (CX), CX
+	MOVQ    br+8(FP), BX
+	MOVQ    24(BX), AX
+	MOVBQZX 32(BX), DX
+	MOVQ    (BX), CX
+	MOVQ    8(BX), BX
 	ADDQ    BX, CX
 	MOVQ    CX, (SP)
 	MOVQ    ctx+16(FP), CX
@@ -772,11 +766,10 @@ sequenceDecs_decode_bmi2_fill_2_end:
 	BZHIQ   R14, R15, R15
 
 	// Update Offset State
-	BZHIQ  R8, R15, CX
-	SHRXQ  R8, R15, R15
-	MOVQ   $0x00001010, R14
-	BEXTRQ R14, R8, R8
-	ADDQ   CX, R8
+	BZHIQ R8, R15, CX
+	SHRXQ R8, R15, R15
+	SHRL  $0x10, R8
+	ADDQ  CX, R8
 
 	// Load ctx.ofTable
 	MOVQ ctx+16(FP), CX
@@ -784,11 +777,10 @@ sequenceDecs_decode_bmi2_fill_2_end:
 	MOVQ (CX)(R8*8), R8
 
 	// Update Match Length State
-	BZHIQ  DI, R15, CX
-	SHRXQ  DI, R15, R15
-	MOVQ   $0x00001010, R14
-	BEXTRQ R14, DI, DI
-	ADDQ   CX, DI
+	BZHIQ DI, R15, CX
+	SHRXQ DI, R15, R15
+	SHRL  $0x10, DI
+	ADDQ  CX, DI
 
 	// Load ctx.mlTable
 	MOVQ ctx+16(FP), CX
@@ -796,10 +788,9 @@ sequenceDecs_decode_bmi2_fill_2_end:
 	MOVQ (CX)(DI*8), DI
 
 	// Update Literal Length State
-	BZHIQ  SI, R15, CX
-	MOVQ   $0x00001010, R14
-	BEXTRQ R14, SI, SI
-	ADDQ   CX, SI
+	BZHIQ SI, R15, CX
+	SHRL  $0x10, SI
+	ADDQ  CX, SI
 
 	// Load ctx.llTable
 	MOVQ ctx+16(FP), CX
@@ -892,9 +883,9 @@ sequenceDecs_decode_bmi2_match_len_ofs_ok:
 	MOVQ R11, 152(CX)
 	MOVQ R12, 160(CX)
 	MOVQ br+8(FP), CX
-	MOVQ AX, 32(CX)
-	MOVB DL, 40(CX)
-	MOVQ BX, 24(CX)
+	MOVQ AX, 24(CX)
+	MOVB DL, 32(CX)
+	MOVQ BX, 8(CX)
 
 	// Return success
 	MOVQ $0x00000000, ret+24(FP)
@@ -927,11 +918,11 @@ error_overread:
 // func sequenceDecs_decode_56_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int
 // Requires: BMI, BMI2, CMOV
 TEXT ·sequenceDecs_decode_56_bmi2(SB), $8-32
-	MOVQ    br+8(FP), CX
-	MOVQ    32(CX), AX
-	MOVBQZX 40(CX), DX
-	MOVQ    24(CX), BX
-	MOVQ    (CX), CX
+	MOVQ    br+8(FP), BX
+	MOVQ    24(BX), AX
+	MOVBQZX 32(BX), DX
+	MOVQ    (BX), CX
+	MOVQ    8(BX), BX
 	ADDQ    BX, CX
 	MOVQ    CX, (SP)
 	MOVQ    ctx+16(FP), CX
@@ -1032,11 +1023,10 @@ sequenceDecs_decode_56_bmi2_fill_end:
 	BZHIQ   R14, R15, R15
 
 	// Update Offset State
-	BZHIQ  R8, R15, CX
-	SHRXQ  R8, R15, R15
-	MOVQ   $0x00001010, R14
-	BEXTRQ R14, R8, R8
-	ADDQ   CX, R8
+	BZHIQ R8, R15, CX
+	SHRXQ R8, R15, R15
+	SHRL  $0x10, R8
+	ADDQ  CX, R8
 
 	// Load ctx.ofTable
 	MOVQ ctx+16(FP), CX
@@ -1044,11 +1034,10 @@ sequenceDecs_decode_56_bmi2_fill_end:
 	MOVQ (CX)(R8*8), R8
 
 	// Update Match Length State
-	BZHIQ  DI, R15, CX
-	SHRXQ  DI, R15, R15
-	MOVQ   $0x00001010, R14
-	BEXTRQ R14, DI, DI
-	ADDQ   CX, DI
+	BZHIQ DI, R15, CX
+	SHRXQ DI, R15, R15
+	SHRL  $0x10, DI
+	ADDQ  CX, DI
 
 	// Load ctx.mlTable
 	MOVQ ctx+16(FP), CX
@@ -1056,10 +1045,9 @@ sequenceDecs_decode_56_bmi2_fill_end:
 	MOVQ (CX)(DI*8), DI
 
 	// Update Literal Length State
-	BZHIQ  SI, R15, CX
-	MOVQ   $0x00001010, R14
-	BEXTRQ R14, SI, SI
-	ADDQ   CX, SI
+	BZHIQ SI, R15, CX
+	SHRL  $0x10, SI
+	ADDQ  CX, SI
 
 	// Load ctx.llTable
 	MOVQ ctx+16(FP), CX
@@ -1152,9 +1140,9 @@ sequenceDecs_decode_56_bmi2_match_len_ofs_ok:
 	MOVQ R11, 152(CX)
 	MOVQ R12, 160(CX)
 	MOVQ br+8(FP), CX
-	MOVQ AX, 32(CX)
-	MOVB DL, 40(CX)
-	MOVQ BX, 24(CX)
+	MOVQ AX, 24(CX)
+	MOVB DL, 32(CX)
+	MOVQ BX, 8(CX)
 
 	// Return success
 	MOVQ $0x00000000, ret+24(FP)
@@ -1797,11 +1785,11 @@ empty_seqs:
 // func sequenceDecs_decodeSync_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int
 // Requires: CMOV, SSE
 TEXT ·sequenceDecs_decodeSync_amd64(SB), $64-32
-	MOVQ    br+8(FP), AX
-	MOVQ    32(AX), DX
-	MOVBQZX 40(AX), BX
-	MOVQ    24(AX), SI
-	MOVQ    (AX), AX
+	MOVQ    br+8(FP), CX
+	MOVQ    24(CX), DX
+	MOVBQZX 32(CX), BX
+	MOVQ    (CX), AX
+	MOVQ    8(CX), SI
 	ADDQ    SI, AX
 	MOVQ    AX, (SP)
 	MOVQ    ctx+16(FP), AX
@@ -1967,8 +1955,7 @@ sequenceDecs_decodeSync_amd64_ll_update_zero:
 
 	// Update Literal Length State
 	MOVBQZX DI, R13
-	SHRQ    $0x10, DI
-	MOVWQZX DI, DI
+	SHRL    $0x10, DI
 	LEAQ    (BX)(R13*1), CX
 	MOVQ    DX, R14
 	MOVQ    CX, BX
@@ -1987,8 +1974,7 @@ sequenceDecs_decodeSync_amd64_ll_update_zero:
 
 	// Update Match Length State
 	MOVBQZX R8, R13
-	SHRQ    $0x10, R8
-	MOVWQZX R8, R8
+	SHRL    $0x10, R8
 	LEAQ    (BX)(R13*1), CX
 	MOVQ    DX, R14
 	MOVQ    CX, BX
@@ -2007,8 +1993,7 @@ sequenceDecs_decodeSync_amd64_ll_update_zero:
 
 	// Update Offset State
 	MOVBQZX R9, R13
-	SHRQ    $0x10, R9
-	MOVWQZX R9, R9
+	SHRL    $0x10, R9
 	LEAQ    (BX)(R13*1), CX
 	MOVQ    DX, R14
 	MOVQ    CX, BX
@@ -2295,9 +2280,9 @@ handle_loop:
 
 loop_finished:
 	MOVQ br+8(FP), AX
-	MOVQ DX, 32(AX)
-	MOVB BL, 40(AX)
-	MOVQ SI, 24(AX)
+	MOVQ DX, 24(AX)
+	MOVB BL, 32(AX)
+	MOVQ SI, 8(AX)
 
 	// Update the context
 	MOVQ ctx+16(FP), AX
@@ -2362,11 +2347,11 @@ error_not_enough_space:
 // func sequenceDecs_decodeSync_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int
 // Requires: BMI, BMI2, CMOV, SSE
 TEXT ·sequenceDecs_decodeSync_bmi2(SB), $64-32
-	MOVQ    br+8(FP), CX
-	MOVQ    32(CX), AX
-	MOVBQZX 40(CX), DX
-	MOVQ    24(CX), BX
-	MOVQ    (CX), CX
+	MOVQ    br+8(FP), BX
+	MOVQ    24(BX), AX
+	MOVBQZX 32(BX), DX
+	MOVQ    (BX), CX
+	MOVQ    8(BX), BX
 	ADDQ    BX, CX
 	MOVQ    CX, (SP)
 	MOVQ    ctx+16(FP), CX
@@ -2514,11 +2499,10 @@ sequenceDecs_decodeSync_bmi2_fill_2_end:
 	BZHIQ   R13, R14, R14
 
 	// Update Offset State
-	BZHIQ  R8, R14, CX
-	SHRXQ  R8, R14, R14
-	MOVQ   $0x00001010, R13
-	BEXTRQ R13, R8, R8
-	ADDQ   CX, R8
+	BZHIQ R8, R14, CX
+	SHRXQ R8, R14, R14
+	SHRL  $0x10, R8
+	ADDQ  CX, R8
 
 	// Load ctx.ofTable
 	MOVQ ctx+16(FP), CX
@@ -2526,11 +2510,10 @@ sequenceDecs_decodeSync_bmi2_fill_2_end:
 	MOVQ (CX)(R8*8), R8
 
 	// Update Match Length State
-	BZHIQ  DI, R14, CX
-	SHRXQ  DI, R14, R14
-	MOVQ   $0x00001010, R13
-	BEXTRQ R13, DI, DI
-	ADDQ   CX, DI
+	BZHIQ DI, R14, CX
+	SHRXQ DI, R14, R14
+	SHRL  $0x10, DI
+	ADDQ  CX, DI
 
 	// Load ctx.mlTable
 	MOVQ ctx+16(FP), CX
@@ -2538,10 +2521,9 @@ sequenceDecs_decodeSync_bmi2_fill_2_end:
 	MOVQ (CX)(DI*8), DI
 
 	// Update Literal Length State
-	BZHIQ  SI, R14, CX
-	MOVQ   $0x00001010, R13
-	BEXTRQ R13, SI, SI
-	ADDQ   CX, SI
+	BZHIQ SI, R14, CX
+	SHRL  $0x10, SI
+	ADDQ  CX, SI
 
 	// Load ctx.llTable
 	MOVQ ctx+16(FP), CX
@@ -2818,9 +2800,9 @@ handle_loop:
 
 loop_finished:
 	MOVQ br+8(FP), CX
-	MOVQ AX, 32(CX)
-	MOVB DL, 40(CX)
-	MOVQ BX, 24(CX)
+	MOVQ AX, 24(CX)
+	MOVB DL, 32(CX)
+	MOVQ BX, 8(CX)
 
 	// Update the context
 	MOVQ ctx+16(FP), AX
@@ -2885,11 +2867,11 @@ error_not_enough_space:
 // func sequenceDecs_decodeSync_safe_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int
 // Requires: CMOV, SSE
 TEXT ·sequenceDecs_decodeSync_safe_amd64(SB), $64-32
-	MOVQ    br+8(FP), AX
-	MOVQ    32(AX), DX
-	MOVBQZX 40(AX), BX
-	MOVQ    24(AX), SI
-	MOVQ    (AX), AX
+	MOVQ    br+8(FP), CX
+	MOVQ    24(CX), DX
+	MOVBQZX 32(CX), BX
+	MOVQ    (CX), AX
+	MOVQ    8(CX), SI
 	ADDQ    SI, AX
 	MOVQ    AX, (SP)
 	MOVQ    ctx+16(FP), AX
@@ -3055,8 +3037,7 @@ sequenceDecs_decodeSync_safe_amd64_ll_update_zero:
 
 	// Update Literal Length State
 	MOVBQZX DI, R13
-	SHRQ    $0x10, DI
-	MOVWQZX DI, DI
+	SHRL    $0x10, DI
 	LEAQ    (BX)(R13*1), CX
 	MOVQ    DX, R14
 	MOVQ    CX, BX
@@ -3075,8 +3056,7 @@ sequenceDecs_decodeSync_safe_amd64_ll_update_zero:
 
 	// Update Match Length State
 	MOVBQZX R8, R13
-	SHRQ    $0x10, R8
-	MOVWQZX R8, R8
+	SHRL    $0x10, R8
 	LEAQ    (BX)(R13*1), CX
 	MOVQ    DX, R14
 	MOVQ    CX, BX
@@ -3095,8 +3075,7 @@ sequenceDecs_decodeSync_safe_amd64_ll_update_zero:
 
 	// Update Offset State
 	MOVBQZX R9, R13
-	SHRQ    $0x10, R9
-	MOVWQZX R9, R9
+	SHRL    $0x10, R9
 	LEAQ    (BX)(R13*1), CX
 	MOVQ    DX, R14
 	MOVQ    CX, BX
@@ -3485,9 +3464,9 @@ handle_loop:
 
 loop_finished:
 	MOVQ br+8(FP), AX
-	MOVQ DX, 32(AX)
-	MOVB BL, 40(AX)
-	MOVQ SI, 24(AX)
+	MOVQ DX, 24(AX)
+	MOVB BL, 32(AX)
+	MOVQ SI, 8(AX)
 
 	// Update the context
 	MOVQ ctx+16(FP), AX
@@ -3552,11 +3531,11 @@ error_not_enough_space:
 // func sequenceDecs_decodeSync_safe_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int
 // Requires: BMI, BMI2, CMOV, SSE
 TEXT ·sequenceDecs_decodeSync_safe_bmi2(SB), $64-32
-	MOVQ    br+8(FP), CX
-	MOVQ    32(CX), AX
-	MOVBQZX 40(CX), DX
-	MOVQ    24(CX), BX
-	MOVQ    (CX), CX
+	MOVQ    br+8(FP), BX
+	MOVQ    24(BX), AX
+	MOVBQZX 32(BX), DX
+	MOVQ    (BX), CX
+	MOVQ    8(BX), BX
 	ADDQ    BX, CX
 	MOVQ    CX, (SP)
 	MOVQ    ctx+16(FP), CX
@@ -3704,11 +3683,10 @@ sequenceDecs_decodeSync_safe_bmi2_fill_2_end:
 	BZHIQ   R13, R14, R14
 
 	// Update Offset State
-	BZHIQ  R8, R14, CX
-	SHRXQ  R8, R14, R14
-	MOVQ   $0x00001010, R13
-	BEXTRQ R13, R8, R8
-	ADDQ   CX, R8
+	BZHIQ R8, R14, CX
+	SHRXQ R8, R14, R14
+	SHRL  $0x10, R8
+	ADDQ  CX, R8
 
 	// Load ctx.ofTable
 	MOVQ ctx+16(FP), CX
@@ -3716,11 +3694,10 @@ sequenceDecs_decodeSync_safe_bmi2_fill_2_end:
 	MOVQ (CX)(R8*8), R8
 
 	// Update Match Length State
-	BZHIQ  DI, R14, CX
-	SHRXQ  DI, R14, R14
-	MOVQ   $0x00001010, R13
-	BEXTRQ R13, DI, DI
-	ADDQ   CX, DI
+	BZHIQ DI, R14, CX
+	SHRXQ DI, R14, R14
+	SHRL  $0x10, DI
+	ADDQ  CX, DI
 
 	// Load ctx.mlTable
 	MOVQ ctx+16(FP), CX
@@ -3728,10 +3705,9 @@ sequenceDecs_decodeSync_safe_bmi2_fill_2_end:
 	MOVQ (CX)(DI*8), DI
 
 	// Update Literal Length State
-	BZHIQ  SI, R14, CX
-	MOVQ   $0x00001010, R13
-	BEXTRQ R13, SI, SI
-	ADDQ   CX, SI
+	BZHIQ SI, R14, CX
+	SHRL  $0x10, SI
+	ADDQ  CX, SI
 
 	// Load ctx.llTable
 	MOVQ ctx+16(FP), CX
@@ -4110,9 +4086,9 @@ handle_loop:
 
 loop_finished:
 	MOVQ br+8(FP), CX
-	MOVQ AX, 32(CX)
-	MOVB DL, 40(CX)
-	MOVQ BX, 24(CX)
+	MOVQ AX, 24(CX)
+	MOVB DL, 32(CX)
+	MOVQ BX, 8(CX)
 
 	// Update the context
 	MOVQ ctx+16(FP), AX
diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go
index ac2a80d29..2fb35b788 100644
--- a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go
+++ b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go
@@ -29,7 +29,7 @@ func (s *sequenceDecs) decode(seqs []seqVals) error {
 	}
 	for i := range seqs {
 		var ll, mo, ml int
-		if br.off > 4+((maxOffsetBits+16+16)>>3) {
+		if len(br.in) > 4+((maxOffsetBits+16+16)>>3) {
 			// inlined function:
 			// ll, mo, ml = s.nextFast(br, llState, mlState, ofState)
 
diff --git a/vendor/github.com/klauspost/compress/zstd/snappy.go b/vendor/github.com/klauspost/compress/zstd/snappy.go
index 9e1baad73..ec13594e8 100644
--- a/vendor/github.com/klauspost/compress/zstd/snappy.go
+++ b/vendor/github.com/klauspost/compress/zstd/snappy.go
@@ -95,10 +95,9 @@ func (r *SnappyConverter) Convert(in io.Reader, w io.Writer) (int64, error) {
 	var written int64
 	var readHeader bool
 	{
-		var header []byte
-		var n int
-		header, r.err = frameHeader{WindowSize: snappyMaxBlockSize}.appendTo(r.buf[:0])
+		header := frameHeader{WindowSize: snappyMaxBlockSize}.appendTo(r.buf[:0])
 
+		var n int
 		n, r.err = w.Write(header)
 		if r.err != nil {
 			return written, r.err
diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md
index bc2f98f00..30f8d2963 100644
--- a/vendor/github.com/klauspost/cpuid/v2/README.md
+++ b/vendor/github.com/klauspost/cpuid/v2/README.md
@@ -9,17 +9,27 @@ You can access the CPU information by accessing the shared CPU variable of the c
 Package home: https://github.com/klauspost/cpuid
 
 [![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
-[![Build Status][3]][4]
-
-[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master
-[4]: https://travis-ci.org/klauspost/cpuid
+[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
 
 ## installing
 
-`go get -u github.com/klauspost/cpuid/v2` using modules. 
-
+`go get -u github.com/klauspost/cpuid/v2` using modules.
 Drop `v2` for others.
 
+Installing binary:
+
+`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
+
+Or download binaries from release page: https://github.com/klauspost/cpuid/releases
+
+### Homebrew
+
+For macOS/Linux users, you can install via [brew](https://brew.sh/)
+
+```sh
+$ brew install cpuid
+```
+
 ## example
 
 ```Go
@@ -77,10 +87,14 @@ We have Streaming SIMD 2 Extensions
 The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
 A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.  
 
+To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
+This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
+
 Note that for some cpu/os combinations some features will not be detected.
 `amd64` has rather good support and should work reliably on all platforms.
 
-Note that hypervisors may not pass through all CPU features.
+Note that hypervisors may not pass through all CPU features through to the guest OS,
+so even if your host supports a feature it may not be visible on guests.
 
 ## arm64 feature detection
 
@@ -132,6 +146,352 @@ func main() {
 }
 ```
 
+## commandline
+
+Download as binary from: https://github.com/klauspost/cpuid/releases
+
+Install from source:
+
+`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
+
+### Example
+
+```
+λ cpuid
+Name: AMD Ryzen 9 3950X 16-Core Processor
+Vendor String: AuthenticAMD
+Vendor ID: AMD
+PhysicalCores: 16
+Threads Per Core: 2
+Logical Cores: 32
+CPU Family 23 Model: 113
+Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
+Microarchitecture level: 3
+Cacheline bytes: 64
+L1 Instruction Cache: 32768 bytes
+L1 Data Cache: 32768 bytes
+L2 Cache: 524288 bytes
+L3 Cache: 16777216 bytes
+
+```
+### JSON Output:
+
+```
+λ cpuid --json
+{
+  "BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
+  "VendorID": 2,
+  "VendorString": "AuthenticAMD",
+  "PhysicalCores": 16,
+  "ThreadsPerCore": 2,
+  "LogicalCores": 32,
+  "Family": 23,
+  "Model": 113,
+  "CacheLine": 64,
+  "Hz": 0,
+  "BoostFreq": 0,
+  "Cache": {
+    "L1I": 32768,
+    "L1D": 32768,
+    "L2": 524288,
+    "L3": 16777216
+  },
+  "SGX": {
+    "Available": false,
+    "LaunchControl": false,
+    "SGX1Supported": false,
+    "SGX2Supported": false,
+    "MaxEnclaveSizeNot64": 0,
+    "MaxEnclaveSize64": 0,
+    "EPCSections": null
+  },
+  "Features": [
+    "ADX",
+    "AESNI",
+    "AVX",
+    "AVX2",
+    "BMI1",
+    "BMI2",
+    "CLMUL",
+    "CLZERO",
+    "CMOV",
+    "CMPXCHG8",
+    "CPBOOST",
+    "CX16",
+    "F16C",
+    "FMA3",
+    "FXSR",
+    "FXSROPT",
+    "HTT",
+    "HYPERVISOR",
+    "LAHF",
+    "LZCNT",
+    "MCAOVERFLOW",
+    "MMX",
+    "MMXEXT",
+    "MOVBE",
+    "NX",
+    "OSXSAVE",
+    "POPCNT",
+    "RDRAND",
+    "RDSEED",
+    "RDTSCP",
+    "SCE",
+    "SHA",
+    "SSE",
+    "SSE2",
+    "SSE3",
+    "SSE4",
+    "SSE42",
+    "SSE4A",
+    "SSSE3",
+    "SUCCOR",
+    "X87",
+    "XSAVE"
+  ],
+  "X64Level": 3
+}
+```
+
+### Check CPU microarch level
+
+```
+λ cpuid --check-level=3
+2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
+2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
+Exit Code 0
+
+λ cpuid --check-level=4
+2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
+2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
+Exit Code 1
+```
+
+
+## Available flags
+
+### x86 & amd64 
+
+| Feature Flag       | Description                                                                                                                                                                        |
+|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
+| ADX                | Intel ADX (Multi-Precision Add-Carry Instruction Extensions)                                                                                                                       |
+| AESNI              | Advanced Encryption Standard New Instructions                                                                                                                                      |
+| AMD3DNOW           | AMD 3DNOW                                                                                                                                                                          |
+| AMD3DNOWEXT        | AMD 3DNowExt                                                                                                                                                                       |
+| AMXBF16            | Tile computational operations on BFLOAT16 numbers                                                                                                                                  |
+| AMXINT8            | Tile computational operations on 8-bit integers                                                                                                                                    |
+| AMXFP16            | Tile computational operations on FP16 numbers                                                                                                                                      |
+| AMXTILE            | Tile architecture                                                                                                                                                                  |
+| APX_F              | Intel APX                                                                                                                                                                          |
+| AVX                | AVX functions                                                                                                                                                                      |
+| AVX10              | If set the Intel AVX10 Converged Vector ISA is supported                                                                                                                           |
+| AVX10_128          | If set indicates that AVX10 128-bit vector support is present                                                                                                                      |
+| AVX10_256          | If set indicates that AVX10 256-bit vector support is present                                                                                                                      |
+| AVX10_512          | If set indicates that AVX10 512-bit vector support is present                                                                                                                      |
+| AVX2               | AVX2 functions                                                                                                                                                                     |
+| AVX512BF16         | AVX-512 BFLOAT16 Instructions                                                                                                                                                      |
+| AVX512BITALG       | AVX-512 Bit Algorithms                                                                                                                                                             |
+| AVX512BW           | AVX-512 Byte and Word Instructions                                                                                                                                                 |
+| AVX512CD           | AVX-512 Conflict Detection Instructions                                                                                                                                            |
+| AVX512DQ           | AVX-512 Doubleword and Quadword Instructions                                                                                                                                       |
+| AVX512ER           | AVX-512 Exponential and Reciprocal Instructions                                                                                                                                    |
+| AVX512F            | AVX-512 Foundation                                                                                                                                                                 |
+| AVX512FP16         | AVX-512 FP16 Instructions                                                                                                                                                          |
+| AVX512IFMA         | AVX-512 Integer Fused Multiply-Add Instructions                                                                                                                                    |
+| AVX512PF           | AVX-512 Prefetch Instructions                                                                                                                                                      |
+| AVX512VBMI         | AVX-512 Vector Bit Manipulation Instructions                                                                                                                                       |
+| AVX512VBMI2        | AVX-512 Vector Bit Manipulation Instructions, Version 2                                                                                                                            |
+| AVX512VL           | AVX-512 Vector Length Extensions                                                                                                                                                   |
+| AVX512VNNI         | AVX-512 Vector Neural Network Instructions                                                                                                                                         |
+| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q                                                                                                                                                          |
+| AVX512VPOPCNTDQ    | AVX-512 Vector Population Count Doubleword and Quadword                                                                                                                            |
+| AVXIFMA            | AVX-IFMA instructions                                                                                                                                                              |
+| AVXNECONVERT       | AVX-NE-CONVERT instructions                                                                                                                                                        |
+| AVXSLOW            | Indicates the CPU performs 2 128 bit operations instead of one                                                                                                                     |
+| AVXVNNI            | AVX (VEX encoded) VNNI neural network instructions                                                                                                                                 |
+| AVXVNNIINT8        | AVX-VNNI-INT8 instructions                                                                                                                                                         |
+| BHI_CTRL           | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598                                                                    |
+| BMI1               | Bit Manipulation Instruction Set 1                                                                                                                                                 |
+| BMI2               | Bit Manipulation Instruction Set 2                                                                                                                                                 |
+| CETIBT             | Intel CET Indirect Branch Tracking                                                                                                                                                 |
+| CETSS              | Intel CET Shadow Stack                                                                                                                                                             |
+| CLDEMOTE           | Cache Line Demote                                                                                                                                                                  |
+| CLMUL              | Carry-less Multiplication                                                                                                                                                          |
+| CLZERO             | CLZERO instruction supported                                                                                                                                                       |
+| CMOV               | i686 CMOV                                                                                                                                                                          |
+| CMPCCXADD          | CMPCCXADD instructions                                                                                                                                                             |
+| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB                                                                                                                                                         |
+| CMPXCHG8           | CMPXCHG8 instruction                                                                                                                                                               |
+| CPBOOST            | Core Performance Boost                                                                                                                                                             |
+| CPPC               | AMD: Collaborative Processor Performance Control                                                                                                                                   |
+| CX16               | CMPXCHG16B Instruction                                                                                                                                                             |
+| EFER_LMSLE_UNS     | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ                                                                                                                        |
+| ENQCMD             | Enqueue Command                                                                                                                                                                    |
+| ERMS               | Enhanced REP MOVSB/STOSB                                                                                                                                                           |
+| F16C               | Half-precision floating-point conversion                                                                                                                                           |
+| FLUSH_L1D          | Flush L1D cache                                                                                                                                                                    |
+| FMA3               | Intel FMA 3. Does not imply AVX.                                                                                                                                                   |
+| FMA4               | Bulldozer FMA4 functions                                                                                                                                                           |
+| FP128              | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide                                                                                                            |
+| FP256              | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide                                                                                                            |
+| FSRM               | Fast Short Rep Mov                                                                                                                                                                 |
+| FXSR               | FXSAVE, FXRESTOR instructions, CR4 bit 9                                                                                                                                           |
+| FXSROPT            | FXSAVE/FXRSTOR optimizations                                                                                                                                                       |
+| GFNI               | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.                                                                                  |
+| HLE                | Hardware Lock Elision                                                                                                                                                              |
+| HRESET             | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR                                                                                                                   |
+| HTT                | Hyperthreading (enabled)                                                                                                                                                           |
+| HWA                | Hardware assert supported. Indicates support for MSRC001_10                                                                                                                        |
+| HYBRID_CPU         | This part has CPUs of more than one type.                                                                                                                                          |
+| HYPERVISOR         | This bit has been reserved by Intel & AMD for use by hypervisors                                                                                                                   |
+| IA32_ARCH_CAP      | IA32_ARCH_CAPABILITIES MSR (Intel)                                                                                                                                                 |
+| IA32_CORE_CAP      | IA32_CORE_CAPABILITIES MSR                                                                                                                                                         |
+| IBPB               | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)                                                                                         |
+| IBRS               | AMD: Indirect Branch Restricted Speculation                                                                                                                                        |
+| IBRS_PREFERRED     | AMD: IBRS is preferred over software solution                                                                                                                                      |
+| IBRS_PROVIDES_SMP  | AMD: IBRS provides Same Mode Protection                                                                                                                                            |
+| IBS                | Instruction Based Sampling (AMD)                                                                                                                                                   |
+| IBSBRNTRGT         | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBSFETCHSAM        | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBSFFV             | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBSOPCNT           | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBSOPCNTEXT        | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBSOPSAM           | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBSRDWROPCNT       | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBSRIPINVALIDCHK   | Instruction Based Sampling Feature (AMD)                                                                                                                                           |
+| IBS_FETCH_CTLX     | AMD: IBS fetch control extended MSR supported                                                                                                                                      |
+| IBS_OPDATA4        | AMD: IBS op data 4 MSR supported                                                                                                                                                   |
+| IBS_OPFUSE         | AMD: Indicates support for IbsOpFuse                                                                                                                                               |
+| IBS_PREVENTHOST    | Disallowing IBS use by the host supported                                                                                                                                          |
+| IBS_ZEN4           | Fetch and Op IBS support IBS extensions added with Zen4                                                                                                                            |
+| IDPRED_CTRL        | IPRED_DIS                                                                                                                                                                          |
+| INT_WBINVD         | WBINVD/WBNOINVD are interruptible.                                                                                                                                                 |
+| INVLPGB            | NVLPGB and TLBSYNC instruction supported                                                                                                                                           |
+| KEYLOCKER          | Key locker                                                                                                                                                                         |
+| KEYLOCKERW         | Key locker wide                                                                                                                                                                    |
+| LAHF               | LAHF/SAHF in long mode                                                                                                                                                             |
+| LAM                | If set, CPU supports Linear Address Masking                                                                                                                                        |
+| LBRVIRT            | LBR virtualization                                                                                                                                                                 |
+| LZCNT              | LZCNT instruction                                                                                                                                                                  |
+| MCAOVERFLOW        | MCA overflow recovery support.                                                                                                                                                     |
+| MCDT_NO            | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.                                                                             |
+| MCOMMIT            | MCOMMIT instruction supported                                                                                                                                                      |
+| MD_CLEAR           | VERW clears CPU buffers                                                                                                                                                            |
+| MMX                | standard MMX                                                                                                                                                                       |
+| MMXEXT             | SSE integer functions or AMD MMX ext                                                                                                                                               |
+| MOVBE              | MOVBE instruction (big-endian)                                                                                                                                                     |
+| MOVDIR64B          | Move 64 Bytes as Direct Store                                                                                                                                                      |
+| MOVDIRI            | Move Doubleword as Direct Store                                                                                                                                                    |
+| MOVSB_ZL           | Fast Zero-Length MOVSB                                                                                                                                                             |
+| MPX                | Intel MPX (Memory Protection Extensions)                                                                                                                                           |
+| MOVU               | MOVU SSE instructions are more efficient and should be preferred to SSE	MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD        |
+| MSRIRC             | Instruction Retired Counter MSR available                                                                                                                                          |
+| MSRLIST            | Read/Write List of Model Specific Registers                                                                                                                                        |
+| MSR_PAGEFLUSH      | Page Flush MSR available                                                                                                                                                           |
+| NRIPS              | Indicates support for NRIP save on VMEXIT                                                                                                                                          |
+| NX                 | NX (No-Execute) bit                                                                                                                                                                |
+| OSXSAVE            | XSAVE enabled by OS                                                                                                                                                                |
+| PCONFIG            | PCONFIG for Intel Multi-Key Total Memory Encryption                                                                                                                                |
+| POPCNT             | POPCNT instruction                                                                                                                                                                 |
+| PPIN               | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled                                            |
+| PREFETCHI          | PREFETCHIT0/1 instructions                                                                                                                                                         |
+| PSFD               | Predictive Store Forward Disable                                                                                                                                                   |
+| RDPRU              | RDPRU instruction supported                                                                                                                                                        |
+| RDRAND             | RDRAND instruction is available                                                                                                                                                    |
+| RDSEED             | RDSEED instruction is available                                                                                                                                                    |
+| RDTSCP             | RDTSCP Instruction                                                                                                                                                                 |
+| RRSBA_CTRL         | Restricted RSB Alternate                                                                                                                                                           |
+| RTM                | Restricted Transactional Memory                                                                                                                                                    |
+| RTM_ALWAYS_ABORT   | Indicates that the loaded microcode is forcing RTM abort.                                                                                                                          |
+| SERIALIZE          | Serialize Instruction Execution                                                                                                                                                    |
+| SEV                | AMD Secure Encrypted Virtualization supported                                                                                                                                      |
+| SEV_64BIT          | AMD SEV guest execution only allowed from a 64-bit host                                                                                                                            |
+| SEV_ALTERNATIVE    | AMD SEV Alternate Injection supported                                                                                                                                              |
+| SEV_DEBUGSWAP      | Full debug state swap supported for SEV-ES guests                                                                                                                                  |
+| SEV_ES             | AMD SEV Encrypted State supported                                                                                                                                                  |
+| SEV_RESTRICTED     | AMD SEV Restricted Injection supported                                                                                                                                             |
+| SEV_SNP            | AMD SEV Secure Nested Paging supported                                                                                                                                             |
+| SGX                | Software Guard Extensions                                                                                                                                                          |
+| SGXLC              | Software Guard Extensions Launch Control                                                                                                                                           |
+| SHA                | Intel SHA Extensions                                                                                                                                                               |
+| SME                | AMD Secure Memory Encryption supported                                                                                                                                             |
+| SME_COHERENT       | AMD Hardware cache coherency across encryption domains enforced                                                                                                                    |
+| SPEC_CTRL_SSBD     | Speculative Store Bypass Disable                                                                                                                                                   |
+| SRBDS_CTRL         | SRBDS mitigation MSR available                                                                                                                                                     |
+| SSE                | SSE functions                                                                                                                                                                      |
+| SSE2               | P4 SSE functions                                                                                                                                                                   |
+| SSE3               | Prescott SSE3 functions                                                                                                                                                            |
+| SSE4               | Penryn SSE4.1 functions                                                                                                                                                            |
+| SSE42              | Nehalem SSE4.2 functions                                                                                                                                                           |
+| SSE4A              | AMD Barcelona microarchitecture SSE4a instructions                                                                                                                                 |
+| SSSE3              | Conroe SSSE3 functions                                                                                                                                                             |
+| STIBP              | Single Thread Indirect Branch Predictors                                                                                                                                           |
+| STIBP_ALWAYSON     | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On                                                                              |
+| STOSB_SHORT        | Fast short STOSB                                                                                                                                                                   |
+| SUCCOR             | Software uncorrectable error containment and recovery capability.                                                                                                                  |
+| SVM                | AMD Secure Virtual Machine                                                                                                                                                         |
+| SVMDA              | Indicates support for the SVM decode assists.                                                                                                                                      |
+| SVMFBASID          | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
+| SVML               | AMD SVM lock. Indicates support for SVM-Lock.                                                                                                                                      |
+| SVMNP              | AMD SVM nested paging                                                                                                                                                              |
+| SVMPF              | SVM pause intercept filter. Indicates support for the pause intercept filter                                                                                                       |
+| SVMPFT             | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold                                                                                           |
+| SYSCALL            | System-Call Extension (SCE): SYSCALL and SYSRET instructions.                                                                                                                      |
+| SYSEE              | SYSENTER and SYSEXIT instructions                                                                                                                                                  |
+| TBM                | AMD Trailing Bit Manipulation                                                                                                                                                      |
+| TDX_GUEST          | Intel Trust Domain Extensions Guest                                                                                                                                                |
+| TLB_FLUSH_NESTED   | AMD: Flushing includes all the nested translations for guest translations                                                                                                          |
+| TME                | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.                         |
+| TOPEXT             | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.                                                         |
+| TSCRATEMSR         | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104                                                                                                       |
+| TSXLDTRK           | Intel TSX Suspend Load Address Tracking                                                                                                                                            |
+| VAES               | Vector AES. AVX(512) versions requires additional checks.                                                                                                                          |
+| VMCBCLEAN          | VMCB clean bits. Indicates support for VMCB clean bits.                                                                                                                            |
+| VMPL               | AMD VM Permission Levels supported                                                                                                                                                 |
+| VMSA_REGPROT       | AMD VMSA Register Protection supported                                                                                                                                             |
+| VMX                | Virtual Machine Extensions                                                                                                                                                         |
+| VPCLMULQDQ         | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.                                                                                                          |
+| VTE                | AMD Virtual Transparent Encryption supported                                                                                                                                       |
+| WAITPKG            | TPAUSE, UMONITOR, UMWAIT                                                                                                                                                           |
+| WBNOINVD           | Write Back and Do Not Invalidate Cache                                                                                                                                             |
+| WRMSRNS            | Non-Serializing Write to Model Specific Register                                                                                                                                   |
+| X87                | FPU                                                                                                                                                                                |
+| XGETBV1            | Supports XGETBV with ECX = 1                                                                                                                                                       |
+| XOP                | Bulldozer XOP functions                                                                                                                                                            |
+| XSAVE              | XSAVE, XRESTOR, XSETBV, XGETBV                                                                                                                                                     |
+| XSAVEC             | Supports XSAVEC and the compacted form of XRSTOR.                                                                                                                                  |
+| XSAVEOPT           | XSAVEOPT available                                                                                                                                                                 |
+| XSAVES             | Supports XSAVES/XRSTORS and IA32_XSS                                                                                                                                               |
+
+# ARM features:
+
+| Feature Flag | Description                                                      |
+|--------------|------------------------------------------------------------------|
+| AESARM       | AES instructions                                                 |
+| ARMCPUID     | Some CPU ID registers readable at user-level                     |
+| ASIMD        | Advanced SIMD                                                    |
+| ASIMDDP      | SIMD Dot Product                                                 |
+| ASIMDHP      | Advanced SIMD half-precision floating point                      |
+| ASIMDRDM     | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
+| ATOMICS      | Large System Extensions (LSE)                                    |
+| CRC32        | CRC32/CRC32C instructions                                        |
+| DCPOP        | Data cache clean to Point of Persistence (DC CVAP)               |
+| EVTSTRM      | Generic timer                                                    |
+| FCMA         | Floatin point complex number addition and multiplication         |
+| FP           | Single-precision and double-precision floating point             |
+| FPHP         | Half-precision floating point                                    |
+| GPA          | Generic Pointer Authentication                                   |
+| JSCVT        | Javascript-style double->int convert (FJCVTZS)                   |
+| LRCPC        | Weaker release consistency (LDAPR, etc)                          |
+| PMULL        | Polynomial Multiply instructions (PMULL/PMULL2)                  |
+| SHA1         | SHA-1 instructions (SHA1C, etc)                                  |
+| SHA2         | SHA-2 instructions (SHA256H, etc)                                |
+| SHA3         | SHA-3 instructions (EOR3, RAXI, XAR, BCAX)                       |
+| SHA512       | SHA512 instructions                                              |
+| SM3          | SM3 instructions                                                 |
+| SM4          | SM4 instructions                                                 |
+| SVE          | Scalable Vector Extension                                        |
+
 # license
 
 This code is published under an MIT license. See LICENSE file for more information.
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
index 3d543ce91..805f5e7b4 100644
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go
+++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
@@ -14,6 +14,7 @@ import (
 	"flag"
 	"fmt"
 	"math"
+	"math/bits"
 	"os"
 	"runtime"
 	"strings"
@@ -66,112 +67,200 @@ const (
 	// Keep index -1 as unknown
 	UNKNOWN = -1
 
-	// Add features
-	ADX                FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions)
-	AESNI                               // Advanced Encryption Standard New Instructions
-	AMD3DNOW                            // AMD 3DNOW
-	AMD3DNOWEXT                         // AMD 3DNowExt
-	AMXBF16                             // Tile computational operations on BFLOAT16 numbers
-	AMXINT8                             // Tile computational operations on 8-bit integers
-	AMXTILE                             // Tile architecture
-	AVX                                 // AVX functions
-	AVX2                                // AVX2 functions
-	AVX512BF16                          // AVX-512 BFLOAT16 Instructions
-	AVX512BITALG                        // AVX-512 Bit Algorithms
-	AVX512BW                            // AVX-512 Byte and Word Instructions
-	AVX512CD                            // AVX-512 Conflict Detection Instructions
-	AVX512DQ                            // AVX-512 Doubleword and Quadword Instructions
-	AVX512ER                            // AVX-512 Exponential and Reciprocal Instructions
-	AVX512F                             // AVX-512 Foundation
-	AVX512FP16                          // AVX-512 FP16 Instructions
-	AVX512IFMA                          // AVX-512 Integer Fused Multiply-Add Instructions
-	AVX512PF                            // AVX-512 Prefetch Instructions
-	AVX512VBMI                          // AVX-512 Vector Bit Manipulation Instructions
-	AVX512VBMI2                         // AVX-512 Vector Bit Manipulation Instructions, Version 2
-	AVX512VL                            // AVX-512 Vector Length Extensions
-	AVX512VNNI                          // AVX-512 Vector Neural Network Instructions
-	AVX512VP2INTERSECT                  // AVX-512 Intersect for D/Q
-	AVX512VPOPCNTDQ                     // AVX-512 Vector Population Count Doubleword and Quadword
-	AVXSLOW                             // Indicates the CPU performs 2 128 bit operations instead of one.
-	BMI1                                // Bit Manipulation Instruction Set 1
-	BMI2                                // Bit Manipulation Instruction Set 2
-	CETIBT                              // Intel CET Indirect Branch Tracking
-	CETSS                               // Intel CET Shadow Stack
-	CLDEMOTE                            // Cache Line Demote
-	CLMUL                               // Carry-less Multiplication
-	CLZERO                              // CLZERO instruction supported
-	CMOV                                // i686 CMOV
-	CMPXCHG8                            // CMPXCHG8 instruction
-	CPBOOST                             // Core Performance Boost
-	CX16                                // CMPXCHG16B Instruction
-	ENQCMD                              // Enqueue Command
-	ERMS                                // Enhanced REP MOVSB/STOSB
-	F16C                                // Half-precision floating-point conversion
-	FMA3                                // Intel FMA 3. Does not imply AVX.
-	FMA4                                // Bulldozer FMA4 functions
-	FXSR                                // FXSAVE, FXRESTOR instructions, CR4 bit 9
-	FXSROPT                             // FXSAVE/FXRSTOR optimizations
-	GFNI                                // Galois Field New Instructions
-	HLE                                 // Hardware Lock Elision
-	HTT                                 // Hyperthreading (enabled)
-	HWA                                 // Hardware assert supported. Indicates support for MSRC001_10
-	HYPERVISOR                          // This bit has been reserved by Intel & AMD for use by hypervisors
-	IBPB                                // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
-	IBS                                 // Instruction Based Sampling (AMD)
-	IBSBRNTRGT                          // Instruction Based Sampling Feature (AMD)
-	IBSFETCHSAM                         // Instruction Based Sampling Feature (AMD)
-	IBSFFV                              // Instruction Based Sampling Feature (AMD)
-	IBSOPCNT                            // Instruction Based Sampling Feature (AMD)
-	IBSOPCNTEXT                         // Instruction Based Sampling Feature (AMD)
-	IBSOPSAM                            // Instruction Based Sampling Feature (AMD)
-	IBSRDWROPCNT                        // Instruction Based Sampling Feature (AMD)
-	IBSRIPINVALIDCHK                    // Instruction Based Sampling Feature (AMD)
-	INT_WBINVD                          // WBINVD/WBNOINVD are interruptible.
-	INVLPGB                             // NVLPGB and TLBSYNC instruction supported
-	LAHF                                // LAHF/SAHF in long mode
-	LZCNT                               // LZCNT instruction
-	MCAOVERFLOW                         // MCA overflow recovery support.
-	MCOMMIT                             // MCOMMIT instruction supported
-	MMX                                 // standard MMX
-	MMXEXT                              // SSE integer functions or AMD MMX ext
-	MOVBE                               // MOVBE instruction (big-endian)
-	MOVDIR64B                           // Move 64 Bytes as Direct Store
-	MOVDIRI                             // Move Doubleword as Direct Store
-	MPX                                 // Intel MPX (Memory Protection Extensions)
-	MSRIRC                              // Instruction Retired Counter MSR available
-	NX                                  // NX (No-Execute) bit
-	OSXSAVE                             // XSAVE enabled by OS
-	POPCNT                              // POPCNT instruction
-	RDPRU                               // RDPRU instruction supported
-	RDRAND                              // RDRAND instruction is available
-	RDSEED                              // RDSEED instruction is available
-	RDTSCP                              // RDTSCP Instruction
-	RTM                                 // Restricted Transactional Memory
-	RTM_ALWAYS_ABORT                    // Indicates that the loaded microcode is forcing RTM abort.
-	SCE                                 // SYSENTER and SYSEXIT instructions
-	SERIALIZE                           // Serialize Instruction Execution
-	SGX                                 // Software Guard Extensions
-	SGXLC                               // Software Guard Extensions Launch Control
-	SHA                                 // Intel SHA Extensions
-	SSE                                 // SSE functions
-	SSE2                                // P4 SSE functions
-	SSE3                                // Prescott SSE3 functions
-	SSE4                                // Penryn SSE4.1 functions
-	SSE42                               // Nehalem SSE4.2 functions
-	SSE4A                               // AMD Barcelona microarchitecture SSE4a instructions
-	SSSE3                               // Conroe SSSE3 functions
-	STIBP                               // Single Thread Indirect Branch Predictors
-	SUCCOR                              // Software uncorrectable error containment and recovery capability.
-	TBM                                 // AMD Trailing Bit Manipulation
-	TSXLDTRK                            // Intel TSX Suspend Load Address Tracking
-	VAES                                // Vector AES
-	VMX                                 // Virtual Machine Extensions
-	VPCLMULQDQ                          // Carry-Less Multiplication Quadword
-	WAITPKG                             // TPAUSE, UMONITOR, UMWAIT
-	WBNOINVD                            // Write Back and Do Not Invalidate Cache
-	X87                                 // FPU
-	XOP                                 // Bulldozer XOP functions
-	XSAVE                               // XSAVE, XRESTOR, XSETBV, XGETBV
+	// x86 features
+	ADX                 FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions)
+	AESNI                                // Advanced Encryption Standard New Instructions
+	AMD3DNOW                             // AMD 3DNOW
+	AMD3DNOWEXT                          // AMD 3DNowExt
+	AMXBF16                              // Tile computational operations on BFLOAT16 numbers
+	AMXFP16                              // Tile computational operations on FP16 numbers
+	AMXINT8                              // Tile computational operations on 8-bit integers
+	AMXTILE                              // Tile architecture
+	APX_F                                // Intel APX
+	AVX                                  // AVX functions
+	AVX10                                // If set the Intel AVX10 Converged Vector ISA is supported
+	AVX10_128                            // If set indicates that AVX10 128-bit vector support is present
+	AVX10_256                            // If set indicates that AVX10 256-bit vector support is present
+	AVX10_512                            // If set indicates that AVX10 512-bit vector support is present
+	AVX2                                 // AVX2 functions
+	AVX512BF16                           // AVX-512 BFLOAT16 Instructions
+	AVX512BITALG                         // AVX-512 Bit Algorithms
+	AVX512BW                             // AVX-512 Byte and Word Instructions
+	AVX512CD                             // AVX-512 Conflict Detection Instructions
+	AVX512DQ                             // AVX-512 Doubleword and Quadword Instructions
+	AVX512ER                             // AVX-512 Exponential and Reciprocal Instructions
+	AVX512F                              // AVX-512 Foundation
+	AVX512FP16                           // AVX-512 FP16 Instructions
+	AVX512IFMA                           // AVX-512 Integer Fused Multiply-Add Instructions
+	AVX512PF                             // AVX-512 Prefetch Instructions
+	AVX512VBMI                           // AVX-512 Vector Bit Manipulation Instructions
+	AVX512VBMI2                          // AVX-512 Vector Bit Manipulation Instructions, Version 2
+	AVX512VL                             // AVX-512 Vector Length Extensions
+	AVX512VNNI                           // AVX-512 Vector Neural Network Instructions
+	AVX512VP2INTERSECT                   // AVX-512 Intersect for D/Q
+	AVX512VPOPCNTDQ                      // AVX-512 Vector Population Count Doubleword and Quadword
+	AVXIFMA                              // AVX-IFMA instructions
+	AVXNECONVERT                         // AVX-NE-CONVERT instructions
+	AVXSLOW                              // Indicates the CPU performs 2 128 bit operations instead of one
+	AVXVNNI                              // AVX (VEX encoded) VNNI neural network instructions
+	AVXVNNIINT8                          // AVX-VNNI-INT8 instructions
+	BHI_CTRL                             // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
+	BMI1                                 // Bit Manipulation Instruction Set 1
+	BMI2                                 // Bit Manipulation Instruction Set 2
+	CETIBT                               // Intel CET Indirect Branch Tracking
+	CETSS                                // Intel CET Shadow Stack
+	CLDEMOTE                             // Cache Line Demote
+	CLMUL                                // Carry-less Multiplication
+	CLZERO                               // CLZERO instruction supported
+	CMOV                                 // i686 CMOV
+	CMPCCXADD                            // CMPCCXADD instructions
+	CMPSB_SCADBS_SHORT                   // Fast short CMPSB and SCASB
+	CMPXCHG8                             // CMPXCHG8 instruction
+	CPBOOST                              // Core Performance Boost
+	CPPC                                 // AMD: Collaborative Processor Performance Control
+	CX16                                 // CMPXCHG16B Instruction
+	EFER_LMSLE_UNS                       // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
+	ENQCMD                               // Enqueue Command
+	ERMS                                 // Enhanced REP MOVSB/STOSB
+	F16C                                 // Half-precision floating-point conversion
+	FLUSH_L1D                            // Flush L1D cache
+	FMA3                                 // Intel FMA 3. Does not imply AVX.
+	FMA4                                 // Bulldozer FMA4 functions
+	FP128                                // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
+	FP256                                // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
+	FSRM                                 // Fast Short Rep Mov
+	FXSR                                 // FXSAVE, FXRESTOR instructions, CR4 bit 9
+	FXSROPT                              // FXSAVE/FXRSTOR optimizations
+	GFNI                                 // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
+	HLE                                  // Hardware Lock Elision
+	HRESET                               // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
+	HTT                                  // Hyperthreading (enabled)
+	HWA                                  // Hardware assert supported. Indicates support for MSRC001_10
+	HYBRID_CPU                           // This part has CPUs of more than one type.
+	HYPERVISOR                           // This bit has been reserved by Intel & AMD for use by hypervisors
+	IA32_ARCH_CAP                        // IA32_ARCH_CAPABILITIES MSR (Intel)
+	IA32_CORE_CAP                        // IA32_CORE_CAPABILITIES MSR
+	IBPB                                 // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
+	IBPB_BRTYPE                          // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes	all branch type predictions from the CPU branch predictor
+	IBRS                                 // AMD: Indirect Branch Restricted Speculation
+	IBRS_PREFERRED                       // AMD: IBRS is preferred over software solution
+	IBRS_PROVIDES_SMP                    // AMD: IBRS provides Same Mode Protection
+	IBS                                  // Instruction Based Sampling (AMD)
+	IBSBRNTRGT                           // Instruction Based Sampling Feature (AMD)
+	IBSFETCHSAM                          // Instruction Based Sampling Feature (AMD)
+	IBSFFV                               // Instruction Based Sampling Feature (AMD)
+	IBSOPCNT                             // Instruction Based Sampling Feature (AMD)
+	IBSOPCNTEXT                          // Instruction Based Sampling Feature (AMD)
+	IBSOPSAM                             // Instruction Based Sampling Feature (AMD)
+	IBSRDWROPCNT                         // Instruction Based Sampling Feature (AMD)
+	IBSRIPINVALIDCHK                     // Instruction Based Sampling Feature (AMD)
+	IBS_FETCH_CTLX                       // AMD: IBS fetch control extended MSR supported
+	IBS_OPDATA4                          // AMD: IBS op data 4 MSR supported
+	IBS_OPFUSE                           // AMD: Indicates support for IbsOpFuse
+	IBS_PREVENTHOST                      // Disallowing IBS use by the host supported
+	IBS_ZEN4                             // AMD: Fetch and Op IBS support IBS extensions added with Zen4
+	IDPRED_CTRL                          // IPRED_DIS
+	INT_WBINVD                           // WBINVD/WBNOINVD are interruptible.
+	INVLPGB                              // NVLPGB and TLBSYNC instruction supported
+	KEYLOCKER                            // Key locker
+	KEYLOCKERW                           // Key locker wide
+	LAHF                                 // LAHF/SAHF in long mode
+	LAM                                  // If set, CPU supports Linear Address Masking
+	LBRVIRT                              // LBR virtualization
+	LZCNT                                // LZCNT instruction
+	MCAOVERFLOW                          // MCA overflow recovery support.
+	MCDT_NO                              // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
+	MCOMMIT                              // MCOMMIT instruction supported
+	MD_CLEAR                             // VERW clears CPU buffers
+	MMX                                  // standard MMX
+	MMXEXT                               // SSE integer functions or AMD MMX ext
+	MOVBE                                // MOVBE instruction (big-endian)
+	MOVDIR64B                            // Move 64 Bytes as Direct Store
+	MOVDIRI                              // Move Doubleword as Direct Store
+	MOVSB_ZL                             // Fast Zero-Length MOVSB
+	MOVU                                 // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE	MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
+	MPX                                  // Intel MPX (Memory Protection Extensions)
+	MSRIRC                               // Instruction Retired Counter MSR available
+	MSRLIST                              // Read/Write List of Model Specific Registers
+	MSR_PAGEFLUSH                        // Page Flush MSR available
+	NRIPS                                // Indicates support for NRIP save on VMEXIT
+	NX                                   // NX (No-Execute) bit
+	OSXSAVE                              // XSAVE enabled by OS
+	PCONFIG                              // PCONFIG for Intel Multi-Key Total Memory Encryption
+	POPCNT                               // POPCNT instruction
+	PPIN                                 // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
+	PREFETCHI                            // PREFETCHIT0/1 instructions
+	PSFD                                 // Predictive Store Forward Disable
+	RDPRU                                // RDPRU instruction supported
+	RDRAND                               // RDRAND instruction is available
+	RDSEED                               // RDSEED instruction is available
+	RDTSCP                               // RDTSCP Instruction
+	RRSBA_CTRL                           // Restricted RSB Alternate
+	RTM                                  // Restricted Transactional Memory
+	RTM_ALWAYS_ABORT                     // Indicates that the loaded microcode is forcing RTM abort.
+	SBPB                                 // Indicates support for the Selective Branch Predictor Barrier
+	SERIALIZE                            // Serialize Instruction Execution
+	SEV                                  // AMD Secure Encrypted Virtualization supported
+	SEV_64BIT                            // AMD SEV guest execution only allowed from a 64-bit host
+	SEV_ALTERNATIVE                      // AMD SEV Alternate Injection supported
+	SEV_DEBUGSWAP                        // Full debug state swap supported for SEV-ES guests
+	SEV_ES                               // AMD SEV Encrypted State supported
+	SEV_RESTRICTED                       // AMD SEV Restricted Injection supported
+	SEV_SNP                              // AMD SEV Secure Nested Paging supported
+	SGX                                  // Software Guard Extensions
+	SGXLC                                // Software Guard Extensions Launch Control
+	SHA                                  // Intel SHA Extensions
+	SME                                  // AMD Secure Memory Encryption supported
+	SME_COHERENT                         // AMD Hardware cache coherency across encryption domains enforced
+	SPEC_CTRL_SSBD                       // Speculative Store Bypass Disable
+	SRBDS_CTRL                           // SRBDS mitigation MSR available
+	SRSO_MSR_FIX                         // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO.
+	SRSO_NO                              // Indicates the CPU is not subject to the SRSO vulnerability
+	SRSO_USER_KERNEL_NO                  // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries
+	SSE                                  // SSE functions
+	SSE2                                 // P4 SSE functions
+	SSE3                                 // Prescott SSE3 functions
+	SSE4                                 // Penryn SSE4.1 functions
+	SSE42                                // Nehalem SSE4.2 functions
+	SSE4A                                // AMD Barcelona microarchitecture SSE4a instructions
+	SSSE3                                // Conroe SSSE3 functions
+	STIBP                                // Single Thread Indirect Branch Predictors
+	STIBP_ALWAYSON                       // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
+	STOSB_SHORT                          // Fast short STOSB
+	SUCCOR                               // Software uncorrectable error containment and recovery capability.
+	SVM                                  // AMD Secure Virtual Machine
+	SVMDA                                // Indicates support for the SVM decode assists.
+	SVMFBASID                            // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
+	SVML                                 // AMD SVM lock. Indicates support for SVM-Lock.
+	SVMNP                                // AMD SVM nested paging
+	SVMPF                                // SVM pause intercept filter. Indicates support for the pause intercept filter
+	SVMPFT                               // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
+	SYSCALL                              // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
+	SYSEE                                // SYSENTER and SYSEXIT instructions
+	TBM                                  // AMD Trailing Bit Manipulation
+	TDX_GUEST                            // Intel Trust Domain Extensions Guest
+	TLB_FLUSH_NESTED                     // AMD: Flushing includes all the nested translations for guest translations
+	TME                                  // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
+	TOPEXT                               // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
+	TSCRATEMSR                           // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
+	TSXLDTRK                             // Intel TSX Suspend Load Address Tracking
+	VAES                                 // Vector AES. AVX(512) versions requires additional checks.
+	VMCBCLEAN                            // VMCB clean bits. Indicates support for VMCB clean bits.
+	VMPL                                 // AMD VM Permission Levels supported
+	VMSA_REGPROT                         // AMD VMSA Register Protection supported
+	VMX                                  // Virtual Machine Extensions
+	VPCLMULQDQ                           // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
+	VTE                                  // AMD Virtual Transparent Encryption supported
+	WAITPKG                              // TPAUSE, UMONITOR, UMWAIT
+	WBNOINVD                             // Write Back and Do Not Invalidate Cache
+	WRMSRNS                              // Non-Serializing Write to Model Specific Register
+	X87                                  // FPU
+	XGETBV1                              // Supports XGETBV with ECX = 1
+	XOP                                  // Bulldozer XOP functions
+	XSAVE                                // XSAVE, XRESTOR, XSETBV, XGETBV
+	XSAVEC                               // Supports XSAVEC and the compacted form of XRSTOR.
+	XSAVEOPT                             // XSAVEOPT available
+	XSAVES                               // Supports XSAVES/XRSTORS and IA32_XSS
 
 	// ARM features:
 	AESARM   // AES instructions
@@ -198,7 +287,6 @@ const (
 	SM3      // SM3 instructions
 	SM4      // SM4 instructions
 	SVE      // Scalable Vector Extension
-
 	// Keep it last. It automatically defines the size of []flagSet
 	lastID
 
@@ -216,6 +304,7 @@ type CPUInfo struct {
 	LogicalCores   int     // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
 	Family         int     // CPU family number
 	Model          int     // CPU model number
+	Stepping       int     // CPU stepping info
 	CacheLine      int     // Cache line size in bytes. Will be 0 if undetectable.
 	Hz             int64   // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
 	BoostFreq      int64   // Max clock speed, if known, 0 otherwise
@@ -225,9 +314,11 @@ type CPUInfo struct {
 		L2  int // L2 Cache (per core or shared). Will be -1 if undetected
 		L3  int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
 	}
-	SGX       SGXSupport
-	maxFunc   uint32
-	maxExFunc uint32
+	SGX              SGXSupport
+	AMDMemEncryption AMDMemEncryptionSupport
+	AVX10Level       uint8
+	maxFunc          uint32
+	maxExFunc        uint32
 }
 
 var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
@@ -318,30 +409,61 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool {
 
 // Has allows for checking a single feature.
 // Should be inlined by the compiler.
-func (c CPUInfo) Has(id FeatureID) bool {
+func (c *CPUInfo) Has(id FeatureID) bool {
 	return c.featureSet.inSet(id)
 }
 
+// AnyOf returns whether the CPU supports one or more of the requested features.
+func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
+	for _, id := range ids {
+		if c.featureSet.inSet(id) {
+			return true
+		}
+	}
+	return false
+}
+
+// Features contains several features combined for a fast check using
+// CpuInfo.HasAll
+type Features *flagSet
+
+// CombineFeatures allows to combine several features for a close to constant time lookup.
+func CombineFeatures(ids ...FeatureID) Features {
+	var v flagSet
+	for _, id := range ids {
+		v.set(id)
+	}
+	return &v
+}
+
+func (c *CPUInfo) HasAll(f Features) bool {
+	return c.featureSet.hasSetP(f)
+}
+
 // https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
-var level1Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2)
-var level2Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
-var level3Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
-var level4Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
+var oneOfLevel = CombineFeatures(SYSEE, SYSCALL)
+var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2)
+var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
+var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
+var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
 
 // X64Level returns the microarchitecture level detected on the CPU.
 // If features are lacking or non x64 mode, 0 is returned.
 // See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
 func (c CPUInfo) X64Level() int {
-	if c.featureSet.hasSet(level4Features) {
+	if !c.featureSet.hasOneOf(oneOfLevel) {
+		return 0
+	}
+	if c.featureSet.hasSetP(level4Features) {
 		return 4
 	}
-	if c.featureSet.hasSet(level3Features) {
+	if c.featureSet.hasSetP(level3Features) {
 		return 3
 	}
-	if c.featureSet.hasSet(level2Features) {
+	if c.featureSet.hasSetP(level2Features) {
 		return 2
 	}
-	if c.featureSet.hasSet(level1Features) {
+	if c.featureSet.hasSetP(level1Features) {
 		return 1
 	}
 	return 0
@@ -369,8 +491,9 @@ func (c CPUInfo) IsVendor(v Vendor) bool {
 	return c.VendorID == v
 }
 
+// FeatureSet returns all available features as strings.
 func (c CPUInfo) FeatureSet() []string {
-	s := make([]string, 0)
+	s := make([]string, 0, c.featureSet.nEnabled())
 	s = append(s, c.featureSet.Strings()...)
 	return s
 }
@@ -504,7 +627,7 @@ const flagMask = flagBits - 1
 // flagSet contains detected cpu features and characteristics in an array of flags
 type flagSet [(lastID + flagMask) / flagBits]flags
 
-func (s flagSet) inSet(feat FeatureID) bool {
+func (s *flagSet) inSet(feat FeatureID) bool {
 	return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0
 }
 
@@ -534,7 +657,17 @@ func (s *flagSet) or(other flagSet) {
 }
 
 // hasSet returns whether all features are present.
-func (s flagSet) hasSet(other flagSet) bool {
+func (s *flagSet) hasSet(other flagSet) bool {
+	for i, v := range other[:] {
+		if s[i]&v != v {
+			return false
+		}
+	}
+	return true
+}
+
+// hasSet returns whether all features are present.
+func (s *flagSet) hasSetP(other *flagSet) bool {
 	for i, v := range other[:] {
 		if s[i]&v != v {
 			return false
@@ -543,6 +676,24 @@ func (s flagSet) hasSet(other flagSet) bool {
 	return true
 }
 
+// hasOneOf returns whether one or more features are present.
+func (s *flagSet) hasOneOf(other *flagSet) bool {
+	for i, v := range other[:] {
+		if s[i]&v != 0 {
+			return true
+		}
+	}
+	return false
+}
+
+// nEnabled will return the number of enabled flags.
+func (s *flagSet) nEnabled() (n int) {
+	for _, v := range s[:] {
+		n += bits.OnesCount64(uint64(v))
+	}
+	return n
+}
+
 func flagSetWith(feat ...FeatureID) flagSet {
 	var res flagSet
 	for _, f := range feat {
@@ -631,7 +782,7 @@ func threadsPerCore() int {
 		if vend == AMD {
 			// Workaround for AMD returning 0, assume 2 if >= Zen 2
 			// It will be more correct than not.
-			fam, _ := familyModel()
+			fam, _, _ := familyModel()
 			_, _, _, d := cpuid(1)
 			if (d&(1<<28)) != 0 && fam >= 23 {
 				return 2
@@ -669,14 +820,27 @@ func logicalCores() int {
 	}
 }
 
-func familyModel() (int, int) {
+func familyModel() (family, model, stepping int) {
 	if maxFunctionID() < 0x1 {
-		return 0, 0
+		return 0, 0, 0
 	}
 	eax, _, _, _ := cpuid(1)
-	family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff)
-	model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0)
-	return int(family), int(model)
+	// If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0].
+	family = int((eax >> 8) & 0xf)
+	extFam := family == 0x6 // Intel is 0x6, needs extended model.
+	if family == 0xf {
+		// Add ExtFamily
+		family += int((eax >> 20) & 0xff)
+		extFam = true
+	}
+	// If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0].
+	model = int((eax >> 4) & 0xf)
+	if extFam {
+		// Add ExtModel
+		model += int((eax >> 12) & 0xf0)
+	}
+	stepping = int(eax & 0xf)
+	return family, model, stepping
 }
 
 func physicalCores() int {
@@ -811,9 +975,14 @@ func (c *CPUInfo) cacheSize() {
 		c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024)
 
 		// CPUID Fn8000_001D_EAX_x[N:0] Cache Properties
-		if maxExtendedFunction() < 0x8000001D {
+		if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) {
 			return
 		}
+
+		// Xen Hypervisor is buggy and returns the same entry no matter ECX value.
+		// Hack: When we encounter the same entry 100 times we break.
+		nSame := 0
+		var last uint32
 		for i := uint32(0); i < math.MaxUint32; i++ {
 			eax, ebx, ecx, _ := cpuidex(0x8000001D, i)
 
@@ -829,6 +998,16 @@ func (c *CPUInfo) cacheSize() {
 				return
 			}
 
+			// Check for the same value repeated.
+			comb := eax ^ ebx ^ ecx
+			if comb == last {
+				nSame++
+				if nSame == 100 {
+					return
+				}
+			}
+			last = comb
+
 			switch level {
 			case 1:
 				switch typ {
@@ -906,6 +1085,32 @@ func hasSGX(available, lc bool) (rval SGXSupport) {
 	return
 }
 
+type AMDMemEncryptionSupport struct {
+	Available          bool
+	CBitPossition      uint32
+	NumVMPL            uint32
+	PhysAddrReduction  uint32
+	NumEntryptedGuests uint32
+	MinSevNoEsAsid     uint32
+}
+
+func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) {
+	rval.Available = available
+	if !available {
+		return
+	}
+
+	_, b, c, d := cpuidex(0x8000001f, 0)
+
+	rval.CBitPossition = b & 0x3f
+	rval.PhysAddrReduction = (b >> 6) & 0x3F
+	rval.NumVMPL = (b >> 12) & 0xf
+	rval.NumEntryptedGuests = c
+	rval.MinSevNoEsAsid = d
+
+	return
+}
+
 func support() flagSet {
 	var fs flagSet
 	mfi := maxFunctionID()
@@ -913,14 +1118,13 @@ func support() flagSet {
 	if mfi < 0x1 {
 		return fs
 	}
-	family, model := familyModel()
+	family, model, _ := familyModel()
 
 	_, _, c, d := cpuid(1)
 	fs.setIf((d&(1<<0)) != 0, X87)
 	fs.setIf((d&(1<<8)) != 0, CMPXCHG8)
-	fs.setIf((d&(1<<11)) != 0, SCE)
+	fs.setIf((d&(1<<11)) != 0, SYSEE)
 	fs.setIf((d&(1<<15)) != 0, CMOV)
-	fs.setIf((d&(1<<22)) != 0, MMXEXT)
 	fs.setIf((d&(1<<23)) != 0, MMX)
 	fs.setIf((d&(1<<24)) != 0, FXSR)
 	fs.setIf((d&(1<<25)) != 0, FXSROPT)
@@ -928,9 +1132,9 @@ func support() flagSet {
 	fs.setIf((d&(1<<26)) != 0, SSE2)
 	fs.setIf((c&1) != 0, SSE3)
 	fs.setIf((c&(1<<5)) != 0, VMX)
-	fs.setIf((c&0x00000200) != 0, SSSE3)
-	fs.setIf((c&0x00080000) != 0, SSE4)
-	fs.setIf((c&0x00100000) != 0, SSE42)
+	fs.setIf((c&(1<<9)) != 0, SSSE3)
+	fs.setIf((c&(1<<19)) != 0, SSE4)
+	fs.setIf((c&(1<<20)) != 0, SSE42)
 	fs.setIf((c&(1<<25)) != 0, AESNI)
 	fs.setIf((c&(1<<1)) != 0, CLMUL)
 	fs.setIf(c&(1<<22) != 0, MOVBE)
@@ -976,7 +1180,6 @@ func support() flagSet {
 	// Check AVX2, AVX2 requires OS support, but BMI1/2 don't.
 	if mfi >= 7 {
 		_, ebx, ecx, edx := cpuidex(7, 0)
-		eax1, _, _, _ := cpuidex(7, 1)
 		if fs.inSet(AVX) && (ebx&0x00000020) != 0 {
 			fs.set(AVX2)
 		}
@@ -993,21 +1196,55 @@ func support() flagSet {
 		fs.setIf(ebx&(1<<18) != 0, RDSEED)
 		fs.setIf(ebx&(1<<19) != 0, ADX)
 		fs.setIf(ebx&(1<<29) != 0, SHA)
+
 		// CPUID.(EAX=7, ECX=0).ECX
 		fs.setIf(ecx&(1<<5) != 0, WAITPKG)
 		fs.setIf(ecx&(1<<7) != 0, CETSS)
+		fs.setIf(ecx&(1<<8) != 0, GFNI)
+		fs.setIf(ecx&(1<<9) != 0, VAES)
+		fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
+		fs.setIf(ecx&(1<<13) != 0, TME)
 		fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
+		fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
 		fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
 		fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
 		fs.setIf(ecx&(1<<29) != 0, ENQCMD)
 		fs.setIf(ecx&(1<<30) != 0, SGXLC)
+
 		// CPUID.(EAX=7, ECX=0).EDX
+		fs.setIf(edx&(1<<4) != 0, FSRM)
+		fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL)
+		fs.setIf(edx&(1<<10) != 0, MD_CLEAR)
 		fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT)
 		fs.setIf(edx&(1<<14) != 0, SERIALIZE)
+		fs.setIf(edx&(1<<15) != 0, HYBRID_CPU)
 		fs.setIf(edx&(1<<16) != 0, TSXLDTRK)
+		fs.setIf(edx&(1<<18) != 0, PCONFIG)
 		fs.setIf(edx&(1<<20) != 0, CETIBT)
 		fs.setIf(edx&(1<<26) != 0, IBPB)
 		fs.setIf(edx&(1<<27) != 0, STIBP)
+		fs.setIf(edx&(1<<28) != 0, FLUSH_L1D)
+		fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP)
+		fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
+		fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
+
+		// CPUID.(EAX=7, ECX=1).EAX
+		eax1, _, _, edx1 := cpuidex(7, 1)
+		fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
+		fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
+		fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
+		fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
+		fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
+		fs.setIf(eax1&(1<<22) != 0, HRESET)
+		fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
+		fs.setIf(eax1&(1<<26) != 0, LAM)
+
+		// CPUID.(EAX=7, ECX=1).EDX
+		fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
+		fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
+		fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
+		fs.setIf(edx1&(1<<19) != 0, AVX10)
+		fs.setIf(edx1&(1<<21) != 0, APX_F)
 
 		// Only detect AVX-512 features if XGETBV is supported
 		if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
@@ -1033,9 +1270,6 @@ func support() flagSet {
 				// ecx
 				fs.setIf(ecx&(1<<1) != 0, AVX512VBMI)
 				fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2)
-				fs.setIf(ecx&(1<<8) != 0, GFNI)
-				fs.setIf(ecx&(1<<9) != 0, VAES)
-				fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
 				fs.setIf(ecx&(1<<11) != 0, AVX512VNNI)
 				fs.setIf(ecx&(1<<12) != 0, AVX512BITALG)
 				fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ)
@@ -1047,31 +1281,86 @@ func support() flagSet {
 				fs.setIf(edx&(1<<25) != 0, AMXINT8)
 				// eax1 = CPUID.(EAX=7, ECX=1).EAX
 				fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
+				fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
+				fs.setIf(eax1&(1<<21) != 0, AMXFP16)
+				fs.setIf(eax1&(1<<27) != 0, MSRLIST)
 			}
 		}
+
+		// CPUID.(EAX=7, ECX=2)
+		_, _, _, edx = cpuidex(7, 2)
+		fs.setIf(edx&(1<<0) != 0, PSFD)
+		fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
+		fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
+		fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
+		fs.setIf(edx&(1<<5) != 0, MCDT_NO)
+
+		// Add keylocker features.
+		if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
+			_, ebx, _, _ := cpuidex(0x19, 0)
+			fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
+		}
+
+		// Add AVX10 features.
+		if fs.inSet(AVX10) && mfi >= 0x24 {
+			_, ebx, _, _ := cpuidex(0x24, 0)
+			fs.setIf(ebx&(1<<16) != 0, AVX10_128)
+			fs.setIf(ebx&(1<<17) != 0, AVX10_256)
+			fs.setIf(ebx&(1<<18) != 0, AVX10_512)
+		}
 	}
 
+	// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
+	// EAX
+	// Bit 00: XSAVEOPT is available.
+	// Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set.
+	// Bit 02: Supports XGETBV with ECX = 1 if set.
+	// Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set.
+	// Bits 31 - 04: Reserved.
+	// EBX
+	// Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS.
+	// ECX
+	// Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1.
+	// EDX?
+	// Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved.
+	if mfi >= 0xd {
+		if fs.inSet(XSAVE) {
+			eax, _, _, _ := cpuidex(0xd, 1)
+			fs.setIf(eax&(1<<0) != 0, XSAVEOPT)
+			fs.setIf(eax&(1<<1) != 0, XSAVEC)
+			fs.setIf(eax&(1<<2) != 0, XGETBV1)
+			fs.setIf(eax&(1<<3) != 0, XSAVES)
+		}
+	}
 	if maxExtendedFunction() >= 0x80000001 {
 		_, _, c, d := cpuid(0x80000001)
 		if (c & (1 << 5)) != 0 {
 			fs.set(LZCNT)
 			fs.set(POPCNT)
 		}
+		// ECX
 		fs.setIf((c&(1<<0)) != 0, LAHF)
-		fs.setIf((c&(1<<10)) != 0, IBS)
-		fs.setIf((d&(1<<31)) != 0, AMD3DNOW)
-		fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT)
-		fs.setIf((d&(1<<23)) != 0, MMX)
-		fs.setIf((d&(1<<22)) != 0, MMXEXT)
+		fs.setIf((c&(1<<2)) != 0, SVM)
 		fs.setIf((c&(1<<6)) != 0, SSE4A)
+		fs.setIf((c&(1<<10)) != 0, IBS)
+		fs.setIf((c&(1<<22)) != 0, TOPEXT)
+
+		// EDX
+		fs.setIf(d&(1<<11) != 0, SYSCALL)
 		fs.setIf(d&(1<<20) != 0, NX)
+		fs.setIf(d&(1<<22) != 0, MMXEXT)
+		fs.setIf(d&(1<<23) != 0, MMX)
+		fs.setIf(d&(1<<24) != 0, FXSR)
+		fs.setIf(d&(1<<25) != 0, FXSROPT)
 		fs.setIf(d&(1<<27) != 0, RDTSCP)
+		fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT)
+		fs.setIf(d&(1<<31) != 0, AMD3DNOW)
 
 		/* XOP and FMA4 use the AVX instruction coding scheme, so they can't be
 		 * used unless the OS has AVX support. */
 		if fs.inSet(AVX) {
-			fs.setIf((c&0x00000800) != 0, XOP)
-			fs.setIf((c&0x00010000) != 0, FMA4)
+			fs.setIf((c&(1<<11)) != 0, XOP)
+			fs.setIf((c&(1<<16)) != 0, FMA4)
 		}
 
 	}
@@ -1085,15 +1374,48 @@ func support() flagSet {
 
 	if maxExtendedFunction() >= 0x80000008 {
 		_, b, _, _ := cpuid(0x80000008)
+		fs.setIf(b&(1<<28) != 0, PSFD)
+		fs.setIf(b&(1<<27) != 0, CPPC)
+		fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD)
+		fs.setIf(b&(1<<23) != 0, PPIN)
+		fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED)
+		fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS)
+		fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP)
+		fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED)
+		fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON)
+		fs.setIf(b&(1<<15) != 0, STIBP)
+		fs.setIf(b&(1<<14) != 0, IBRS)
+		fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
+		fs.setIf(b&(1<<12) != 0, IBPB)
 		fs.setIf((b&(1<<9)) != 0, WBNOINVD)
 		fs.setIf((b&(1<<8)) != 0, MCOMMIT)
-		fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
 		fs.setIf((b&(1<<4)) != 0, RDPRU)
 		fs.setIf((b&(1<<3)) != 0, INVLPGB)
 		fs.setIf((b&(1<<1)) != 0, MSRIRC)
 		fs.setIf((b&(1<<0)) != 0, CLZERO)
 	}
 
+	if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A {
+		_, _, _, edx := cpuid(0x8000000A)
+		fs.setIf((edx>>0)&1 == 1, SVMNP)
+		fs.setIf((edx>>1)&1 == 1, LBRVIRT)
+		fs.setIf((edx>>2)&1 == 1, SVML)
+		fs.setIf((edx>>3)&1 == 1, NRIPS)
+		fs.setIf((edx>>4)&1 == 1, TSCRATEMSR)
+		fs.setIf((edx>>5)&1 == 1, VMCBCLEAN)
+		fs.setIf((edx>>6)&1 == 1, SVMFBASID)
+		fs.setIf((edx>>7)&1 == 1, SVMDA)
+		fs.setIf((edx>>10)&1 == 1, SVMPF)
+		fs.setIf((edx>>12)&1 == 1, SVMPFT)
+	}
+
+	if maxExtendedFunction() >= 0x8000001a {
+		eax, _, _, _ := cpuid(0x8000001a)
+		fs.setIf((eax>>0)&1 == 1, FP128)
+		fs.setIf((eax>>1)&1 == 1, MOVU)
+		fs.setIf((eax>>2)&1 == 1, FP256)
+	}
+
 	if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
 		eax, _, _, _ := cpuid(0x8000001b)
 		fs.setIf((eax>>0)&1 == 1, IBSFFV)
@@ -1104,11 +1426,71 @@ func support() flagSet {
 		fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT)
 		fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT)
 		fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
+		fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE)
+		fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX)
+		fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1.
+		fs.setIf((eax>>11)&1 == 1, IBS_ZEN4)
+	}
+
+	if maxExtendedFunction() >= 0x8000001f && vend == AMD {
+		a, _, _, _ := cpuid(0x8000001f)
+		fs.setIf((a>>0)&1 == 1, SME)
+		fs.setIf((a>>1)&1 == 1, SEV)
+		fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH)
+		fs.setIf((a>>3)&1 == 1, SEV_ES)
+		fs.setIf((a>>4)&1 == 1, SEV_SNP)
+		fs.setIf((a>>5)&1 == 1, VMPL)
+		fs.setIf((a>>10)&1 == 1, SME_COHERENT)
+		fs.setIf((a>>11)&1 == 1, SEV_64BIT)
+		fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED)
+		fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE)
+		fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP)
+		fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST)
+		fs.setIf((a>>16)&1 == 1, VTE)
+		fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
+	}
+
+	if maxExtendedFunction() >= 0x80000021 && vend == AMD {
+		a, _, _, _ := cpuid(0x80000021)
+		fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX)
+		fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO)
+		fs.setIf((a>>29)&1 == 1, SRSO_NO)
+		fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE)
+		fs.setIf((a>>27)&1 == 1, SBPB)
+	}
+
+	if mfi >= 0x20 {
+		// Microsoft has decided to purposefully hide the information
+		// of the guest TEE when VMs are being created using Hyper-V.
+		//
+		// This leads us to check for the Hyper-V cpuid features
+		// (0x4000000C), and then for the `ebx` value set.
+		//
+		// For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
+		// we're mostly interested about,according to:
+		// https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
+		_, ebx, _, _ := cpuid(0x4000000C)
+		fs.setIf(ebx == 0xbe3, TDX_GUEST)
+	}
+
+	if mfi >= 0x21 {
+		// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
+		_, ebx, ecx, edx := cpuid(0x21)
+		identity := string(valAsString(ebx, edx, ecx))
+		fs.setIf(identity == "IntelTDX    ", TDX_GUEST)
 	}
 
 	return fs
 }
 
+func (c *CPUInfo) supportAVX10() uint8 {
+	if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
+		_, ebx, _, _ := cpuidex(0x24, 0)
+		return uint8(ebx)
+	}
+	return 0
+}
+
 func valAsString(values ...uint32) []byte {
 	r := make([]byte, 4*len(values))
 	for i, v := range values {
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
index 35678d8a3..799b400c2 100644
--- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
+++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
@@ -24,13 +24,15 @@ func addInfo(c *CPUInfo, safe bool) {
 	c.maxExFunc = maxExtendedFunction()
 	c.BrandName = brandName()
 	c.CacheLine = cacheLine()
-	c.Family, c.Model = familyModel()
+	c.Family, c.Model, c.Stepping = familyModel()
 	c.featureSet = support()
 	c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
+	c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV))
 	c.ThreadsPerCore = threadsPerCore()
 	c.LogicalCores = logicalCores()
 	c.PhysicalCores = physicalCores()
 	c.VendorID, c.VendorString = vendorID()
+	c.AVX10Level = c.supportAVX10()
 	c.cacheSize()
 	c.frequencies()
 }
diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
index 02fe232aa..57a085a53 100644
--- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
+++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
@@ -13,137 +13,225 @@ func _() {
 	_ = x[AMD3DNOW-3]
 	_ = x[AMD3DNOWEXT-4]
 	_ = x[AMXBF16-5]
-	_ = x[AMXINT8-6]
-	_ = x[AMXTILE-7]
-	_ = x[AVX-8]
-	_ = x[AVX2-9]
-	_ = x[AVX512BF16-10]
-	_ = x[AVX512BITALG-11]
-	_ = x[AVX512BW-12]
-	_ = x[AVX512CD-13]
-	_ = x[AVX512DQ-14]
-	_ = x[AVX512ER-15]
-	_ = x[AVX512F-16]
-	_ = x[AVX512FP16-17]
-	_ = x[AVX512IFMA-18]
-	_ = x[AVX512PF-19]
-	_ = x[AVX512VBMI-20]
-	_ = x[AVX512VBMI2-21]
-	_ = x[AVX512VL-22]
-	_ = x[AVX512VNNI-23]
-	_ = x[AVX512VP2INTERSECT-24]
-	_ = x[AVX512VPOPCNTDQ-25]
-	_ = x[AVXSLOW-26]
-	_ = x[BMI1-27]
-	_ = x[BMI2-28]
-	_ = x[CETIBT-29]
-	_ = x[CETSS-30]
-	_ = x[CLDEMOTE-31]
-	_ = x[CLMUL-32]
-	_ = x[CLZERO-33]
-	_ = x[CMOV-34]
-	_ = x[CMPXCHG8-35]
-	_ = x[CPBOOST-36]
-	_ = x[CX16-37]
-	_ = x[ENQCMD-38]
-	_ = x[ERMS-39]
-	_ = x[F16C-40]
-	_ = x[FMA3-41]
-	_ = x[FMA4-42]
-	_ = x[FXSR-43]
-	_ = x[FXSROPT-44]
-	_ = x[GFNI-45]
-	_ = x[HLE-46]
-	_ = x[HTT-47]
-	_ = x[HWA-48]
-	_ = x[HYPERVISOR-49]
-	_ = x[IBPB-50]
-	_ = x[IBS-51]
-	_ = x[IBSBRNTRGT-52]
-	_ = x[IBSFETCHSAM-53]
-	_ = x[IBSFFV-54]
-	_ = x[IBSOPCNT-55]
-	_ = x[IBSOPCNTEXT-56]
-	_ = x[IBSOPSAM-57]
-	_ = x[IBSRDWROPCNT-58]
-	_ = x[IBSRIPINVALIDCHK-59]
-	_ = x[INT_WBINVD-60]
-	_ = x[INVLPGB-61]
-	_ = x[LAHF-62]
-	_ = x[LZCNT-63]
-	_ = x[MCAOVERFLOW-64]
-	_ = x[MCOMMIT-65]
-	_ = x[MMX-66]
-	_ = x[MMXEXT-67]
-	_ = x[MOVBE-68]
-	_ = x[MOVDIR64B-69]
-	_ = x[MOVDIRI-70]
-	_ = x[MPX-71]
-	_ = x[MSRIRC-72]
-	_ = x[NX-73]
-	_ = x[OSXSAVE-74]
-	_ = x[POPCNT-75]
-	_ = x[RDPRU-76]
-	_ = x[RDRAND-77]
-	_ = x[RDSEED-78]
-	_ = x[RDTSCP-79]
-	_ = x[RTM-80]
-	_ = x[RTM_ALWAYS_ABORT-81]
-	_ = x[SCE-82]
-	_ = x[SERIALIZE-83]
-	_ = x[SGX-84]
-	_ = x[SGXLC-85]
-	_ = x[SHA-86]
-	_ = x[SSE-87]
-	_ = x[SSE2-88]
-	_ = x[SSE3-89]
-	_ = x[SSE4-90]
-	_ = x[SSE42-91]
-	_ = x[SSE4A-92]
-	_ = x[SSSE3-93]
-	_ = x[STIBP-94]
-	_ = x[SUCCOR-95]
-	_ = x[TBM-96]
-	_ = x[TSXLDTRK-97]
-	_ = x[VAES-98]
-	_ = x[VMX-99]
-	_ = x[VPCLMULQDQ-100]
-	_ = x[WAITPKG-101]
-	_ = x[WBNOINVD-102]
-	_ = x[X87-103]
-	_ = x[XOP-104]
-	_ = x[XSAVE-105]
-	_ = x[AESARM-106]
-	_ = x[ARMCPUID-107]
-	_ = x[ASIMD-108]
-	_ = x[ASIMDDP-109]
-	_ = x[ASIMDHP-110]
-	_ = x[ASIMDRDM-111]
-	_ = x[ATOMICS-112]
-	_ = x[CRC32-113]
-	_ = x[DCPOP-114]
-	_ = x[EVTSTRM-115]
-	_ = x[FCMA-116]
-	_ = x[FP-117]
-	_ = x[FPHP-118]
-	_ = x[GPA-119]
-	_ = x[JSCVT-120]
-	_ = x[LRCPC-121]
-	_ = x[PMULL-122]
-	_ = x[SHA1-123]
-	_ = x[SHA2-124]
-	_ = x[SHA3-125]
-	_ = x[SHA512-126]
-	_ = x[SM3-127]
-	_ = x[SM4-128]
-	_ = x[SVE-129]
-	_ = x[lastID-130]
+	_ = x[AMXFP16-6]
+	_ = x[AMXINT8-7]
+	_ = x[AMXTILE-8]
+	_ = x[APX_F-9]
+	_ = x[AVX-10]
+	_ = x[AVX10-11]
+	_ = x[AVX10_128-12]
+	_ = x[AVX10_256-13]
+	_ = x[AVX10_512-14]
+	_ = x[AVX2-15]
+	_ = x[AVX512BF16-16]
+	_ = x[AVX512BITALG-17]
+	_ = x[AVX512BW-18]
+	_ = x[AVX512CD-19]
+	_ = x[AVX512DQ-20]
+	_ = x[AVX512ER-21]
+	_ = x[AVX512F-22]
+	_ = x[AVX512FP16-23]
+	_ = x[AVX512IFMA-24]
+	_ = x[AVX512PF-25]
+	_ = x[AVX512VBMI-26]
+	_ = x[AVX512VBMI2-27]
+	_ = x[AVX512VL-28]
+	_ = x[AVX512VNNI-29]
+	_ = x[AVX512VP2INTERSECT-30]
+	_ = x[AVX512VPOPCNTDQ-31]
+	_ = x[AVXIFMA-32]
+	_ = x[AVXNECONVERT-33]
+	_ = x[AVXSLOW-34]
+	_ = x[AVXVNNI-35]
+	_ = x[AVXVNNIINT8-36]
+	_ = x[BHI_CTRL-37]
+	_ = x[BMI1-38]
+	_ = x[BMI2-39]
+	_ = x[CETIBT-40]
+	_ = x[CETSS-41]
+	_ = x[CLDEMOTE-42]
+	_ = x[CLMUL-43]
+	_ = x[CLZERO-44]
+	_ = x[CMOV-45]
+	_ = x[CMPCCXADD-46]
+	_ = x[CMPSB_SCADBS_SHORT-47]
+	_ = x[CMPXCHG8-48]
+	_ = x[CPBOOST-49]
+	_ = x[CPPC-50]
+	_ = x[CX16-51]
+	_ = x[EFER_LMSLE_UNS-52]
+	_ = x[ENQCMD-53]
+	_ = x[ERMS-54]
+	_ = x[F16C-55]
+	_ = x[FLUSH_L1D-56]
+	_ = x[FMA3-57]
+	_ = x[FMA4-58]
+	_ = x[FP128-59]
+	_ = x[FP256-60]
+	_ = x[FSRM-61]
+	_ = x[FXSR-62]
+	_ = x[FXSROPT-63]
+	_ = x[GFNI-64]
+	_ = x[HLE-65]
+	_ = x[HRESET-66]
+	_ = x[HTT-67]
+	_ = x[HWA-68]
+	_ = x[HYBRID_CPU-69]
+	_ = x[HYPERVISOR-70]
+	_ = x[IA32_ARCH_CAP-71]
+	_ = x[IA32_CORE_CAP-72]
+	_ = x[IBPB-73]
+	_ = x[IBPB_BRTYPE-74]
+	_ = x[IBRS-75]
+	_ = x[IBRS_PREFERRED-76]
+	_ = x[IBRS_PROVIDES_SMP-77]
+	_ = x[IBS-78]
+	_ = x[IBSBRNTRGT-79]
+	_ = x[IBSFETCHSAM-80]
+	_ = x[IBSFFV-81]
+	_ = x[IBSOPCNT-82]
+	_ = x[IBSOPCNTEXT-83]
+	_ = x[IBSOPSAM-84]
+	_ = x[IBSRDWROPCNT-85]
+	_ = x[IBSRIPINVALIDCHK-86]
+	_ = x[IBS_FETCH_CTLX-87]
+	_ = x[IBS_OPDATA4-88]
+	_ = x[IBS_OPFUSE-89]
+	_ = x[IBS_PREVENTHOST-90]
+	_ = x[IBS_ZEN4-91]
+	_ = x[IDPRED_CTRL-92]
+	_ = x[INT_WBINVD-93]
+	_ = x[INVLPGB-94]
+	_ = x[KEYLOCKER-95]
+	_ = x[KEYLOCKERW-96]
+	_ = x[LAHF-97]
+	_ = x[LAM-98]
+	_ = x[LBRVIRT-99]
+	_ = x[LZCNT-100]
+	_ = x[MCAOVERFLOW-101]
+	_ = x[MCDT_NO-102]
+	_ = x[MCOMMIT-103]
+	_ = x[MD_CLEAR-104]
+	_ = x[MMX-105]
+	_ = x[MMXEXT-106]
+	_ = x[MOVBE-107]
+	_ = x[MOVDIR64B-108]
+	_ = x[MOVDIRI-109]
+	_ = x[MOVSB_ZL-110]
+	_ = x[MOVU-111]
+	_ = x[MPX-112]
+	_ = x[MSRIRC-113]
+	_ = x[MSRLIST-114]
+	_ = x[MSR_PAGEFLUSH-115]
+	_ = x[NRIPS-116]
+	_ = x[NX-117]
+	_ = x[OSXSAVE-118]
+	_ = x[PCONFIG-119]
+	_ = x[POPCNT-120]
+	_ = x[PPIN-121]
+	_ = x[PREFETCHI-122]
+	_ = x[PSFD-123]
+	_ = x[RDPRU-124]
+	_ = x[RDRAND-125]
+	_ = x[RDSEED-126]
+	_ = x[RDTSCP-127]
+	_ = x[RRSBA_CTRL-128]
+	_ = x[RTM-129]
+	_ = x[RTM_ALWAYS_ABORT-130]
+	_ = x[SBPB-131]
+	_ = x[SERIALIZE-132]
+	_ = x[SEV-133]
+	_ = x[SEV_64BIT-134]
+	_ = x[SEV_ALTERNATIVE-135]
+	_ = x[SEV_DEBUGSWAP-136]
+	_ = x[SEV_ES-137]
+	_ = x[SEV_RESTRICTED-138]
+	_ = x[SEV_SNP-139]
+	_ = x[SGX-140]
+	_ = x[SGXLC-141]
+	_ = x[SHA-142]
+	_ = x[SME-143]
+	_ = x[SME_COHERENT-144]
+	_ = x[SPEC_CTRL_SSBD-145]
+	_ = x[SRBDS_CTRL-146]
+	_ = x[SRSO_MSR_FIX-147]
+	_ = x[SRSO_NO-148]
+	_ = x[SRSO_USER_KERNEL_NO-149]
+	_ = x[SSE-150]
+	_ = x[SSE2-151]
+	_ = x[SSE3-152]
+	_ = x[SSE4-153]
+	_ = x[SSE42-154]
+	_ = x[SSE4A-155]
+	_ = x[SSSE3-156]
+	_ = x[STIBP-157]
+	_ = x[STIBP_ALWAYSON-158]
+	_ = x[STOSB_SHORT-159]
+	_ = x[SUCCOR-160]
+	_ = x[SVM-161]
+	_ = x[SVMDA-162]
+	_ = x[SVMFBASID-163]
+	_ = x[SVML-164]
+	_ = x[SVMNP-165]
+	_ = x[SVMPF-166]
+	_ = x[SVMPFT-167]
+	_ = x[SYSCALL-168]
+	_ = x[SYSEE-169]
+	_ = x[TBM-170]
+	_ = x[TDX_GUEST-171]
+	_ = x[TLB_FLUSH_NESTED-172]
+	_ = x[TME-173]
+	_ = x[TOPEXT-174]
+	_ = x[TSCRATEMSR-175]
+	_ = x[TSXLDTRK-176]
+	_ = x[VAES-177]
+	_ = x[VMCBCLEAN-178]
+	_ = x[VMPL-179]
+	_ = x[VMSA_REGPROT-180]
+	_ = x[VMX-181]
+	_ = x[VPCLMULQDQ-182]
+	_ = x[VTE-183]
+	_ = x[WAITPKG-184]
+	_ = x[WBNOINVD-185]
+	_ = x[WRMSRNS-186]
+	_ = x[X87-187]
+	_ = x[XGETBV1-188]
+	_ = x[XOP-189]
+	_ = x[XSAVE-190]
+	_ = x[XSAVEC-191]
+	_ = x[XSAVEOPT-192]
+	_ = x[XSAVES-193]
+	_ = x[AESARM-194]
+	_ = x[ARMCPUID-195]
+	_ = x[ASIMD-196]
+	_ = x[ASIMDDP-197]
+	_ = x[ASIMDHP-198]
+	_ = x[ASIMDRDM-199]
+	_ = x[ATOMICS-200]
+	_ = x[CRC32-201]
+	_ = x[DCPOP-202]
+	_ = x[EVTSTRM-203]
+	_ = x[FCMA-204]
+	_ = x[FP-205]
+	_ = x[FPHP-206]
+	_ = x[GPA-207]
+	_ = x[JSCVT-208]
+	_ = x[LRCPC-209]
+	_ = x[PMULL-210]
+	_ = x[SHA1-211]
+	_ = x[SHA2-212]
+	_ = x[SHA3-213]
+	_ = x[SHA512-214]
+	_ = x[SM3-215]
+	_ = x[SM4-216]
+	_ = x[SVE-217]
+	_ = x[lastID-218]
 	_ = x[firstID-0]
 }
 
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKINT_WBINVDINVLPGBLAHFLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMPXMSRIRCNXOSXSAVEPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSCESERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSUCCORTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDX87XOPXSAVEAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
+const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
 
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 234, 238, 244, 249, 257, 262, 268, 272, 280, 287, 291, 297, 301, 305, 309, 313, 317, 324, 328, 331, 334, 337, 347, 351, 354, 364, 375, 381, 389, 400, 408, 420, 436, 446, 453, 457, 462, 473, 480, 483, 489, 494, 503, 510, 513, 519, 521, 528, 534, 539, 545, 551, 557, 560, 576, 579, 588, 591, 596, 599, 602, 606, 610, 614, 619, 624, 629, 634, 640, 643, 651, 655, 658, 668, 675, 683, 686, 689, 694, 700, 708, 713, 720, 727, 735, 742, 747, 752, 759, 763, 765, 769, 772, 777, 782, 787, 791, 795, 799, 805, 808, 811, 814, 820}
+var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 561, 565, 579, 596, 599, 609, 620, 626, 634, 645, 653, 665, 681, 695, 706, 716, 731, 739, 750, 760, 767, 776, 786, 790, 793, 800, 805, 816, 823, 830, 838, 841, 847, 852, 861, 868, 876, 880, 883, 889, 896, 909, 914, 916, 923, 930, 936, 940, 949, 953, 958, 964, 970, 976, 986, 989, 1005, 1009, 1018, 1021, 1030, 1045, 1058, 1064, 1078, 1085, 1088, 1093, 1096, 1099, 1111, 1125, 1135, 1147, 1154, 1173, 1176, 1180, 1184, 1188, 1193, 1198, 1203, 1208, 1222, 1233, 1239, 1242, 1247, 1256, 1260, 1265, 1270, 1276, 1283, 1288, 1291, 1300, 1316, 1319, 1325, 1335, 1343, 1347, 1356, 1360, 1372, 1375, 1385, 1388, 1395, 1403, 1410, 1413, 1420, 1423, 1428, 1434, 1442, 1448, 1454, 1462, 1467, 1474, 1481, 1489, 1496, 1501, 1506, 1513, 1517, 1519, 1523, 1526, 1531, 1536, 1541, 1545, 1549, 1553, 1559, 1562, 1565, 1568, 1574}
 
 func (i FeatureID) String() string {
 	if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
index 8d2cb0368..84b1acd21 100644
--- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
+++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
@@ -2,18 +2,120 @@
 
 package cpuid
 
-import "runtime"
+import (
+	"runtime"
+	"strings"
+
+	"golang.org/x/sys/unix"
+)
 
 func detectOS(c *CPUInfo) bool {
+	if runtime.GOOS != "ios" {
+		tryToFillCPUInfoFomSysctl(c)
+	}
 	// There are no hw.optional sysctl values for the below features on Mac OS 11.0
 	// to detect their supported state dynamically. Assume the CPU features that
 	// Apple Silicon M1 supports to be available as a minimal set of features
 	// to all Go programs running on darwin/arm64.
 	// TODO: Add more if we know them.
 	c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
-	c.PhysicalCores = runtime.NumCPU()
-	// For now assuming 1 thread per core...
-	c.ThreadsPerCore = 1
-	c.LogicalCores = c.PhysicalCores
+
 	return true
 }
+
+func sysctlGetBool(name string) bool {
+	value, err := unix.SysctlUint32(name)
+	if err != nil {
+		return false
+	}
+	return value != 0
+}
+
+func sysctlGetString(name string) string {
+	value, err := unix.Sysctl(name)
+	if err != nil {
+		return ""
+	}
+	return value
+}
+
+func sysctlGetInt(unknown int, names ...string) int {
+	for _, name := range names {
+		value, err := unix.SysctlUint32(name)
+		if err != nil {
+			continue
+		}
+		if value != 0 {
+			return int(value)
+		}
+	}
+	return unknown
+}
+
+func sysctlGetInt64(unknown int, names ...string) int {
+	for _, name := range names {
+		value64, err := unix.SysctlUint64(name)
+		if err != nil {
+			continue
+		}
+		if int(value64) != unknown {
+			return int(value64)
+		}
+	}
+	return unknown
+}
+
+func setFeature(c *CPUInfo, name string, feature FeatureID) {
+	c.featureSet.setIf(sysctlGetBool(name), feature)
+}
+func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
+	c.BrandName = sysctlGetString("machdep.cpu.brand_string")
+
+	if len(c.BrandName) != 0 {
+		c.VendorString = strings.Fields(c.BrandName)[0]
+	}
+
+	c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
+	c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
+		sysctlGetInt(1, "hw.physicalcpu")
+	c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
+	c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
+	c.Model = sysctlGetInt(0, "machdep.cpu.model")
+	c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
+	c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
+	c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
+	c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
+	c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
+
+	// from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile
+	setFeature(c, "hw.optional.arm.FEAT_AES", AESARM)
+	setFeature(c, "hw.optional.AdvSIMD", ASIMD)
+	setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP)
+	setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM)
+	setFeature(c, "hw.optional.FEAT_CRC32", CRC32)
+	setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
+	// setFeature(c, "", EVTSTRM)
+	setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
+	setFeature(c, "hw.optional.arm.FEAT_FP", FP)
+	setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
+	setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
+	setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
+	setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
+	setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
+	setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1)
+	setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
+	setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
+	setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
+	// setFeature(c, "", SM3)
+	// setFeature(c, "", SM4)
+	setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
+
+	// from empirical observation
+	setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP)
+	setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS)
+	setFeature(c, "hw.optional.floatingpoint", FP)
+	setFeature(c, "hw.optional.armv8_2_sha3", SHA3)
+	setFeature(c, "hw.optional.armv8_2_sha512", SHA512)
+	setFeature(c, "hw.optional.armv8_3_compnum", FCMA)
+	setFeature(c, "hw.optional.armv8_crc32", CRC32)
+}
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go
index 48d23f919..be01dec97 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go
@@ -32,6 +32,9 @@ func BuildGenerateCommand() command.Command {
 			{Name: "template-data", KeyPath: "CustomTemplateData",
 				UsageArgument: "template-data-file",
 				Usage:         "If specified, generate will use the contents of the file passed as data to be rendered in the test file template"},
+			{Name: "tags", KeyPath: "Tags",
+				UsageArgument: "build-tags",
+				Usage:         "If specified, generate will create a test file that uses the given build tags (i.e. `--tags e2e,!unit` will add `//go:build e2e,!unit`)"},
 		},
 		&conf,
 		types.GinkgoFlagSections{},
@@ -59,6 +62,7 @@ You can also pass a <filename> of the form "file.go" and generate will emit "fil
 }
 
 type specData struct {
+	BuildTags         string
 	Package           string
 	Subject           string
 	PackageImportPath string
@@ -93,6 +97,7 @@ func generateTestFileForSubject(subject string, conf GeneratorsConfig) {
 	}
 
 	data := specData{
+		BuildTags:         getBuildTags(conf.Tags),
 		Package:           determinePackageName(packageName, conf.Internal),
 		Subject:           formattedName,
 		PackageImportPath: getPackageImportPath(),
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go
index c3470adbf..4dab07d03 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go
@@ -1,6 +1,7 @@
 package generators
 
-var specText = `package {{.Package}}
+var specText = `{{.BuildTags}}
+package {{.Package}}
 
 import (
 	{{.GinkgoImport}}
@@ -14,7 +15,8 @@ var _ = {{.GinkgoPackage}}Describe("{{.Subject}}", func() {
 })
 `
 
-var agoutiSpecText = `package {{.Package}}
+var agoutiSpecText = `{{.BuildTags}}
+package {{.Package}}
 
 import (
 	{{.GinkgoImport}}
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go
index 3046a4487..28c7aa6f4 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go
@@ -1,6 +1,7 @@
 package generators
 
 import (
+	"fmt"
 	"go/build"
 	"os"
 	"path/filepath"
@@ -14,6 +15,7 @@ type GeneratorsConfig struct {
 	Agouti, NoDot, Internal bool
 	CustomTemplate          string
 	CustomTemplateData      string
+	Tags                    string
 }
 
 func getPackageAndFormattedName() (string, string, string) {
@@ -62,3 +64,13 @@ func determinePackageName(name string, internal bool) string {
 
 	return name + "_test"
 }
+
+// getBuildTags returns the resultant string to be added.
+// If the input string is not empty, then returns a `//go:build {}` string,
+// otherwise returns an empty string.
+func getBuildTags(tags string) string {
+	if tags != "" {
+		return fmt.Sprintf("//go:build %s\n", tags)
+	}
+	return ""
+}
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/gocovmerge.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/gocovmerge.go
new file mode 100644
index 000000000..3c5079ff4
--- /dev/null
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/gocovmerge.go
@@ -0,0 +1,129 @@
+// Copyright (c) 2015, Wade Simmons
+// All rights reserved.
+
+// Redistribution and use in source and binary forms, with or without
+// modification, are permitted provided that the following conditions are met:
+
+// 1. Redistributions of source code must retain the above copyright notice, this
+//    list of conditions and the following disclaimer.
+// 2. Redistributions in binary form must reproduce the above copyright notice,
+//    this list of conditions and the following disclaimer in the documentation
+//    and/or other materials provided with the distribution.
+
+// THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND
+// ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED
+// WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE
+// DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR
+// ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES
+// (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES;
+// LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND
+// ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
+// (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS
+// SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
+
+// Package gocovmerge takes the results from multiple `go test -coverprofile`
+// runs and merges them into one profile
+
+// this file was originally taken from the gocovmerge project
+// see also: https://go.shabbyrobe.org/gocovmerge
+package internal
+
+import (
+	"fmt"
+	"io"
+	"sort"
+
+	"golang.org/x/tools/cover"
+)
+
+func AddCoverProfile(profiles []*cover.Profile, p *cover.Profile) []*cover.Profile {
+	i := sort.Search(len(profiles), func(i int) bool { return profiles[i].FileName >= p.FileName })
+	if i < len(profiles) && profiles[i].FileName == p.FileName {
+		MergeCoverProfiles(profiles[i], p)
+	} else {
+		profiles = append(profiles, nil)
+		copy(profiles[i+1:], profiles[i:])
+		profiles[i] = p
+	}
+	return profiles
+}
+
+func DumpCoverProfiles(profiles []*cover.Profile, out io.Writer) error {
+	if len(profiles) == 0 {
+		return nil
+	}
+	if _, err := fmt.Fprintf(out, "mode: %s\n", profiles[0].Mode); err != nil {
+		return err
+	}
+	for _, p := range profiles {
+		for _, b := range p.Blocks {
+			if _, err := fmt.Fprintf(out, "%s:%d.%d,%d.%d %d %d\n", p.FileName, b.StartLine, b.StartCol, b.EndLine, b.EndCol, b.NumStmt, b.Count); err != nil {
+				return err
+			}
+		}
+	}
+	return nil
+}
+
+func MergeCoverProfiles(into *cover.Profile, merge *cover.Profile) error {
+	if into.Mode != merge.Mode {
+		return fmt.Errorf("cannot merge profiles with different modes")
+	}
+	// Since the blocks are sorted, we can keep track of where the last block
+	// was inserted and only look at the blocks after that as targets for merge
+	startIndex := 0
+	for _, b := range merge.Blocks {
+		var err error
+		startIndex, err = mergeProfileBlock(into, b, startIndex)
+		if err != nil {
+			return err
+		}
+	}
+	return nil
+}
+
+func mergeProfileBlock(p *cover.Profile, pb cover.ProfileBlock, startIndex int) (int, error) {
+	sortFunc := func(i int) bool {
+		pi := p.Blocks[i+startIndex]
+		return pi.StartLine >= pb.StartLine && (pi.StartLine != pb.StartLine || pi.StartCol >= pb.StartCol)
+	}
+
+	i := 0
+	if sortFunc(i) != true {
+		i = sort.Search(len(p.Blocks)-startIndex, sortFunc)
+	}
+
+	i += startIndex
+	if i < len(p.Blocks) && p.Blocks[i].StartLine == pb.StartLine && p.Blocks[i].StartCol == pb.StartCol {
+		if p.Blocks[i].EndLine != pb.EndLine || p.Blocks[i].EndCol != pb.EndCol {
+			return i, fmt.Errorf("gocovmerge: overlapping merge %v %v %v", p.FileName, p.Blocks[i], pb)
+		}
+		switch p.Mode {
+		case "set":
+			p.Blocks[i].Count |= pb.Count
+		case "count", "atomic":
+			p.Blocks[i].Count += pb.Count
+		default:
+			return i, fmt.Errorf("gocovmerge: unsupported covermode '%s'", p.Mode)
+		}
+
+	} else {
+		if i > 0 {
+			pa := p.Blocks[i-1]
+			if pa.EndLine >= pb.EndLine && (pa.EndLine != pb.EndLine || pa.EndCol > pb.EndCol) {
+				return i, fmt.Errorf("gocovmerge: overlap before %v %v %v", p.FileName, pa, pb)
+			}
+		}
+		if i < len(p.Blocks)-1 {
+			pa := p.Blocks[i+1]
+			if pa.StartLine <= pb.StartLine && (pa.StartLine != pb.StartLine || pa.StartCol < pb.StartCol) {
+				return i, fmt.Errorf("gocovmerge: overlap after %v %v %v", p.FileName, pa, pb)
+			}
+		}
+		p.Blocks = append(p.Blocks, cover.ProfileBlock{})
+		copy(p.Blocks[i+1:], p.Blocks[i:])
+		p.Blocks[i] = pb
+	}
+
+	return i + 1, nil
+}
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/profiles_and_reports.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/profiles_and_reports.go
index bd3c6d028..5f35864dd 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/profiles_and_reports.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/profiles_and_reports.go
@@ -1,7 +1,6 @@
 package internal
 
 import (
-	"bytes"
 	"fmt"
 	"os"
 	"os/exec"
@@ -12,6 +11,7 @@ import (
 	"github.com/google/pprof/profile"
 	"github.com/onsi/ginkgo/v2/reporters"
 	"github.com/onsi/ginkgo/v2/types"
+	"golang.org/x/tools/cover"
 )
 
 func AbsPathForGeneratedAsset(assetName string, suite TestSuite, cliConfig types.CLIConfig, process int) string {
@@ -144,38 +144,26 @@ func FinalizeProfilesAndReportsForSuites(suites TestSuites, cliConfig types.CLIC
 	return messages, nil
 }
 
-//loads each profile, combines them, deletes them, stores them in destination
+// loads each profile, merges them, deletes them, stores them in destination
 func MergeAndCleanupCoverProfiles(profiles []string, destination string) error {
-	combined := &bytes.Buffer{}
-	modeRegex := regexp.MustCompile(`^mode: .*\n`)
-	for i, profile := range profiles {
-		contents, err := os.ReadFile(profile)
+	var merged []*cover.Profile
+	for _, file := range profiles {
+		parsedProfiles, err := cover.ParseProfiles(file)
 		if err != nil {
-			return fmt.Errorf("Unable to read coverage file %s:\n%s", profile, err.Error())
+			return err
 		}
-		os.Remove(profile)
-
-		// remove the cover mode line from every file
-		// except the first one
-		if i > 0 {
-			contents = modeRegex.ReplaceAll(contents, []byte{})
-		}
-
-		_, err = combined.Write(contents)
-
-		// Add a newline to the end of every file if missing.
-		if err == nil && len(contents) > 0 && contents[len(contents)-1] != '\n' {
-			_, err = combined.Write([]byte("\n"))
-		}
-
-		if err != nil {
-			return fmt.Errorf("Unable to append to coverprofile:\n%s", err.Error())
+		os.Remove(file)
+		for _, p := range parsedProfiles {
+			merged = AddCoverProfile(merged, p)
 		}
 	}
-
-	err := os.WriteFile(destination, combined.Bytes(), 0666)
+	dst, err := os.OpenFile(destination, os.O_RDWR|os.O_CREATE|os.O_TRUNC, 0666)
+	if err != nil {
+		return err
+	}
+	err = DumpCoverProfiles(merged, dst)
 	if err != nil {
-		return fmt.Errorf("Unable to create combined cover profile:\n%s", err.Error())
+		return err
 	}
 	return nil
 }
@@ -184,7 +172,7 @@ func GetCoverageFromCoverProfile(profile string) (float64, error) {
 	cmd := exec.Command("go", "tool", "cover", "-func", profile)
 	output, err := cmd.CombinedOutput()
 	if err != nil {
-		return 0, fmt.Errorf("Could not process Coverprofile %s: %s", profile, err.Error())
+		return 0, fmt.Errorf("Could not process Coverprofile %s: %s - %s", profile, err.Error(), string(output))
 	}
 	re := regexp.MustCompile(`total:\s*\(statements\)\s*(\d*\.\d*)\%`)
 	matches := re.FindStringSubmatch(string(output))
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/test_suite.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/test_suite.go
index 64dcb1b78..df99875be 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/test_suite.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/internal/test_suite.go
@@ -7,6 +7,7 @@ import (
 	"path"
 	"path/filepath"
 	"regexp"
+	"runtime"
 	"strings"
 
 	"github.com/onsi/ginkgo/v2/types"
@@ -192,7 +193,7 @@ func precompiledTestSuite(path string) (TestSuite, error) {
 		return TestSuite{}, errors.New("this is not a .test binary")
 	}
 
-	if filepath.Ext(path) == ".test" && info.Mode()&0111 == 0 {
+	if filepath.Ext(path) == ".test" && runtime.GOOS != "windows" && info.Mode()&0111 == 0 {
 		return TestSuite{}, errors.New("this is not executable")
 	}
 
@@ -225,7 +226,7 @@ func suitesInDir(dir string, recurse bool) TestSuites {
 	files, _ := os.ReadDir(dir)
 	re := regexp.MustCompile(`^[^._].*_test\.go$`)
 	for _, file := range files {
-		if !file.IsDir() && re.Match([]byte(file.Name())) {
+		if !file.IsDir() && re.MatchString(file.Name()) {
 			suite := TestSuite{
 				Path:        relPath(dir),
 				PackageName: packageNameForSuite(dir),
@@ -240,7 +241,7 @@ func suitesInDir(dir string, recurse bool) TestSuites {
 	if recurse {
 		re = regexp.MustCompile(`^[._]`)
 		for _, file := range files {
-			if file.IsDir() && !re.Match([]byte(file.Name())) {
+			if file.IsDir() && !re.MatchString(file.Name()) {
 				suites = append(suites, suitesInDir(dir+"/"+file.Name(), recurse)...)
 			}
 		}
@@ -271,7 +272,7 @@ func filesHaveGinkgoSuite(dir string, files []os.DirEntry) bool {
 	reGinkgo := regexp.MustCompile(`package ginkgo|\/ginkgo"|\/ginkgo\/v2"|\/ginkgo\/v2/dsl/`)
 
 	for _, file := range files {
-		if !file.IsDir() && reTestFile.Match([]byte(file.Name())) {
+		if !file.IsDir() && reTestFile.MatchString(file.Name()) {
 			contents, _ := os.ReadFile(dir + "/" + file.Name())
 			if reGinkgo.Match(contents) {
 				return true
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go
index 0b9b19fe7..5d8d00bb1 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go
@@ -1,10 +1,11 @@
 package outline
 
 import (
-	"github.com/onsi/ginkgo/v2/types"
 	"go/ast"
 	"go/token"
 	"strconv"
+
+	"github.com/onsi/ginkgo/v2/types"
 )
 
 const (
@@ -244,9 +245,7 @@ func labelFromCallExpr(ce *ast.CallExpr) []string {
 			}
 			if id.Name == "Label" {
 				ls := extractLabels(expr)
-				for _, label := range ls {
-					labels = append(labels, label)
-				}
+				labels = append(labels, ls...)
 			}
 		}
 	}
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/import.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/import.go
index 67ec5ab75..f0a6b5d26 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/import.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/import.go
@@ -28,14 +28,7 @@ func packageNameForImport(f *ast.File, path string) *string {
 	}
 	name := spec.Name.String()
 	if name == "<nil>" {
-		// If the package name is not explicitly specified,
-		// make an educated guess. This is not guaranteed to be correct.
-		lastSlash := strings.LastIndex(path, "/")
-		if lastSlash == -1 {
-			name = path
-		} else {
-			name = path[lastSlash+1:]
-		}
+		name = "ginkgo"
 	}
 	if name == "." {
 		name = ""
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/dependencies.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/dependencies.go
index f5ddff30f..a34d94354 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/dependencies.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/dependencies.go
@@ -78,7 +78,7 @@ func (d Dependencies) resolveAndAdd(deps []string, depth int) {
 		if err != nil {
 			continue
 		}
-		if !pkg.Goroot && (!ginkgoAndGomegaFilter.Match([]byte(pkg.Dir)) || ginkgoIntegrationTestFilter.Match([]byte(pkg.Dir))) {
+		if !pkg.Goroot && (!ginkgoAndGomegaFilter.MatchString(pkg.Dir) || ginkgoIntegrationTestFilter.MatchString(pkg.Dir)) {
 			d.addDepIfNotPresent(pkg.Dir, depth)
 		}
 	}
diff --git a/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/package_hash.go b/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/package_hash.go
index e9f7ec0cb..17d052bdc 100644
--- a/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/package_hash.go
+++ b/vendor/github.com/onsi/ginkgo/v2/ginkgo/watch/package_hash.go
@@ -79,7 +79,7 @@ func (p *PackageHash) computeHashes() (codeHash string, codeModifiedTime time.Ti
 			continue
 		}
 
-		if goTestRegExp.Match([]byte(info.Name())) {
+		if goTestRegExp.MatchString(info.Name()) {
 			testHash += p.hashForFileInfo(info)
 			if info.ModTime().After(testModifiedTime) {
 				testModifiedTime = info.ModTime()
@@ -87,7 +87,7 @@ func (p *PackageHash) computeHashes() (codeHash string, codeModifiedTime time.Ti
 			continue
 		}
 
-		if p.watchRegExp.Match([]byte(info.Name())) {
+		if p.watchRegExp.MatchString(info.Name()) {
 			codeHash += p.hashForFileInfo(info)
 			if info.ModTime().After(codeModifiedTime) {
 				codeModifiedTime = info.ModTime()
diff --git a/vendor/github.com/onsi/ginkgo/v2/reporters/default_reporter.go b/vendor/github.com/onsi/ginkgo/v2/reporters/default_reporter.go
index 56b7be758..4026859ec 100644
--- a/vendor/github.com/onsi/ginkgo/v2/reporters/default_reporter.go
+++ b/vendor/github.com/onsi/ginkgo/v2/reporters/default_reporter.go
@@ -182,6 +182,22 @@ func (r *DefaultReporter) WillRun(report types.SpecReport) {
 	r.emitBlock(r.f(r.codeLocationBlock(report, "{{/}}", v.Is(types.VerbosityLevelVeryVerbose), false)))
 }
 
+func (r *DefaultReporter) wrapTextBlock(sectionName string, fn func()) {
+	r.emitBlock("\n")
+	if r.conf.GithubOutput {
+		r.emitBlock(r.fi(1, "::group::%s", sectionName))
+	} else {
+		r.emitBlock(r.fi(1, "{{gray}}%s >>{{/}}", sectionName))
+	}
+	fn()
+	if r.conf.GithubOutput {
+		r.emitBlock(r.fi(1, "::endgroup::"))
+	} else {
+		r.emitBlock(r.fi(1, "{{gray}}<< %s{{/}}", sectionName))
+	}
+
+}
+
 func (r *DefaultReporter) DidRun(report types.SpecReport) {
 	v := r.conf.Verbosity()
 	inParallel := report.RunningInParallel
@@ -283,26 +299,23 @@ func (r *DefaultReporter) DidRun(report types.SpecReport) {
 
 	//Emit Stdout/Stderr Output
 	if showSeparateStdSection {
-		r.emitBlock("\n")
-		r.emitBlock(r.fi(1, "{{gray}}Captured StdOut/StdErr Output >>{{/}}"))
-		r.emitBlock(r.fi(1, "%s", report.CapturedStdOutErr))
-		r.emitBlock(r.fi(1, "{{gray}}<< Captured StdOut/StdErr Output{{/}}"))
+		r.wrapTextBlock("Captured StdOut/StdErr Output", func() {
+			r.emitBlock(r.fi(1, "%s", report.CapturedStdOutErr))
+		})
 	}
 
 	if showSeparateVisibilityAlwaysReportsSection {
-		r.emitBlock("\n")
-		r.emitBlock(r.fi(1, "{{gray}}Report Entries >>{{/}}"))
-		for _, entry := range report.ReportEntries.WithVisibility(types.ReportEntryVisibilityAlways) {
-			r.emitReportEntry(1, entry)
-		}
-		r.emitBlock(r.fi(1, "{{gray}}<< Report Entries{{/}}"))
+		r.wrapTextBlock("Report Entries", func() {
+			for _, entry := range report.ReportEntries.WithVisibility(types.ReportEntryVisibilityAlways) {
+				r.emitReportEntry(1, entry)
+			}
+		})
 	}
 
 	if showTimeline {
-		r.emitBlock("\n")
-		r.emitBlock(r.fi(1, "{{gray}}Timeline >>{{/}}"))
-		r.emitTimeline(1, report, timeline)
-		r.emitBlock(r.fi(1, "{{gray}}<< Timeline{{/}}"))
+		r.wrapTextBlock("Timeline", func() {
+			r.emitTimeline(1, report, timeline)
+		})
 	}
 
 	// Emit Failure Message
@@ -405,7 +418,11 @@ func (r *DefaultReporter) emitShortFailure(indent uint, state types.SpecState, f
 func (r *DefaultReporter) emitFailure(indent uint, state types.SpecState, failure types.Failure, includeAdditionalFailure bool) {
 	highlightColor := r.highlightColorForState(state)
 	r.emitBlock(r.fi(indent, highlightColor+"[%s] %s{{/}}", r.humanReadableState(state), failure.Message))
-	r.emitBlock(r.fi(indent, highlightColor+"In {{bold}}[%s]{{/}}"+highlightColor+" at: {{bold}}%s{{/}} {{gray}}@ %s{{/}}\n", failure.FailureNodeType, failure.Location, failure.TimelineLocation.Time.Format(types.GINKGO_TIME_FORMAT)))
+	if r.conf.GithubOutput {
+		r.emitBlock(r.fi(indent, "::error file=%s,line=%d::%s %s", failure.Location.FileName, failure.Location.LineNumber, failure.FailureNodeType, failure.TimelineLocation.Time.Format(types.GINKGO_TIME_FORMAT)))
+	} else {
+		r.emitBlock(r.fi(indent, highlightColor+"In {{bold}}[%s]{{/}}"+highlightColor+" at: {{bold}}%s{{/}} {{gray}}@ %s{{/}}\n", failure.FailureNodeType, failure.Location, failure.TimelineLocation.Time.Format(types.GINKGO_TIME_FORMAT)))
+	}
 	if failure.ForwardedPanic != "" {
 		r.emitBlock("\n")
 		r.emitBlock(r.fi(indent, highlightColor+"%s{{/}}", failure.ForwardedPanic))
diff --git a/vendor/github.com/onsi/ginkgo/v2/reporters/json_report.go b/vendor/github.com/onsi/ginkgo/v2/reporters/json_report.go
index 7f96c450f..5d3e8db99 100644
--- a/vendor/github.com/onsi/ginkgo/v2/reporters/json_report.go
+++ b/vendor/github.com/onsi/ginkgo/v2/reporters/json_report.go
@@ -4,16 +4,21 @@ import (
 	"encoding/json"
 	"fmt"
 	"os"
+	"path"
 
 	"github.com/onsi/ginkgo/v2/types"
 )
 
-//GenerateJSONReport produces a JSON-formatted report at the passed in destination
+// GenerateJSONReport produces a JSON-formatted report at the passed in destination
 func GenerateJSONReport(report types.Report, destination string) error {
+	if err := os.MkdirAll(path.Dir(destination), 0770); err != nil {
+		return err
+	}
 	f, err := os.Create(destination)
 	if err != nil {
 		return err
 	}
+	defer f.Close()
 	enc := json.NewEncoder(f)
 	enc.SetIndent("", "  ")
 	err = enc.Encode([]types.Report{
@@ -22,11 +27,11 @@ func GenerateJSONReport(report types.Report, destination string) error {
 	if err != nil {
 		return err
 	}
-	return f.Close()
+	return nil
 }
 
-//MergeJSONReports produces a single JSON-formatted report at the passed in destination by merging the JSON-formatted reports provided in sources
-//It skips over reports that fail to decode but reports on them via the returned messages []string
+// MergeJSONReports produces a single JSON-formatted report at the passed in destination by merging the JSON-formatted reports provided in sources
+// It skips over reports that fail to decode but reports on them via the returned messages []string
 func MergeAndCleanupJSONReports(sources []string, destination string) ([]string, error) {
 	messages := []string{}
 	allReports := []types.Report{}
@@ -46,15 +51,19 @@ func MergeAndCleanupJSONReports(sources []string, destination string) ([]string,
 		allReports = append(allReports, reports...)
 	}
 
+	if err := os.MkdirAll(path.Dir(destination), 0770); err != nil {
+		return messages, err
+	}
 	f, err := os.Create(destination)
 	if err != nil {
 		return messages, err
 	}
+	defer f.Close()
 	enc := json.NewEncoder(f)
 	enc.SetIndent("", "  ")
 	err = enc.Encode(allReports)
 	if err != nil {
 		return messages, err
 	}
-	return messages, f.Close()
+	return messages, nil
 }
diff --git a/vendor/github.com/onsi/ginkgo/v2/reporters/junit_report.go b/vendor/github.com/onsi/ginkgo/v2/reporters/junit_report.go
index 592d7f614..43244a9bd 100644
--- a/vendor/github.com/onsi/ginkgo/v2/reporters/junit_report.go
+++ b/vendor/github.com/onsi/ginkgo/v2/reporters/junit_report.go
@@ -14,6 +14,8 @@ import (
 	"encoding/xml"
 	"fmt"
 	"os"
+	"path"
+	"regexp"
 	"strings"
 
 	"github.com/onsi/ginkgo/v2/config"
@@ -103,6 +105,8 @@ type JUnitProperty struct {
 	Value string `xml:"value,attr"`
 }
 
+var ownerRE = regexp.MustCompile(`(?i)^owner:(.*)$`)
+
 type JUnitTestCase struct {
 	// Name maps onto the full text of the spec - equivalent to "[SpecReport.LeafNodeType] SpecReport.FullText()"
 	Name string `xml:"name,attr"`
@@ -112,6 +116,8 @@ type JUnitTestCase struct {
 	Status string `xml:"status,attr"`
 	// Time is the time in seconds to execute the spec - maps onto SpecReport.RunTime
 	Time float64 `xml:"time,attr"`
+	// Owner is the owner the spec - is set if a label matching Label("owner:X") is provided.  The last matching label is used as the owner, thereby allowing specs to override owners specified in container nodes.
+	Owner string `xml:"owner,attr,omitempty"`
 	//Skipped is populated with a message if the test was skipped or pending
 	Skipped *JUnitSkipped `xml:"skipped,omitempty"`
 	//Error is populated if the test panicked or was interrupted
@@ -194,6 +200,12 @@ func GenerateJUnitReportWithConfig(report types.Report, dst string, config Junit
 		if len(labels) > 0 && !config.OmitSpecLabels {
 			name = name + " [" + strings.Join(labels, ", ") + "]"
 		}
+		owner := ""
+		for _, label := range labels {
+			if matches := ownerRE.FindStringSubmatch(label); len(matches) == 2 {
+				owner = matches[1]
+			}
+		}
 		name = strings.TrimSpace(name)
 
 		test := JUnitTestCase{
@@ -201,6 +213,7 @@ func GenerateJUnitReportWithConfig(report types.Report, dst string, config Junit
 			Classname: report.SuiteDescription,
 			Status:    spec.State.String(),
 			Time:      spec.RunTime.Seconds(),
+			Owner:     owner,
 		}
 		if !spec.State.Is(config.OmitTimelinesForSpecState) {
 			test.SystemErr = systemErrForUnstructuredReporters(spec)
@@ -285,6 +298,9 @@ func GenerateJUnitReportWithConfig(report types.Report, dst string, config Junit
 		TestSuites: []JUnitTestSuite{suite},
 	}
 
+	if err := os.MkdirAll(path.Dir(dst), 0770); err != nil {
+		return err
+	}
 	f, err := os.Create(dst)
 	if err != nil {
 		return err
@@ -322,6 +338,9 @@ func MergeAndCleanupJUnitReports(sources []string, dst string) ([]string, error)
 		mergedReport.TestSuites = append(mergedReport.TestSuites, report.TestSuites...)
 	}
 
+	if err := os.MkdirAll(path.Dir(dst), 0770); err != nil {
+		return messages, err
+	}
 	f, err := os.Create(dst)
 	if err != nil {
 		return messages, err
diff --git a/vendor/github.com/onsi/ginkgo/v2/reporters/teamcity_report.go b/vendor/github.com/onsi/ginkgo/v2/reporters/teamcity_report.go
index c1863496d..e990ad82e 100644
--- a/vendor/github.com/onsi/ginkgo/v2/reporters/teamcity_report.go
+++ b/vendor/github.com/onsi/ginkgo/v2/reporters/teamcity_report.go
@@ -11,6 +11,7 @@ package reporters
 import (
 	"fmt"
 	"os"
+	"path"
 	"strings"
 
 	"github.com/onsi/ginkgo/v2/types"
@@ -27,6 +28,9 @@ func tcEscape(s string) string {
 }
 
 func GenerateTeamcityReport(report types.Report, dst string) error {
+	if err := os.MkdirAll(path.Dir(dst), 0770); err != nil {
+		return err
+	}
 	f, err := os.Create(dst)
 	if err != nil {
 		return err
diff --git a/vendor/github.com/onsi/ginkgo/v2/types/code_location.go b/vendor/github.com/onsi/ginkgo/v2/types/code_location.go
index 9cd576817..57e87517e 100644
--- a/vendor/github.com/onsi/ginkgo/v2/types/code_location.go
+++ b/vendor/github.com/onsi/ginkgo/v2/types/code_location.go
@@ -149,7 +149,7 @@ func PruneStack(fullStackTrace string, skip int) string {
 		re := regexp.MustCompile(`\/ginkgo\/|\/pkg\/testing\/|\/pkg\/runtime\/`)
 		for i := 0; i < len(stack)/2; i++ {
 			// We filter out based on the source code file name.
-			if !re.Match([]byte(stack[i*2+1])) {
+			if !re.MatchString(stack[i*2+1]) {
 				prunedStack = append(prunedStack, stack[i*2])
 				prunedStack = append(prunedStack, stack[i*2+1])
 			}
diff --git a/vendor/github.com/onsi/ginkgo/v2/types/config.go b/vendor/github.com/onsi/ginkgo/v2/types/config.go
index 1014c7b49..cef273ee1 100644
--- a/vendor/github.com/onsi/ginkgo/v2/types/config.go
+++ b/vendor/github.com/onsi/ginkgo/v2/types/config.go
@@ -27,6 +27,7 @@ type SuiteConfig struct {
 	FailOnPending         bool
 	FailFast              bool
 	FlakeAttempts         int
+	MustPassRepeatedly    int
 	DryRun                bool
 	PollProgressAfter     time.Duration
 	PollProgressInterval  time.Duration
@@ -88,6 +89,7 @@ type ReporterConfig struct {
 	VeryVerbose    bool
 	FullTrace      bool
 	ShowNodeEvents bool
+	GithubOutput   bool
 
 	JSONReport     string
 	JUnitReport    string
@@ -263,7 +265,7 @@ var FlagSections = GinkgoFlagSections{
 // SuiteConfigFlags provides flags for the Ginkgo test process, and CLI
 var SuiteConfigFlags = GinkgoFlags{
 	{KeyPath: "S.RandomSeed", Name: "seed", SectionKey: "order", UsageDefaultValue: "randomly generated by Ginkgo",
-		Usage: "The seed used to randomize the spec suite."},
+		Usage: "The seed used to randomize the spec suite.", AlwaysExport: true},
 	{KeyPath: "S.RandomizeAllSpecs", Name: "randomize-all", SectionKey: "order", DeprecatedName: "randomizeAllSpecs", DeprecatedDocLink: "changed-command-line-flags",
 		Usage: "If set, ginkgo will randomize all specs together.  By default, ginkgo only randomizes the top level Describe, Context and When containers."},
 
@@ -330,6 +332,8 @@ var ReporterConfigFlags = GinkgoFlags{
 		Usage: "If set, default reporter prints out the full stack trace when a failure occurs"},
 	{KeyPath: "R.ShowNodeEvents", Name: "show-node-events", SectionKey: "output",
 		Usage: "If set, default reporter prints node > Enter and < Exit events when specs fail"},
+	{KeyPath: "R.GithubOutput", Name: "github-output", SectionKey: "output",
+		Usage: "If set, default reporter prints easier to manage output in Github Actions."},
 
 	{KeyPath: "R.JSONReport", Name: "json-report", UsageArgument: "filename.json", SectionKey: "output",
 		Usage: "If set, Ginkgo will generate a JSON-formatted test report at the specified location."},
diff --git a/vendor/github.com/onsi/ginkgo/v2/types/errors.go b/vendor/github.com/onsi/ginkgo/v2/types/errors.go
index 1e0dbfd9d..6bb72d00c 100644
--- a/vendor/github.com/onsi/ginkgo/v2/types/errors.go
+++ b/vendor/github.com/onsi/ginkgo/v2/types/errors.go
@@ -453,8 +453,8 @@ func (g ginkgoErrors) InvalidEntryDescription(cl CodeLocation) error {
 
 func (g ginkgoErrors) MissingParametersForTableFunction(cl CodeLocation) error {
 	return GinkgoError{
-		Heading:      fmt.Sprintf("No parameters have been passed to the Table Function"),
-		Message:      fmt.Sprintf("The Table Function expected at least 1 parameter"),
+		Heading:      "No parameters have been passed to the Table Function",
+		Message:      "The Table Function expected at least 1 parameter",
 		CodeLocation: cl,
 		DocLink:      "table-specs",
 	}
@@ -505,6 +505,15 @@ func (g ginkgoErrors) IncorrectVariadicParameterTypeToTableFunction(expected, ac
 	}
 }
 
+func (g ginkgoErrors) ContextsCannotBeUsedInSubtreeTables(cl CodeLocation) error {
+	return GinkgoError{
+		Heading:      "Contexts cannot be used in subtree tables",
+		Message:      "You''ve defined a subtree body function that accepts a context but did not provide one in the table entry.  Ginkgo SpecContexts can only be passed in to subject and setup nodes - so if you are trying to implement a spec timeout you should request a context in the It function within your subtree body function, not in the subtree body function itself.",
+		CodeLocation: cl,
+		DocLink:      "table-specs",
+	}
+}
+
 /* Parallel Synchronization errors */
 
 func (g ginkgoErrors) AggregatedReportUnavailableDueToNodeDisappearing() error {
diff --git a/vendor/github.com/onsi/ginkgo/v2/types/flags.go b/vendor/github.com/onsi/ginkgo/v2/types/flags.go
index 9186ae873..de69f3022 100644
--- a/vendor/github.com/onsi/ginkgo/v2/types/flags.go
+++ b/vendor/github.com/onsi/ginkgo/v2/types/flags.go
@@ -24,7 +24,8 @@ type GinkgoFlag struct {
 	DeprecatedDocLink string
 	DeprecatedVersion string
 
-	ExportAs string
+	ExportAs     string
+	AlwaysExport bool
 }
 
 type GinkgoFlags []GinkgoFlag
@@ -431,7 +432,7 @@ func (ssv stringSliceVar) Set(s string) error {
 	return nil
 }
 
-//given a set of GinkgoFlags and bindings, generate flag arguments suitable to be passed to an application with that set of flags configured.
+// given a set of GinkgoFlags and bindings, generate flag arguments suitable to be passed to an application with that set of flags configured.
 func GenerateFlagArgs(flags GinkgoFlags, bindings interface{}) ([]string, error) {
 	result := []string{}
 	for _, flag := range flags {
@@ -451,19 +452,19 @@ func GenerateFlagArgs(flags GinkgoFlags, bindings interface{}) ([]string, error)
 		iface := value.Interface()
 		switch value.Type() {
 		case reflect.TypeOf(string("")):
-			if iface.(string) != "" {
+			if iface.(string) != "" || flag.AlwaysExport {
 				result = append(result, fmt.Sprintf("--%s=%s", name, iface))
 			}
 		case reflect.TypeOf(int64(0)):
-			if iface.(int64) != 0 {
+			if iface.(int64) != 0 || flag.AlwaysExport {
 				result = append(result, fmt.Sprintf("--%s=%d", name, iface))
 			}
 		case reflect.TypeOf(float64(0)):
-			if iface.(float64) != 0 {
+			if iface.(float64) != 0 || flag.AlwaysExport {
 				result = append(result, fmt.Sprintf("--%s=%f", name, iface))
 			}
 		case reflect.TypeOf(int(0)):
-			if iface.(int) != 0 {
+			if iface.(int) != 0 || flag.AlwaysExport {
 				result = append(result, fmt.Sprintf("--%s=%d", name, iface))
 			}
 		case reflect.TypeOf(bool(true)):
@@ -471,7 +472,7 @@ func GenerateFlagArgs(flags GinkgoFlags, bindings interface{}) ([]string, error)
 				result = append(result, fmt.Sprintf("--%s", name))
 			}
 		case reflect.TypeOf(time.Duration(0)):
-			if iface.(time.Duration) != time.Duration(0) {
+			if iface.(time.Duration) != time.Duration(0) || flag.AlwaysExport {
 				result = append(result, fmt.Sprintf("--%s=%s", name, iface))
 			}
 
diff --git a/vendor/github.com/onsi/ginkgo/v2/types/types.go b/vendor/github.com/onsi/ginkgo/v2/types/types.go
index d048a8ada..aae69b04c 100644
--- a/vendor/github.com/onsi/ginkgo/v2/types/types.go
+++ b/vendor/github.com/onsi/ginkgo/v2/types/types.go
@@ -97,9 +97,7 @@ func (report Report) Add(other Report) Report {
 	report.RunTime = report.EndTime.Sub(report.StartTime)
 
 	reports := make(SpecReports, len(report.SpecReports)+len(other.SpecReports))
-	for i := range report.SpecReports {
-		reports[i] = report.SpecReports[i]
-	}
+	copy(reports, report.SpecReports)
 	offset := len(report.SpecReports)
 	for i := range other.SpecReports {
 		reports[i+offset] = other.SpecReports[i]
diff --git a/vendor/github.com/onsi/ginkgo/v2/types/version.go b/vendor/github.com/onsi/ginkgo/v2/types/version.go
index 43066341e..851d42b45 100644
--- a/vendor/github.com/onsi/ginkgo/v2/types/version.go
+++ b/vendor/github.com/onsi/ginkgo/v2/types/version.go
@@ -1,3 +1,3 @@
 package types
 
-const VERSION = "2.9.5"
+const VERSION = "2.17.1"
diff --git a/vendor/github.com/shopspring/decimal/.travis.yml b/vendor/github.com/shopspring/decimal/.travis.yml
deleted file mode 100644
index 6326d40f0..000000000
--- a/vendor/github.com/shopspring/decimal/.travis.yml
+++ /dev/null
@@ -1,19 +0,0 @@
-language: go
-
-arch: 
- - amd64
- - ppc64le
-
-go:
-  - 1.7.x
-  - 1.14.x
-  - 1.15.x
-  - 1.16.x
-  - 1.17.x
-  - tip
-
-install:
-  - go build .
-
-script:
-  - go test -v
diff --git a/vendor/github.com/shopspring/decimal/CHANGELOG.md b/vendor/github.com/shopspring/decimal/CHANGELOG.md
index aea61154b..432d0fd4e 100644
--- a/vendor/github.com/shopspring/decimal/CHANGELOG.md
+++ b/vendor/github.com/shopspring/decimal/CHANGELOG.md
@@ -1,3 +1,30 @@
+## Decimal v1.4.0
+#### BREAKING
+- Drop support for Go version older than 1.10 [#361](https://github.com/shopspring/decimal/pull/361)
+
+#### FEATURES
+- Add implementation of natural logarithm [#339](https://github.com/shopspring/decimal/pull/339) [#357](https://github.com/shopspring/decimal/pull/357)
+- Add improved implementation of power operation [#358](https://github.com/shopspring/decimal/pull/358)
+- Add Compare method which forwards calls to Cmp [#346](https://github.com/shopspring/decimal/pull/346)
+- Add NewFromBigRat constructor [#288](https://github.com/shopspring/decimal/pull/288)
+- Add NewFromUint64 constructor [#352](https://github.com/shopspring/decimal/pull/352)
+
+#### ENHANCEMENTS
+- Migrate to Github Actions [#245](https://github.com/shopspring/decimal/pull/245) [#340](https://github.com/shopspring/decimal/pull/340)
+- Fix examples for RoundDown, RoundFloor, RoundUp, and RoundCeil [#285](https://github.com/shopspring/decimal/pull/285) [#328](https://github.com/shopspring/decimal/pull/328) [#341](https://github.com/shopspring/decimal/pull/341)
+- Use Godoc standard to mark deprecated Equals and StringScaled methods [#342](https://github.com/shopspring/decimal/pull/342)
+- Removed unnecessary min function for RescalePair method [#265](https://github.com/shopspring/decimal/pull/265)
+- Avoid reallocation of initial slice in MarshalBinary (GobEncode) [#355](https://github.com/shopspring/decimal/pull/355)
+- Optimize NumDigits method [#301](https://github.com/shopspring/decimal/pull/301) [#356](https://github.com/shopspring/decimal/pull/356)
+- Optimize BigInt method [#359](https://github.com/shopspring/decimal/pull/359)
+- Support scanning uint64 [#131](https://github.com/shopspring/decimal/pull/131) [#364](https://github.com/shopspring/decimal/pull/364)
+- Add docs section with alternative libraries [#363](https://github.com/shopspring/decimal/pull/363)
+
+#### BUGFIXES
+- Fix incorrect calculation of decimal modulo [#258](https://github.com/shopspring/decimal/pull/258) [#317](https://github.com/shopspring/decimal/pull/317)
+- Allocate new(big.Int) in Copy method to deeply clone it [#278](https://github.com/shopspring/decimal/pull/278)
+- Fix overflow edge case in QuoRem method [#322](https://github.com/shopspring/decimal/pull/322)
+
 ## Decimal v1.3.1
 
 #### ENHANCEMENTS
diff --git a/vendor/github.com/shopspring/decimal/README.md b/vendor/github.com/shopspring/decimal/README.md
index 2e35df068..318c9df58 100644
--- a/vendor/github.com/shopspring/decimal/README.md
+++ b/vendor/github.com/shopspring/decimal/README.md
@@ -1,6 +1,8 @@
 # decimal
 
-[![Build Status](https://app.travis-ci.com/shopspring/decimal.svg?branch=master)](https://app.travis-ci.com/shopspring/decimal) [![GoDoc](https://godoc.org/github.com/shopspring/decimal?status.svg)](https://godoc.org/github.com/shopspring/decimal) [![Go Report Card](https://goreportcard.com/badge/github.com/shopspring/decimal)](https://goreportcard.com/report/github.com/shopspring/decimal)
+[![ci](https://github.com/shopspring/decimal/actions/workflows/ci.yml/badge.svg?branch=master)](https://github.com/shopspring/decimal/actions/workflows/ci.yml)
+[![GoDoc](https://godoc.org/github.com/shopspring/decimal?status.svg)](https://godoc.org/github.com/shopspring/decimal) 
+[![Go Report Card](https://goreportcard.com/badge/github.com/shopspring/decimal)](https://goreportcard.com/report/github.com/shopspring/decimal)
 
 Arbitrary-precision fixed-point decimal numbers in go.
 
@@ -20,7 +22,12 @@ Run `go get github.com/shopspring/decimal`
 
 ## Requirements 
 
-Decimal library requires Go version `>=1.7`
+Decimal library requires Go version `>=1.10`
+
+## Documentation
+
+http://godoc.org/github.com/shopspring/decimal
+
 
 ## Usage
 
@@ -57,14 +64,16 @@ func main() {
 }
 ```
 
-## Documentation
-
-http://godoc.org/github.com/shopspring/decimal
+## Alternative libraries
 
-## Production Usage
+When working with decimal numbers, you might face problems this library is not perfectly suited for. 
+Fortunately, thanks to the wonderful community we have a dozen other libraries that you can choose from.  
+Explore other alternatives to find the one that best fits your needs :)  
 
-* [Spring](https://shopspring.com/), since August 14, 2014.
-* If you are using this in production, please let us know!
+* [cockroachdb/apd](https://github.com/cockroachdb/apd) - arbitrary precision, mutable and rich API similar to `big.Int`, more performant than this library 
+* [alpacahq/alpacadecimal](https://github.com/alpacahq/alpacadecimal) - high performance, low precision (12 digits), fully compatible API with this library 
+* [govalues/decimal](https://github.com/govalues/decimal) - high performance, zero-allocation, low precision (19 digits)
+* [greatcloak/decimal](https://github.com/greatcloak/decimal) - fork focusing on billing and e-commerce web application related use cases, includes out-of-the-box BSON marshaling support
 
 ## FAQ
 
diff --git a/vendor/github.com/shopspring/decimal/const.go b/vendor/github.com/shopspring/decimal/const.go
new file mode 100644
index 000000000..e5d6fa87e
--- /dev/null
+++ b/vendor/github.com/shopspring/decimal/const.go
@@ -0,0 +1,63 @@
+package decimal
+
+import (
+	"strings"
+)
+
+const (
+	strLn10 = "2.302585092994045684017991454684364207601101488628772976033327900967572609677352480235997205089598298341967784042286248633409525465082806756666287369098781689482907208325554680843799894826233198528393505308965377732628846163366222287698219886746543667474404243274365155048934314939391479619404400222105101714174800368808401264708068556774321622835522011480466371565912137345074785694768346361679210180644507064800027750268491674655058685693567342067058113642922455440575892572420824131469568901675894025677631135691929203337658714166023010570308963457207544037084746994016826928280848118428931484852494864487192780967627127577539702766860595249671667418348570442250719796500471495105049221477656763693866297697952211071826454973477266242570942932258279850258550978526538320760672631716430950599508780752371033310119785754733154142180842754386359177811705430982748238504564801909561029929182431823752535770975053956518769751037497088869218020518933950723853920514463419726528728696511086257149219884997874887377134568620916705849807828059751193854445009978131146915934666241071846692310107598438319191292230792503747298650929009880391941702654416816335727555703151596113564846546190897042819763365836983716328982174407366009162177850541779276367731145041782137660111010731042397832521894898817597921798666394319523936855916447118246753245630912528778330963604262982153040874560927760726641354787576616262926568298704957954913954918049209069438580790032763017941503117866862092408537949861264933479354871737451675809537088281067452440105892444976479686075120275724181874989395971643105518848195288330746699317814634930000321200327765654130472621883970596794457943468343218395304414844803701305753674262153675579814770458031413637793236291560128185336498466942261465206459942072917119370602444929358037007718981097362533224548366988505528285966192805098447175198503666680874970496982273220244823343097169111136813588418696549323714996941979687803008850408979618598756579894836445212043698216415292987811742973332588607915912510967187510929248475023930572665446276200923068791518135803477701295593646298412366497023355174586195564772461857717369368404676577047874319780573853271810933883496338813069945569399346101090745616033312247949360455361849123333063704751724871276379140924398331810164737823379692265637682071706935846394531616949411701841938119405416449466111274712819705817783293841742231409930022911502362192186723337268385688273533371925103412930705632544426611429765388301822384091026198582888433587455960453004548370789052578473166283701953392231047527564998119228742789713715713228319641003422124210082180679525276689858180956119208391760721080919923461516952599099473782780648128058792731993893453415320185969711021407542282796298237068941764740642225757212455392526179373652434440560595336591539160312524480149313234572453879524389036839236450507881731359711238145323701508413491122324390927681724749607955799151363982881058285740538000653371655553014196332241918087621018204919492651483892"
+)
+
+var (
+	ln10 = newConstApproximation(strLn10)
+)
+
+type constApproximation struct {
+	exact          Decimal
+	approximations []Decimal
+}
+
+func newConstApproximation(value string) constApproximation {
+	parts := strings.Split(value, ".")
+	coeff, fractional := parts[0], parts[1]
+
+	coeffLen := len(coeff)
+	maxPrecision := len(fractional)
+
+	var approximations []Decimal
+	for p := 1; p < maxPrecision; p *= 2 {
+		r := RequireFromString(value[:coeffLen+p])
+		approximations = append(approximations, r)
+	}
+
+	return constApproximation{
+		RequireFromString(value),
+		approximations,
+	}
+}
+
+// Returns the smallest approximation available that's at least as precise
+// as the passed precision (places after decimal point), i.e. Floor[ log2(precision) ] + 1
+func (c constApproximation) withPrecision(precision int32) Decimal {
+	i := 0
+
+	if precision >= 1 {
+		i++
+	}
+
+	for precision >= 16 {
+		precision /= 16
+		i += 4
+	}
+
+	for precision >= 2 {
+		precision /= 2
+		i++
+	}
+
+	if i >= len(c.approximations) {
+		return c.exact
+	}
+
+	return c.approximations[i]
+}
diff --git a/vendor/github.com/shopspring/decimal/decimal.go b/vendor/github.com/shopspring/decimal/decimal.go
index 84405ec1c..a37a2301e 100644
--- a/vendor/github.com/shopspring/decimal/decimal.go
+++ b/vendor/github.com/shopspring/decimal/decimal.go
@@ -4,14 +4,14 @@
 //
 // The best way to create a new Decimal is to use decimal.NewFromString, ex:
 //
-//     n, err := decimal.NewFromString("-123.4567")
-//     n.String() // output: "-123.4567"
+//	n, err := decimal.NewFromString("-123.4567")
+//	n.String() // output: "-123.4567"
 //
 // To use Decimal as part of a struct:
 //
-//     type Struct struct {
-//         Number Decimal
-//     }
+//	type StructName struct {
+//	    Number Decimal
+//	}
 //
 // Note: This can "only" represent numbers with a maximum of 2^31 digits after the decimal point.
 package decimal
@@ -32,18 +32,31 @@ import (
 //
 // Example:
 //
-//     d1 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(3))
-//     d1.String() // output: "0.6666666666666667"
-//     d2 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(30000))
-//     d2.String() // output: "0.0000666666666667"
-//     d3 := decimal.NewFromFloat(20000).Div(decimal.NewFromFloat(3))
-//     d3.String() // output: "6666.6666666666666667"
-//     decimal.DivisionPrecision = 3
-//     d4 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(3))
-//     d4.String() // output: "0.667"
-//
+//	d1 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(3))
+//	d1.String() // output: "0.6666666666666667"
+//	d2 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(30000))
+//	d2.String() // output: "0.0000666666666667"
+//	d3 := decimal.NewFromFloat(20000).Div(decimal.NewFromFloat(3))
+//	d3.String() // output: "6666.6666666666666667"
+//	decimal.DivisionPrecision = 3
+//	d4 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(3))
+//	d4.String() // output: "0.667"
 var DivisionPrecision = 16
 
+// PowPrecisionNegativeExponent specifies the maximum precision of the result (digits after decimal point)
+// when calculating decimal power. Only used for cases where the exponent is a negative number.
+// This constant applies to Pow, PowInt32 and PowBigInt methods, PowWithPrecision method is not constrained by it.
+//
+// Example:
+//
+//	d1, err := decimal.NewFromFloat(15.2).PowInt32(-2)
+//	d1.String() // output: "0.0043282548476454"
+//
+//	decimal.PowPrecisionNegativeExponent = 24
+//	d2, err := decimal.NewFromFloat(15.2).PowInt32(-2)
+//	d2.String() // output: "0.004328254847645429362881"
+var PowPrecisionNegativeExponent = 16
+
 // MarshalJSONWithoutQuotes should be set to true if you want the decimal to
 // be JSON marshaled as a number, instead of as a string.
 // WARNING: this is dangerous for decimals with many digits, since many JSON
@@ -91,12 +104,12 @@ func New(value int64, exp int32) Decimal {
 	}
 }
 
-// NewFromInt converts a int64 to Decimal.
+// NewFromInt converts an int64 to Decimal.
 //
 // Example:
 //
-//     NewFromInt(123).String() // output: "123"
-//     NewFromInt(-10).String() // output: "-10"
+//	NewFromInt(123).String() // output: "123"
+//	NewFromInt(-10).String() // output: "-10"
 func NewFromInt(value int64) Decimal {
 	return Decimal{
 		value: big.NewInt(value),
@@ -104,12 +117,12 @@ func NewFromInt(value int64) Decimal {
 	}
 }
 
-// NewFromInt32 converts a int32 to Decimal.
+// NewFromInt32 converts an int32 to Decimal.
 //
 // Example:
 //
-//     NewFromInt(123).String() // output: "123"
-//     NewFromInt(-10).String() // output: "-10"
+//	NewFromInt(123).String() // output: "123"
+//	NewFromInt(-10).String() // output: "-10"
 func NewFromInt32(value int32) Decimal {
 	return Decimal{
 		value: big.NewInt(int64(value)),
@@ -117,6 +130,18 @@ func NewFromInt32(value int32) Decimal {
 	}
 }
 
+// NewFromUint64 converts an uint64 to Decimal.
+//
+// Example:
+//
+//	NewFromUint64(123).String() // output: "123"
+func NewFromUint64(value uint64) Decimal {
+	return Decimal{
+		value: new(big.Int).SetUint64(value),
+		exp:   0,
+	}
+}
+
 // NewFromBigInt returns a new Decimal from a big.Int, value * 10 ^ exp
 func NewFromBigInt(value *big.Int, exp int32) Decimal {
 	return Decimal{
@@ -125,15 +150,33 @@ func NewFromBigInt(value *big.Int, exp int32) Decimal {
 	}
 }
 
+// NewFromBigRat returns a new Decimal from a big.Rat. The numerator and
+// denominator are divided and rounded to the given precision.
+//
+// Example:
+//
+//	d1 := NewFromBigRat(big.NewRat(0, 1), 0)    // output: "0"
+//	d2 := NewFromBigRat(big.NewRat(4, 5), 1)    // output: "0.8"
+//	d3 := NewFromBigRat(big.NewRat(1000, 3), 3) // output: "333.333"
+//	d4 := NewFromBigRat(big.NewRat(2, 7), 4)    // output: "0.2857"
+func NewFromBigRat(value *big.Rat, precision int32) Decimal {
+	return Decimal{
+		value: new(big.Int).Set(value.Num()),
+		exp:   0,
+	}.DivRound(Decimal{
+		value: new(big.Int).Set(value.Denom()),
+		exp:   0,
+	}, precision)
+}
+
 // NewFromString returns a new Decimal from a string representation.
 // Trailing zeroes are not trimmed.
 //
 // Example:
 //
-//     d, err := NewFromString("-123.45")
-//     d2, err := NewFromString(".0001")
-//     d3, err := NewFromString("1.47000")
-//
+//	d, err := NewFromString("-123.45")
+//	d2, err := NewFromString(".0001")
+//	d3, err := NewFromString("1.47000")
 func NewFromString(value string) (Decimal, error) {
 	originalInput := value
 	var intString string
@@ -211,15 +254,14 @@ func NewFromString(value string) (Decimal, error) {
 //
 // Example:
 //
-//     r := regexp.MustCompile("[$,]")
-//     d1, err := NewFromFormattedString("$5,125.99", r)
+//	r := regexp.MustCompile("[$,]")
+//	d1, err := NewFromFormattedString("$5,125.99", r)
 //
-//     r2 := regexp.MustCompile("[_]")
-//     d2, err := NewFromFormattedString("1_000_000", r2)
-//
-//     r3 := regexp.MustCompile("[USD\\s]")
-//     d3, err := NewFromFormattedString("5000 USD", r3)
+//	r2 := regexp.MustCompile("[_]")
+//	d2, err := NewFromFormattedString("1_000_000", r2)
 //
+//	r3 := regexp.MustCompile("[USD\\s]")
+//	d3, err := NewFromFormattedString("5000 USD", r3)
 func NewFromFormattedString(value string, replRegexp *regexp.Regexp) (Decimal, error) {
 	parsedValue := replRegexp.ReplaceAllString(value, "")
 	d, err := NewFromString(parsedValue)
@@ -230,13 +272,12 @@ func NewFromFormattedString(value string, replRegexp *regexp.Regexp) (Decimal, e
 }
 
 // RequireFromString returns a new Decimal from a string representation
-// or panics if NewFromString would have returned an error.
+// or panics if NewFromString had returned an error.
 //
 // Example:
 //
-//     d := RequireFromString("-123.45")
-//     d2 := RequireFromString(".0001")
-//
+//	d := RequireFromString("-123.45")
+//	d2 := RequireFromString(".0001")
 func RequireFromString(value string) Decimal {
 	dec, err := NewFromString(value)
 	if err != nil {
@@ -332,8 +373,7 @@ func newFromFloat(val float64, bits uint64, flt *floatInfo) Decimal {
 //
 // Example:
 //
-//     NewFromFloatWithExponent(123.456, -2).String() // output: "123.46"
-//
+//	NewFromFloatWithExponent(123.456, -2).String() // output: "123.46"
 func NewFromFloatWithExponent(value float64, exp int32) Decimal {
 	if math.IsNaN(value) || math.IsInf(value, 0) {
 		panic(fmt.Sprintf("Cannot create a Decimal from %v", value))
@@ -418,7 +458,7 @@ func NewFromFloatWithExponent(value float64, exp int32) Decimal {
 func (d Decimal) Copy() Decimal {
 	d.ensureInitialized()
 	return Decimal{
-		value: &(*d.value),
+		value: new(big.Int).Set(d.value),
 		exp:   d.exp,
 	}
 }
@@ -430,7 +470,7 @@ func (d Decimal) Copy() Decimal {
 //
 // Example:
 //
-// 	d := New(12345, -4)
+//	d := New(12345, -4)
 //	d2 := d.rescale(-1)
 //	d3 := d2.rescale(-4)
 //	println(d1)
@@ -442,7 +482,6 @@ func (d Decimal) Copy() Decimal {
 //	1.2345
 //	1.2
 //	1.2000
-//
 func (d Decimal) rescale(exp int32) Decimal {
 	d.ensureInitialized()
 
@@ -552,11 +591,13 @@ func (d Decimal) Div(d2 Decimal) Decimal {
 	return d.DivRound(d2, int32(DivisionPrecision))
 }
 
-// QuoRem does divsion with remainder
+// QuoRem does division with remainder
 // d.QuoRem(d2,precision) returns quotient q and remainder r such that
-//   d = d2 * q + r, q an integer multiple of 10^(-precision)
-//   0 <= r < abs(d2) * 10 ^(-precision) if d>=0
-//   0 >= r > -abs(d2) * 10 ^(-precision) if d<0
+//
+//	d = d2 * q + r, q an integer multiple of 10^(-precision)
+//	0 <= r < abs(d2) * 10 ^(-precision) if d>=0
+//	0 >= r > -abs(d2) * 10 ^(-precision) if d<0
+//
 // Note that precision<0 is allowed as input.
 func (d Decimal) QuoRem(d2 Decimal, precision int32) (Decimal, Decimal) {
 	d.ensureInitialized()
@@ -565,7 +606,7 @@ func (d Decimal) QuoRem(d2 Decimal, precision int32) (Decimal, Decimal) {
 		panic("decimal division by 0")
 	}
 	scale := -precision
-	e := int64(d.exp - d2.exp - scale)
+	e := int64(d.exp) - int64(d2.exp) - int64(scale)
 	if e > math.MaxInt32 || e < math.MinInt32 {
 		panic("overflow in decimal QuoRem")
 	}
@@ -599,8 +640,10 @@ func (d Decimal) QuoRem(d2 Decimal, precision int32) (Decimal, Decimal) {
 
 // DivRound divides and rounds to a given precision
 // i.e. to an integer multiple of 10^(-precision)
-//   for a positive quotient digit 5 is rounded up, away from 0
-//   if the quotient is negative then digit 5 is rounded down, away from 0
+//
+//	for a positive quotient digit 5 is rounded up, away from 0
+//	if the quotient is negative then digit 5 is rounded down, away from 0
+//
 // Note that precision<0 is allowed as input.
 func (d Decimal) DivRound(d2 Decimal, precision int32) Decimal {
 	// QuoRem already checks initialization
@@ -628,24 +671,278 @@ func (d Decimal) DivRound(d2 Decimal, precision int32) Decimal {
 
 // Mod returns d % d2.
 func (d Decimal) Mod(d2 Decimal) Decimal {
-	quo := d.Div(d2).Truncate(0)
-	return d.Sub(d2.Mul(quo))
+	_, r := d.QuoRem(d2, 0)
+	return r
 }
 
-// Pow returns d to the power d2
+// Pow returns d to the power of d2.
+// When exponent is negative the returned decimal will have maximum precision of PowPrecisionNegativeExponent places after decimal point.
+//
+// Pow returns 0 (zero-value of Decimal) instead of error for power operation edge cases, to handle those edge cases use PowWithPrecision
+// Edge cases not handled by Pow:
+//   - 0 ** 0 => undefined value
+//   - 0 ** y, where y < 0 => infinity
+//   - x ** y, where x < 0 and y is non-integer decimal => imaginary value
+//
+// Example:
+//
+//	d1 := decimal.NewFromFloat(4.0)
+//	d2 := decimal.NewFromFloat(4.0)
+//	res1 := d1.Pow(d2)
+//	res1.String() // output: "256"
+//
+//	d3 := decimal.NewFromFloat(5.0)
+//	d4 := decimal.NewFromFloat(5.73)
+//	res2 := d3.Pow(d4)
+//	res2.String() // output: "10118.08037125"
 func (d Decimal) Pow(d2 Decimal) Decimal {
-	var temp Decimal
-	if d2.IntPart() == 0 {
-		return NewFromFloat(1)
+	baseSign := d.Sign()
+	expSign := d2.Sign()
+
+	if baseSign == 0 {
+		if expSign == 0 {
+			return Decimal{}
+		}
+		if expSign == 1 {
+			return Decimal{zeroInt, 0}
+		}
+		if expSign == -1 {
+			return Decimal{}
+		}
+	}
+
+	if expSign == 0 {
+		return Decimal{oneInt, 0}
+	}
+
+	// TODO: optimize extraction of fractional part
+	one := Decimal{oneInt, 0}
+	expIntPart, expFracPart := d2.QuoRem(one, 0)
+
+	if baseSign == -1 && !expFracPart.IsZero() {
+		return Decimal{}
+	}
+
+	intPartPow, _ := d.PowBigInt(expIntPart.value)
+
+	// if exponent is an integer we don't need to calculate d1**frac(d2)
+	if expFracPart.value.Sign() == 0 {
+		return intPartPow
+	}
+
+	// TODO: optimize NumDigits for more performant precision adjustment
+	digitsBase := d.NumDigits()
+	digitsExponent := d2.NumDigits()
+
+	precision := digitsBase
+
+	if digitsExponent > precision {
+		precision += digitsExponent
+	}
+
+	precision += 6
+
+	// Calculate x ** frac(y), where
+	// x ** frac(y) = exp(ln(x ** frac(y)) = exp(ln(x) * frac(y))
+	fracPartPow, err := d.Abs().Ln(-d.exp + int32(precision))
+	if err != nil {
+		return Decimal{}
+	}
+
+	fracPartPow = fracPartPow.Mul(expFracPart)
+
+	fracPartPow, err = fracPartPow.ExpTaylor(-d.exp + int32(precision))
+	if err != nil {
+		return Decimal{}
+	}
+
+	// Join integer and fractional part,
+	// base ** (expBase + expFrac) = base ** expBase * base ** expFrac
+	res := intPartPow.Mul(fracPartPow)
+
+	return res
+}
+
+// PowWithPrecision returns d to the power of d2.
+// Precision parameter specifies minimum precision of the result (digits after decimal point).
+// Returned decimal is not rounded to 'precision' places after decimal point.
+//
+// PowWithPrecision returns error when:
+//   - 0 ** 0 => undefined value
+//   - 0 ** y, where y < 0 => infinity
+//   - x ** y, where x < 0 and y is non-integer decimal => imaginary value
+//
+// Example:
+//
+//	d1 := decimal.NewFromFloat(4.0)
+//	d2 := decimal.NewFromFloat(4.0)
+//	res1, err := d1.PowWithPrecision(d2, 2)
+//	res1.String() // output: "256"
+//
+//	d3 := decimal.NewFromFloat(5.0)
+//	d4 := decimal.NewFromFloat(5.73)
+//	res2, err := d3.PowWithPrecision(d4, 5)
+//	res2.String() // output: "10118.080371595015625"
+//
+//	d5 := decimal.NewFromFloat(-3.0)
+//	d6 := decimal.NewFromFloat(-6.0)
+//	res3, err := d5.PowWithPrecision(d6, 10)
+//	res3.String() // output: "0.0013717421"
+func (d Decimal) PowWithPrecision(d2 Decimal, precision int32) (Decimal, error) {
+	baseSign := d.Sign()
+	expSign := d2.Sign()
+
+	if baseSign == 0 {
+		if expSign == 0 {
+			return Decimal{}, fmt.Errorf("cannot represent undefined value of 0**0")
+		}
+		if expSign == 1 {
+			return Decimal{zeroInt, 0}, nil
+		}
+		if expSign == -1 {
+			return Decimal{}, fmt.Errorf("cannot represent infinity value of 0 ** y, where y < 0")
+		}
+	}
+
+	if expSign == 0 {
+		return Decimal{oneInt, 0}, nil
+	}
+
+	// TODO: optimize extraction of fractional part
+	one := Decimal{oneInt, 0}
+	expIntPart, expFracPart := d2.QuoRem(one, 0)
+
+	if baseSign == -1 && !expFracPart.IsZero() {
+		return Decimal{}, fmt.Errorf("cannot represent imaginary value of x ** y, where x < 0 and y is non-integer decimal")
+	}
+
+	intPartPow, _ := d.powBigIntWithPrecision(expIntPart.value, precision)
+
+	// if exponent is an integer we don't need to calculate d1**frac(d2)
+	if expFracPart.value.Sign() == 0 {
+		return intPartPow, nil
+	}
+
+	// TODO: optimize NumDigits for more performant precision adjustment
+	digitsBase := d.NumDigits()
+	digitsExponent := d2.NumDigits()
+
+	if int32(digitsBase) > precision {
+		precision = int32(digitsBase)
+	}
+	if int32(digitsExponent) > precision {
+		precision += int32(digitsExponent)
+	}
+	// increase precision by 10 to compensate for errors in further calculations
+	precision += 10
+
+	// Calculate x ** frac(y), where
+	// x ** frac(y) = exp(ln(x ** frac(y)) = exp(ln(x) * frac(y))
+	fracPartPow, err := d.Abs().Ln(precision)
+	if err != nil {
+		return Decimal{}, err
+	}
+
+	fracPartPow = fracPartPow.Mul(expFracPart)
+
+	fracPartPow, err = fracPartPow.ExpTaylor(precision)
+	if err != nil {
+		return Decimal{}, err
+	}
+
+	// Join integer and fractional part,
+	// base ** (expBase + expFrac) = base ** expBase * base ** expFrac
+	res := intPartPow.Mul(fracPartPow)
+
+	return res, nil
+}
+
+// PowInt32 returns d to the power of exp, where exp is int32.
+// Only returns error when d and exp is 0, thus result is undefined.
+//
+// When exponent is negative the returned decimal will have maximum precision of PowPrecisionNegativeExponent places after decimal point.
+//
+// Example:
+//
+//	d1, err := decimal.NewFromFloat(4.0).PowInt32(4)
+//	d1.String() // output: "256"
+//
+//	d2, err := decimal.NewFromFloat(3.13).PowInt32(5)
+//	d2.String() // output: "300.4150512793"
+func (d Decimal) PowInt32(exp int32) (Decimal, error) {
+	if d.IsZero() && exp == 0 {
+		return Decimal{}, fmt.Errorf("cannot represent undefined value of 0**0")
+	}
+
+	isExpNeg := exp < 0
+	exp = abs(exp)
+
+	n, result := d, New(1, 0)
+
+	for exp > 0 {
+		if exp%2 == 1 {
+			result = result.Mul(n)
+		}
+		exp /= 2
+
+		if exp > 0 {
+			n = n.Mul(n)
+		}
+	}
+
+	if isExpNeg {
+		return New(1, 0).DivRound(result, int32(PowPrecisionNegativeExponent)), nil
+	}
+
+	return result, nil
+}
+
+// PowBigInt returns d to the power of exp, where exp is big.Int.
+// Only returns error when d and exp is 0, thus result is undefined.
+//
+// When exponent is negative the returned decimal will have maximum precision of PowPrecisionNegativeExponent places after decimal point.
+//
+// Example:
+//
+//	d1, err := decimal.NewFromFloat(3.0).PowBigInt(big.NewInt(3))
+//	d1.String() // output: "27"
+//
+//	d2, err := decimal.NewFromFloat(629.25).PowBigInt(big.NewInt(5))
+//	d2.String() // output: "98654323103449.5673828125"
+func (d Decimal) PowBigInt(exp *big.Int) (Decimal, error) {
+	return d.powBigIntWithPrecision(exp, int32(PowPrecisionNegativeExponent))
+}
+
+func (d Decimal) powBigIntWithPrecision(exp *big.Int, precision int32) (Decimal, error) {
+	if d.IsZero() && exp.Sign() == 0 {
+		return Decimal{}, fmt.Errorf("cannot represent undefined value of 0**0")
 	}
-	temp = d.Pow(d2.Div(NewFromFloat(2)))
-	if d2.IntPart()%2 == 0 {
-		return temp.Mul(temp)
+
+	tmpExp := new(big.Int).Set(exp)
+	isExpNeg := exp.Sign() < 0
+
+	if isExpNeg {
+		tmpExp.Abs(tmpExp)
+	}
+
+	n, result := d, New(1, 0)
+
+	for tmpExp.Sign() > 0 {
+		if tmpExp.Bit(0) == 1 {
+			result = result.Mul(n)
+		}
+		tmpExp.Rsh(tmpExp, 1)
+
+		if tmpExp.Sign() > 0 {
+			n = n.Mul(n)
+		}
 	}
-	if d2.IntPart() > 0 {
-		return temp.Mul(temp).Mul(d)
+
+	if isExpNeg {
+		return New(1, 0).DivRound(result, precision), nil
 	}
-	return temp.Mul(temp).Div(d)
+
+	return result, nil
 }
 
 // ExpHullAbrham calculates the natural exponent of decimal (e to the power of d) using Hull-Abraham algorithm.
@@ -655,9 +952,8 @@ func (d Decimal) Pow(d2 Decimal) Decimal {
 //
 // Example:
 //
-//     NewFromFloat(26.1).ExpHullAbrham(2).String()    // output: "220000000000"
-//     NewFromFloat(26.1).ExpHullAbrham(20).String()   // output: "216314672147.05767284"
-//
+//	NewFromFloat(26.1).ExpHullAbrham(2).String()    // output: "220000000000"
+//	NewFromFloat(26.1).ExpHullAbrham(20).String()   // output: "216314672147.05767284"
 func (d Decimal) ExpHullAbrham(overallPrecision uint32) (Decimal, error) {
 	// Algorithm based on Variable precision exponential function.
 	// ACM Transactions on Mathematical Software by T. E. Hull & A. Abrham.
@@ -747,15 +1043,14 @@ func (d Decimal) ExpHullAbrham(overallPrecision uint32) (Decimal, error) {
 //
 // Example:
 //
-//     d, err := NewFromFloat(26.1).ExpTaylor(2).String()
-//     d.String()  // output: "216314672147.06"
-//
-//     NewFromFloat(26.1).ExpTaylor(20).String()
-//     d.String()  // output: "216314672147.05767284062928674083"
+//	d, err := NewFromFloat(26.1).ExpTaylor(2).String()
+//	d.String()  // output: "216314672147.06"
 //
-//     NewFromFloat(26.1).ExpTaylor(-10).String()
-//     d.String()  // output: "220000000000"
+//	NewFromFloat(26.1).ExpTaylor(20).String()
+//	d.String()  // output: "216314672147.05767284062928674083"
 //
+//	NewFromFloat(26.1).ExpTaylor(-10).String()
+//	d.String()  // output: "220000000000"
 func (d Decimal) ExpTaylor(precision int32) (Decimal, error) {
 	// Note(mwoss): Implementation can be optimized by exclusively using big.Int API only
 	if d.IsZero() {
@@ -812,14 +1107,162 @@ func (d Decimal) ExpTaylor(precision int32) (Decimal, error) {
 	return result, nil
 }
 
+// Ln calculates natural logarithm of d.
+// Precision argument specifies how precise the result must be (number of digits after decimal point).
+// Negative precision is allowed.
+//
+// Example:
+//
+//	d1, err := NewFromFloat(13.3).Ln(2)
+//	d1.String()  // output: "2.59"
+//
+//	d2, err := NewFromFloat(579.161).Ln(10)
+//	d2.String()  // output: "6.3615805046"
+func (d Decimal) Ln(precision int32) (Decimal, error) {
+	// Algorithm based on The Use of Iteration Methods for Approximating the Natural Logarithm,
+	// James F. Epperson, The American Mathematical Monthly, Vol. 96, No. 9, November 1989, pp. 831-835.
+	if d.IsNegative() {
+		return Decimal{}, fmt.Errorf("cannot calculate natural logarithm for negative decimals")
+	}
+
+	if d.IsZero() {
+		return Decimal{}, fmt.Errorf("cannot represent natural logarithm of 0, result: -infinity")
+	}
+
+	calcPrecision := precision + 2
+	z := d.Copy()
+
+	var comp1, comp3, comp2, comp4, reduceAdjust Decimal
+	comp1 = z.Sub(Decimal{oneInt, 0})
+	comp3 = Decimal{oneInt, -1}
+
+	// for decimal in range [0.9, 1.1] where ln(d) is close to 0
+	usePowerSeries := false
+
+	if comp1.Abs().Cmp(comp3) <= 0 {
+		usePowerSeries = true
+	} else {
+		// reduce input decimal to range [0.1, 1)
+		expDelta := int32(z.NumDigits()) + z.exp
+		z.exp -= expDelta
+
+		// Input decimal was reduced by factor of 10^expDelta, thus we will need to add
+		// ln(10^expDelta) = expDelta * ln(10)
+		// to the result to compensate that
+		ln10 := ln10.withPrecision(calcPrecision)
+		reduceAdjust = NewFromInt32(expDelta)
+		reduceAdjust = reduceAdjust.Mul(ln10)
+
+		comp1 = z.Sub(Decimal{oneInt, 0})
+
+		if comp1.Abs().Cmp(comp3) <= 0 {
+			usePowerSeries = true
+		} else {
+			// initial estimate using floats
+			zFloat := z.InexactFloat64()
+			comp1 = NewFromFloat(math.Log(zFloat))
+		}
+	}
+
+	epsilon := Decimal{oneInt, -calcPrecision}
+
+	if usePowerSeries {
+		// Power Series - https://en.wikipedia.org/wiki/Logarithm#Power_series
+		// Calculating n-th term of formula: ln(z+1) = 2 sum [ 1 / (2n+1) * (z / (z+2))^(2n+1) ]
+		// until the difference between current and next term is smaller than epsilon.
+		// Coverage quite fast for decimals close to 1.0
+
+		// z + 2
+		comp2 = comp1.Add(Decimal{twoInt, 0})
+		// z / (z + 2)
+		comp3 = comp1.DivRound(comp2, calcPrecision)
+		// 2 * (z / (z + 2))
+		comp1 = comp3.Add(comp3)
+		comp2 = comp1.Copy()
+
+		for n := 1; ; n++ {
+			// 2 * (z / (z+2))^(2n+1)
+			comp2 = comp2.Mul(comp3).Mul(comp3)
+
+			// 1 / (2n+1) * 2 * (z / (z+2))^(2n+1)
+			comp4 = NewFromInt(int64(2*n + 1))
+			comp4 = comp2.DivRound(comp4, calcPrecision)
+
+			// comp1 = 2 sum [ 1 / (2n+1) * (z / (z+2))^(2n+1) ]
+			comp1 = comp1.Add(comp4)
+
+			if comp4.Abs().Cmp(epsilon) <= 0 {
+				break
+			}
+		}
+	} else {
+		// Halley's Iteration.
+		// Calculating n-th term of formula: a_(n+1) = a_n - 2 * (exp(a_n) - z) / (exp(a_n) + z),
+		// until the difference between current and next term is smaller than epsilon
+		var prevStep Decimal
+		maxIters := calcPrecision*2 + 10
+
+		for i := int32(0); i < maxIters; i++ {
+			// exp(a_n)
+			comp3, _ = comp1.ExpTaylor(calcPrecision)
+			// exp(a_n) - z
+			comp2 = comp3.Sub(z)
+			// 2 * (exp(a_n) - z)
+			comp2 = comp2.Add(comp2)
+			// exp(a_n) + z
+			comp4 = comp3.Add(z)
+			// 2 * (exp(a_n) - z) / (exp(a_n) + z)
+			comp3 = comp2.DivRound(comp4, calcPrecision)
+			// comp1 = a_(n+1) = a_n - 2 * (exp(a_n) - z) / (exp(a_n) + z)
+			comp1 = comp1.Sub(comp3)
+
+			if prevStep.Add(comp3).IsZero() {
+				// If iteration steps oscillate we should return early and prevent an infinity loop
+				// NOTE(mwoss): This should be quite a rare case, returning error is not necessary
+				break
+			}
+
+			if comp3.Abs().Cmp(epsilon) <= 0 {
+				break
+			}
+
+			prevStep = comp3
+		}
+	}
+
+	comp1 = comp1.Add(reduceAdjust)
+
+	return comp1.Round(precision), nil
+}
+
 // NumDigits returns the number of digits of the decimal coefficient (d.Value)
-// Note: Current implementation is extremely slow for large decimals and/or decimals with large fractional part
 func (d Decimal) NumDigits() int {
-	// Note(mwoss): It can be optimized, unnecessary cast of big.Int to string
-	if d.IsNegative() {
-		return len(d.value.String()) - 1
+	if d.value == nil {
+		return 1
+	}
+
+	if d.value.IsInt64() {
+		i64 := d.value.Int64()
+		// restrict fast path to integers with exact conversion to float64
+		if i64 <= (1<<53) && i64 >= -(1<<53) {
+			if i64 == 0 {
+				return 1
+			}
+			return int(math.Log10(math.Abs(float64(i64)))) + 1
+		}
+	}
+
+	estimatedNumDigits := int(float64(d.value.BitLen()) / math.Log2(10))
+
+	// estimatedNumDigits (lg10) may be off by 1, need to verify
+	digitsBigInt := big.NewInt(int64(estimatedNumDigits))
+	errorCorrectionUnit := digitsBigInt.Exp(tenInt, digitsBigInt, nil)
+
+	if d.value.CmpAbs(errorCorrectionUnit) >= 0 {
+		return estimatedNumDigits + 1
 	}
-	return len(d.value.String())
+
+	return estimatedNumDigits
 }
 
 // IsInteger returns true when decimal can be represented as an integer value, otherwise, it returns false.
@@ -851,10 +1294,9 @@ func abs(n int32) int32 {
 
 // Cmp compares the numbers represented by d and d2 and returns:
 //
-//     -1 if d <  d2
-//      0 if d == d2
-//     +1 if d >  d2
-//
+//	-1 if d <  d2
+//	 0 if d == d2
+//	+1 if d >  d2
 func (d Decimal) Cmp(d2 Decimal) int {
 	d.ensureInitialized()
 	d2.ensureInitialized()
@@ -868,12 +1310,21 @@ func (d Decimal) Cmp(d2 Decimal) int {
 	return rd.value.Cmp(rd2.value)
 }
 
+// Compare compares the numbers represented by d and d2 and returns:
+//
+//	-1 if d <  d2
+//	 0 if d == d2
+//	+1 if d >  d2
+func (d Decimal) Compare(d2 Decimal) int {
+	return d.Cmp(d2)
+}
+
 // Equal returns whether the numbers represented by d and d2 are equal.
 func (d Decimal) Equal(d2 Decimal) bool {
 	return d.Cmp(d2) == 0
 }
 
-// Equals is deprecated, please use Equal method instead
+// Deprecated: Equals is deprecated, please use Equal method instead.
 func (d Decimal) Equals(d2 Decimal) bool {
 	return d.Equal(d2)
 }
@@ -905,7 +1356,6 @@ func (d Decimal) LessThanOrEqual(d2 Decimal) bool {
 //	-1 if d <  0
 //	 0 if d == 0
 //	+1 if d >  0
-//
 func (d Decimal) Sign() int {
 	if d.value == nil {
 		return 0
@@ -968,9 +1418,7 @@ func (d Decimal) IntPart() int64 {
 // BigInt returns integer component of the decimal as a BigInt.
 func (d Decimal) BigInt() *big.Int {
 	scaledD := d.rescale(0)
-	i := &big.Int{}
-	i.SetString(scaledD.String(), 10)
-	return i
+	return scaledD.value
 }
 
 // BigFloat returns decimal as BigFloat.
@@ -1014,13 +1462,12 @@ func (d Decimal) InexactFloat64() float64 {
 //
 // Example:
 //
-//     d := New(-12345, -3)
-//     println(d.String())
+//	d := New(-12345, -3)
+//	println(d.String())
 //
 // Output:
 //
-//     -12.345
-//
+//	-12.345
 func (d Decimal) String() string {
 	return d.string(true)
 }
@@ -1030,14 +1477,13 @@ func (d Decimal) String() string {
 //
 // Example:
 //
-// 	   NewFromFloat(0).StringFixed(2) // output: "0.00"
-// 	   NewFromFloat(0).StringFixed(0) // output: "0"
-// 	   NewFromFloat(5.45).StringFixed(0) // output: "5"
-// 	   NewFromFloat(5.45).StringFixed(1) // output: "5.5"
-// 	   NewFromFloat(5.45).StringFixed(2) // output: "5.45"
-// 	   NewFromFloat(5.45).StringFixed(3) // output: "5.450"
-// 	   NewFromFloat(545).StringFixed(-1) // output: "550"
-//
+//	NewFromFloat(0).StringFixed(2) // output: "0.00"
+//	NewFromFloat(0).StringFixed(0) // output: "0"
+//	NewFromFloat(5.45).StringFixed(0) // output: "5"
+//	NewFromFloat(5.45).StringFixed(1) // output: "5.5"
+//	NewFromFloat(5.45).StringFixed(2) // output: "5.45"
+//	NewFromFloat(5.45).StringFixed(3) // output: "5.450"
+//	NewFromFloat(545).StringFixed(-1) // output: "550"
 func (d Decimal) StringFixed(places int32) string {
 	rounded := d.Round(places)
 	return rounded.string(false)
@@ -1048,14 +1494,13 @@ func (d Decimal) StringFixed(places int32) string {
 //
 // Example:
 //
-// 	   NewFromFloat(0).StringFixedBank(2) // output: "0.00"
-// 	   NewFromFloat(0).StringFixedBank(0) // output: "0"
-// 	   NewFromFloat(5.45).StringFixedBank(0) // output: "5"
-// 	   NewFromFloat(5.45).StringFixedBank(1) // output: "5.4"
-// 	   NewFromFloat(5.45).StringFixedBank(2) // output: "5.45"
-// 	   NewFromFloat(5.45).StringFixedBank(3) // output: "5.450"
-// 	   NewFromFloat(545).StringFixedBank(-1) // output: "540"
-//
+//	NewFromFloat(0).StringFixedBank(2) // output: "0.00"
+//	NewFromFloat(0).StringFixedBank(0) // output: "0"
+//	NewFromFloat(5.45).StringFixedBank(0) // output: "5"
+//	NewFromFloat(5.45).StringFixedBank(1) // output: "5.4"
+//	NewFromFloat(5.45).StringFixedBank(2) // output: "5.45"
+//	NewFromFloat(5.45).StringFixedBank(3) // output: "5.450"
+//	NewFromFloat(545).StringFixedBank(-1) // output: "540"
 func (d Decimal) StringFixedBank(places int32) string {
 	rounded := d.RoundBank(places)
 	return rounded.string(false)
@@ -1073,9 +1518,8 @@ func (d Decimal) StringFixedCash(interval uint8) string {
 //
 // Example:
 //
-// 	   NewFromFloat(5.45).Round(1).String() // output: "5.5"
-// 	   NewFromFloat(545).Round(-1).String() // output: "550"
-//
+//	NewFromFloat(5.45).Round(1).String() // output: "5.5"
+//	NewFromFloat(545).Round(-1).String() // output: "550"
 func (d Decimal) Round(places int32) Decimal {
 	if d.exp == -places {
 		return d
@@ -1104,11 +1548,10 @@ func (d Decimal) Round(places int32) Decimal {
 //
 // Example:
 //
-//     NewFromFloat(545).RoundCeil(-2).String()   // output: "600"
-//     NewFromFloat(500).RoundCeil(-2).String()   // output: "500"
-//     NewFromFloat(1.1001).RoundCeil(2).String() // output: "1.11"
-//     NewFromFloat(-1.454).RoundCeil(1).String() // output: "-1.5"
-//
+//	NewFromFloat(545).RoundCeil(-2).String()   // output: "600"
+//	NewFromFloat(500).RoundCeil(-2).String()   // output: "500"
+//	NewFromFloat(1.1001).RoundCeil(2).String() // output: "1.11"
+//	NewFromFloat(-1.454).RoundCeil(1).String() // output: "-1.4"
 func (d Decimal) RoundCeil(places int32) Decimal {
 	if d.exp >= -places {
 		return d
@@ -1130,11 +1573,10 @@ func (d Decimal) RoundCeil(places int32) Decimal {
 //
 // Example:
 //
-//     NewFromFloat(545).RoundFloor(-2).String()   // output: "500"
-//     NewFromFloat(-500).RoundFloor(-2).String()   // output: "-500"
-//     NewFromFloat(1.1001).RoundFloor(2).String() // output: "1.1"
-//     NewFromFloat(-1.454).RoundFloor(1).String() // output: "-1.4"
-//
+//	NewFromFloat(545).RoundFloor(-2).String()   // output: "500"
+//	NewFromFloat(-500).RoundFloor(-2).String()   // output: "-500"
+//	NewFromFloat(1.1001).RoundFloor(2).String() // output: "1.1"
+//	NewFromFloat(-1.454).RoundFloor(1).String() // output: "-1.5"
 func (d Decimal) RoundFloor(places int32) Decimal {
 	if d.exp >= -places {
 		return d
@@ -1156,11 +1598,10 @@ func (d Decimal) RoundFloor(places int32) Decimal {
 //
 // Example:
 //
-//     NewFromFloat(545).RoundUp(-2).String()   // output: "600"
-//     NewFromFloat(500).RoundUp(-2).String()   // output: "500"
-//     NewFromFloat(1.1001).RoundUp(2).String() // output: "1.11"
-//     NewFromFloat(-1.454).RoundUp(1).String() // output: "-1.4"
-//
+//	NewFromFloat(545).RoundUp(-2).String()   // output: "600"
+//	NewFromFloat(500).RoundUp(-2).String()   // output: "500"
+//	NewFromFloat(1.1001).RoundUp(2).String() // output: "1.11"
+//	NewFromFloat(-1.454).RoundUp(1).String() // output: "-1.5"
 func (d Decimal) RoundUp(places int32) Decimal {
 	if d.exp >= -places {
 		return d
@@ -1184,11 +1625,10 @@ func (d Decimal) RoundUp(places int32) Decimal {
 //
 // Example:
 //
-//     NewFromFloat(545).RoundDown(-2).String()   // output: "500"
-//     NewFromFloat(-500).RoundDown(-2).String()   // output: "-500"
-//     NewFromFloat(1.1001).RoundDown(2).String() // output: "1.1"
-//     NewFromFloat(-1.454).RoundDown(1).String() // output: "-1.5"
-//
+//	NewFromFloat(545).RoundDown(-2).String()   // output: "500"
+//	NewFromFloat(-500).RoundDown(-2).String()   // output: "-500"
+//	NewFromFloat(1.1001).RoundDown(2).String() // output: "1.1"
+//	NewFromFloat(-1.454).RoundDown(1).String() // output: "-1.4"
 func (d Decimal) RoundDown(places int32) Decimal {
 	if d.exp >= -places {
 		return d
@@ -1209,13 +1649,12 @@ func (d Decimal) RoundDown(places int32) Decimal {
 //
 // Examples:
 //
-// 	   NewFromFloat(5.45).RoundBank(1).String() // output: "5.4"
-// 	   NewFromFloat(545).RoundBank(-1).String() // output: "540"
-// 	   NewFromFloat(5.46).RoundBank(1).String() // output: "5.5"
-// 	   NewFromFloat(546).RoundBank(-1).String() // output: "550"
-// 	   NewFromFloat(5.55).RoundBank(1).String() // output: "5.6"
-// 	   NewFromFloat(555).RoundBank(-1).String() // output: "560"
-//
+//	NewFromFloat(5.45).RoundBank(1).String() // output: "5.4"
+//	NewFromFloat(545).RoundBank(-1).String() // output: "540"
+//	NewFromFloat(5.46).RoundBank(1).String() // output: "5.5"
+//	NewFromFloat(546).RoundBank(-1).String() // output: "550"
+//	NewFromFloat(5.55).RoundBank(1).String() // output: "5.6"
+//	NewFromFloat(555).RoundBank(-1).String() // output: "560"
 func (d Decimal) RoundBank(places int32) Decimal {
 
 	round := d.Round(places)
@@ -1237,11 +1676,13 @@ func (d Decimal) RoundBank(places int32) Decimal {
 // interval. The amount payable for a cash transaction is rounded to the nearest
 // multiple of the minimum currency unit available. The following intervals are
 // available: 5, 10, 25, 50 and 100; any other number throws a panic.
-//	    5:   5 cent rounding 3.43 => 3.45
-// 	   10:  10 cent rounding 3.45 => 3.50 (5 gets rounded up)
-// 	   25:  25 cent rounding 3.41 => 3.50
-// 	   50:  50 cent rounding 3.75 => 4.00
-// 	  100: 100 cent rounding 3.50 => 4.00
+//
+//	  5:   5 cent rounding 3.43 => 3.45
+//	 10:  10 cent rounding 3.45 => 3.50 (5 gets rounded up)
+//	 25:  25 cent rounding 3.41 => 3.50
+//	 50:  50 cent rounding 3.75 => 4.00
+//	100: 100 cent rounding 3.50 => 4.00
+//
 // For more details: https://en.wikipedia.org/wiki/Cash_rounding
 func (d Decimal) RoundCash(interval uint8) Decimal {
 	var iVal *big.Int
@@ -1310,8 +1751,7 @@ func (d Decimal) Ceil() Decimal {
 //
 // Example:
 //
-//     decimal.NewFromString("123.456").Truncate(2).String() // "123.45"
-//
+//	decimal.NewFromString("123.456").Truncate(2).String() // "123.45"
 func (d Decimal) Truncate(precision int32) Decimal {
 	d.ensureInitialized()
 	if precision >= 0 && -precision > d.exp {
@@ -1373,19 +1813,18 @@ func (d *Decimal) UnmarshalBinary(data []byte) error {
 
 // MarshalBinary implements the encoding.BinaryMarshaler interface.
 func (d Decimal) MarshalBinary() (data []byte, err error) {
-	// Write the exponent first since it's a fixed size
-	v1 := make([]byte, 4)
-	binary.BigEndian.PutUint32(v1, uint32(d.exp))
-
-	// Add the value
-	var v2 []byte
-	if v2, err = d.value.GobEncode(); err != nil {
-		return
+	// exp is written first, but encode value first to know output size
+	var valueData []byte
+	if valueData, err = d.value.GobEncode(); err != nil {
+		return nil, err
 	}
 
+	// Write the exponent in front, since it's a fixed size
+	expData := make([]byte, 4, len(valueData)+4)
+	binary.BigEndian.PutUint32(expData, uint32(d.exp))
+
 	// Return the byte array
-	data = append(v1, v2...)
-	return
+	return append(expData, valueData...), nil
 }
 
 // Scan implements the sql.Scanner interface for database deserialization.
@@ -1408,6 +1847,11 @@ func (d *Decimal) Scan(value interface{}) error {
 		*d = New(v, 0)
 		return nil
 
+	case uint64:
+		// while clickhouse may send 0 in db as uint64
+		*d = NewFromUint64(v)
+		return nil
+
 	default:
 		// default is trying to interpret value stored as string
 		str, err := unquoteIfQuoted(v)
@@ -1455,7 +1899,8 @@ func (d *Decimal) GobDecode(data []byte) error {
 }
 
 // StringScaled first scales the decimal then calls .String() on it.
-// NOTE: buggy, unintuitive, and DEPRECATED! Use StringFixed instead.
+//
+// Deprecated: buggy and unintuitive. Use StringFixed instead.
 func (d Decimal) StringScaled(exp int32) string {
 	return d.rescale(exp).String()
 }
@@ -1515,7 +1960,7 @@ func (d *Decimal) ensureInitialized() {
 //
 // To call this function with an array, you must do:
 //
-//     Min(arr[0], arr[1:]...)
+//	Min(arr[0], arr[1:]...)
 //
 // This makes it harder to accidentally call Min with 0 arguments.
 func Min(first Decimal, rest ...Decimal) Decimal {
@@ -1532,7 +1977,7 @@ func Min(first Decimal, rest ...Decimal) Decimal {
 //
 // To call this function with an array, you must do:
 //
-//     Max(arr[0], arr[1:]...)
+//	Max(arr[0], arr[1:]...)
 //
 // This makes it harder to accidentally call Max with 0 arguments.
 func Max(first Decimal, rest ...Decimal) Decimal {
@@ -1567,22 +2012,13 @@ func RescalePair(d1 Decimal, d2 Decimal) (Decimal, Decimal) {
 	d1.ensureInitialized()
 	d2.ensureInitialized()
 
-	if d1.exp == d2.exp {
-		return d1, d2
+	if d1.exp < d2.exp {
+		return d1, d2.rescale(d1.exp)
+	} else if d1.exp > d2.exp {
+		return d1.rescale(d2.exp), d2
 	}
 
-	baseScale := min(d1.exp, d2.exp)
-	if baseScale != d1.exp {
-		return d1.rescale(baseScale), d2
-	}
-	return d1, d2.rescale(baseScale)
-}
-
-func min(x, y int32) int32 {
-	if x >= y {
-		return y
-	}
-	return x
+	return d1, d2
 }
 
 func unquoteIfQuoted(value interface{}) (string, error) {
@@ -1594,8 +2030,7 @@ func unquoteIfQuoted(value interface{}) (string, error) {
 	case []byte:
 		bytes = v
 	default:
-		return "", fmt.Errorf("could not convert value '%+v' to byte array of type '%T'",
-			value, value)
+		return "", fmt.Errorf("could not convert value '%+v' to byte array of type '%T'", value, value)
 	}
 
 	// If the amount is quoted, strip the quotes
diff --git a/vendor/github.com/xrash/smetrics/soundex.go b/vendor/github.com/xrash/smetrics/soundex.go
index a2ad034d5..18c3aef72 100644
--- a/vendor/github.com/xrash/smetrics/soundex.go
+++ b/vendor/github.com/xrash/smetrics/soundex.go
@@ -6,36 +6,58 @@ import (
 
 // The Soundex encoding. It is a phonetic algorithm that considers how the words sound in English. Soundex maps a string to a 4-byte code consisting of the first letter of the original string and three numbers. Strings that sound similar should map to the same code.
 func Soundex(s string) string {
-	m := map[byte]string{
-		'B': "1", 'P': "1", 'F': "1", 'V': "1",
-		'C': "2", 'S': "2", 'K': "2", 'G': "2", 'J': "2", 'Q': "2", 'X': "2", 'Z': "2",
-		'D': "3", 'T': "3",
-		'L': "4",
-		'M': "5", 'N': "5",
-		'R': "6",
-	}
-
-	s = strings.ToUpper(s)
+	b := strings.Builder{}
+	b.Grow(4)
 
-	r := string(s[0])
 	p := s[0]
-	for i := 1; i < len(s) && len(r) < 4; i++ {
+	if p <= 'z' && p >= 'a' {
+		p -= 32 // convert to uppercase
+	}
+	b.WriteByte(p)
+
+	n := 0
+	for i := 1; i < len(s); i++ {
 		c := s[i]
 
-		if (c < 'A' || c > 'Z') || (c == p) {
+		if c <= 'z' && c >= 'a' {
+			c -= 32 // convert to uppercase
+		} else if c < 'A' || c > 'Z' {
+			continue
+		}
+
+		if c == p {
 			continue
 		}
 
 		p = c
 
-		if n, ok := m[c]; ok {
-			r += n
+		switch c {
+		case 'B', 'P', 'F', 'V':
+			c = '1'
+		case 'C', 'S', 'K', 'G', 'J', 'Q', 'X', 'Z':
+			c = '2'
+		case 'D', 'T':
+			c = '3'
+		case 'L':
+			c = '4'
+		case 'M', 'N':
+			c = '5'
+		case 'R':
+			c = '6'
+		default:
+			continue
+		}
+
+		b.WriteByte(c)
+		n++
+		if n == 3 {
+			break
 		}
 	}
 
-	for i := len(r); i < 4; i++ {
-		r += "0"
+	for i := n; i < 3; i++ {
+		b.WriteByte('0')
 	}
 
-	return r
+	return b.String()
 }
diff --git a/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go b/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go
index 2681af35a..150f887e7 100644
--- a/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go
+++ b/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go
@@ -13,7 +13,7 @@ import (
 	"sync"
 )
 
-// Regexp is a wrapper around regexp.Regexp, where the underlying regexp will be
+// Regexp is a wrapper around [regexp.Regexp], where the underlying regexp will be
 // compiled the first time it is needed.
 type Regexp struct {
 	str  string
diff --git a/vendor/golang.org/x/mod/modfile/read.go b/vendor/golang.org/x/mod/modfile/read.go
index a503bc210..220568259 100644
--- a/vendor/golang.org/x/mod/modfile/read.go
+++ b/vendor/golang.org/x/mod/modfile/read.go
@@ -65,7 +65,7 @@ type Comments struct {
 }
 
 // Comment returns the receiver. This isn't useful by itself, but
-// a Comments struct is embedded into all the expression
+// a [Comments] struct is embedded into all the expression
 // implementation types, and this gives each of those a Comment
 // method to satisfy the Expr interface.
 func (c *Comments) Comment() *Comments {
@@ -225,7 +225,7 @@ func (x *FileSyntax) Cleanup() {
 			if ww == 0 {
 				continue
 			}
-			if ww == 1 {
+			if ww == 1 && len(stmt.RParen.Comments.Before) == 0 {
 				// Collapse block into single line.
 				line := &Line{
 					Comments: Comments{
diff --git a/vendor/golang.org/x/mod/modfile/rule.go b/vendor/golang.org/x/mod/modfile/rule.go
index b4dd7997b..0e7b7e267 100644
--- a/vendor/golang.org/x/mod/modfile/rule.go
+++ b/vendor/golang.org/x/mod/modfile/rule.go
@@ -5,17 +5,17 @@
 // Package modfile implements a parser and formatter for go.mod files.
 //
 // The go.mod syntax is described in
-// https://golang.org/cmd/go/#hdr-The_go_mod_file.
+// https://pkg.go.dev/cmd/go/#hdr-The_go_mod_file.
 //
-// The Parse and ParseLax functions both parse a go.mod file and return an
+// The [Parse] and [ParseLax] functions both parse a go.mod file and return an
 // abstract syntax tree. ParseLax ignores unknown statements and may be used to
 // parse go.mod files that may have been developed with newer versions of Go.
 //
-// The File struct returned by Parse and ParseLax represent an abstract
-// go.mod file. File has several methods like AddNewRequire and DropReplace
-// that can be used to programmatically edit a file.
+// The [File] struct returned by Parse and ParseLax represent an abstract
+// go.mod file. File has several methods like [File.AddNewRequire] and
+// [File.DropReplace] that can be used to programmatically edit a file.
 //
-// The Format function formats a File back to a byte slice which can be
+// The [Format] function formats a File back to a byte slice which can be
 // written to a file.
 package modfile
 
@@ -226,7 +226,7 @@ var dontFixRetract VersionFixer = func(_, vers string) (string, error) {
 // data is the content of the file.
 //
 // fix is an optional function that canonicalizes module versions.
-// If fix is nil, all module versions must be canonical (module.CanonicalVersion
+// If fix is nil, all module versions must be canonical ([module.CanonicalVersion]
 // must return the same string).
 func Parse(file string, data []byte, fix VersionFixer) (*File, error) {
 	return parseToFile(file, data, fix, true)
@@ -308,6 +308,7 @@ var laxGoVersionRE = lazyregexp.New(`^v?(([1-9][0-9]*)\.(0|[1-9][0-9]*))([^0-9].
 
 // Toolchains must be named beginning with `go1`,
 // like "go1.20.3" or "go1.20.3-gccgo". As a special case, "default" is also permitted.
+// TODO(samthanawalla): Replace regex with https://pkg.go.dev/go/version#IsValid in 1.23+
 var ToolchainRE = lazyregexp.New(`^default$|^go1($|\.)`)
 
 func (f *File) add(errs *ErrorList, block *LineBlock, line *Line, verb string, args []string, fix VersionFixer, strict bool) {
@@ -367,7 +368,7 @@ func (f *File) add(errs *ErrorList, block *LineBlock, line *Line, verb string, a
 				}
 			}
 			if !fixed {
-				errorf("invalid go version '%s': must match format 1.23", args[0])
+				errorf("invalid go version '%s': must match format 1.23.0", args[0])
 				return
 			}
 		}
@@ -384,7 +385,7 @@ func (f *File) add(errs *ErrorList, block *LineBlock, line *Line, verb string, a
 			errorf("toolchain directive expects exactly one argument")
 			return
 		} else if strict && !ToolchainRE.MatchString(args[0]) {
-			errorf("invalid toolchain version '%s': must match format go1.23 or local", args[0])
+			errorf("invalid toolchain version '%s': must match format go1.23.0 or default", args[0])
 			return
 		}
 		f.Toolchain = &Toolchain{Syntax: line}
@@ -542,7 +543,7 @@ func parseReplace(filename string, line *Line, verb string, args []string, fix V
 			if strings.Contains(ns, "@") {
 				return nil, errorf("replacement module must match format 'path version', not 'path@version'")
 			}
-			return nil, errorf("replacement module without version must be directory path (rooted or starting with ./ or ../)")
+			return nil, errorf("replacement module without version must be directory path (rooted or starting with . or ..)")
 		}
 		if filepath.Separator == '/' && strings.Contains(ns, `\`) {
 			return nil, errorf("replacement directory appears to be Windows path (on a non-windows system)")
@@ -555,7 +556,6 @@ func parseReplace(filename string, line *Line, verb string, args []string, fix V
 		}
 		if IsDirectoryPath(ns) {
 			return nil, errorf("replacement module directory path %q cannot have version", ns)
-
 		}
 	}
 	return &Replace{
@@ -631,7 +631,7 @@ func (f *WorkFile) add(errs *ErrorList, line *Line, verb string, args []string,
 			errorf("go directive expects exactly one argument")
 			return
 		} else if !GoVersionRE.MatchString(args[0]) {
-			errorf("invalid go version '%s': must match format 1.23", args[0])
+			errorf("invalid go version '%s': must match format 1.23.0", args[0])
 			return
 		}
 
@@ -647,7 +647,7 @@ func (f *WorkFile) add(errs *ErrorList, line *Line, verb string, args []string,
 			errorf("toolchain directive expects exactly one argument")
 			return
 		} else if !ToolchainRE.MatchString(args[0]) {
-			errorf("invalid toolchain version '%s': must match format go1.23 or local", args[0])
+			errorf("invalid toolchain version '%s': must match format go1.23.0 or default", args[0])
 			return
 		}
 
@@ -679,14 +679,15 @@ func (f *WorkFile) add(errs *ErrorList, line *Line, verb string, args []string,
 	}
 }
 
-// IsDirectoryPath reports whether the given path should be interpreted
-// as a directory path. Just like on the go command line, relative paths
+// IsDirectoryPath reports whether the given path should be interpreted as a directory path.
+// Just like on the go command line, relative paths starting with a '.' or '..' path component
 // and rooted paths are directory paths; the rest are module paths.
 func IsDirectoryPath(ns string) bool {
 	// Because go.mod files can move from one system to another,
 	// we check all known path syntaxes, both Unix and Windows.
-	return strings.HasPrefix(ns, "./") || strings.HasPrefix(ns, "../") || strings.HasPrefix(ns, "/") ||
-		strings.HasPrefix(ns, `.\`) || strings.HasPrefix(ns, `..\`) || strings.HasPrefix(ns, `\`) ||
+	return ns == "." || strings.HasPrefix(ns, "./") || strings.HasPrefix(ns, `.\`) ||
+		ns == ".." || strings.HasPrefix(ns, "../") || strings.HasPrefix(ns, `..\`) ||
+		strings.HasPrefix(ns, "/") || strings.HasPrefix(ns, `\`) ||
 		len(ns) >= 2 && ('A' <= ns[0] && ns[0] <= 'Z' || 'a' <= ns[0] && ns[0] <= 'z') && ns[1] == ':'
 }
 
@@ -923,7 +924,7 @@ func (f *File) Format() ([]byte, error) {
 }
 
 // Cleanup cleans up the file f after any edit operations.
-// To avoid quadratic behavior, modifications like DropRequire
+// To avoid quadratic behavior, modifications like [File.DropRequire]
 // clear the entry but do not remove it from the slice.
 // Cleanup cleans out all the cleared entries.
 func (f *File) Cleanup() {
@@ -974,6 +975,8 @@ func (f *File) AddGoStmt(version string) error {
 		var hint Expr
 		if f.Module != nil && f.Module.Syntax != nil {
 			hint = f.Module.Syntax
+		} else if f.Syntax == nil {
+			f.Syntax = new(FileSyntax)
 		}
 		f.Go = &Go{
 			Version: version,
@@ -1075,8 +1078,8 @@ func (f *File) AddNewRequire(path, vers string, indirect bool) {
 // The requirements in req must specify at most one distinct version for each
 // module path.
 //
-// If any existing requirements may be removed, the caller should call Cleanup
-// after all edits are complete.
+// If any existing requirements may be removed, the caller should call
+// [File.Cleanup] after all edits are complete.
 func (f *File) SetRequire(req []*Require) {
 	type elem struct {
 		version  string
diff --git a/vendor/golang.org/x/mod/modfile/work.go b/vendor/golang.org/x/mod/modfile/work.go
index 75dc1c549..d7b99376e 100644
--- a/vendor/golang.org/x/mod/modfile/work.go
+++ b/vendor/golang.org/x/mod/modfile/work.go
@@ -34,7 +34,7 @@ type Use struct {
 // data is the content of the file.
 //
 // fix is an optional function that canonicalizes module versions.
-// If fix is nil, all module versions must be canonical (module.CanonicalVersion
+// If fix is nil, all module versions must be canonical ([module.CanonicalVersion]
 // must return the same string).
 func ParseWork(file string, data []byte, fix VersionFixer) (*WorkFile, error) {
 	fs, err := parse(file, data)
@@ -83,7 +83,7 @@ func ParseWork(file string, data []byte, fix VersionFixer) (*WorkFile, error) {
 }
 
 // Cleanup cleans up the file f after any edit operations.
-// To avoid quadratic behavior, modifications like DropRequire
+// To avoid quadratic behavior, modifications like [WorkFile.DropRequire]
 // clear the entry but do not remove it from the slice.
 // Cleanup cleans out all the cleared entries.
 func (f *WorkFile) Cleanup() {
diff --git a/vendor/golang.org/x/mod/module/module.go b/vendor/golang.org/x/mod/module/module.go
index e9dec6e61..2a364b229 100644
--- a/vendor/golang.org/x/mod/module/module.go
+++ b/vendor/golang.org/x/mod/module/module.go
@@ -4,7 +4,7 @@
 
 // Package module defines the module.Version type along with support code.
 //
-// The module.Version type is a simple Path, Version pair:
+// The [module.Version] type is a simple Path, Version pair:
 //
 //	type Version struct {
 //		Path string
@@ -12,7 +12,7 @@
 //	}
 //
 // There are no restrictions imposed directly by use of this structure,
-// but additional checking functions, most notably Check, verify that
+// but additional checking functions, most notably [Check], verify that
 // a particular path, version pair is valid.
 //
 // # Escaped Paths
@@ -140,7 +140,7 @@ type ModuleError struct {
 	Err     error
 }
 
-// VersionError returns a ModuleError derived from a Version and error,
+// VersionError returns a [ModuleError] derived from a [Version] and error,
 // or err itself if it is already such an error.
 func VersionError(v Version, err error) error {
 	var mErr *ModuleError
@@ -169,7 +169,7 @@ func (e *ModuleError) Unwrap() error { return e.Err }
 // An InvalidVersionError indicates an error specific to a version, with the
 // module path unknown or specified externally.
 //
-// A ModuleError may wrap an InvalidVersionError, but an InvalidVersionError
+// A [ModuleError] may wrap an InvalidVersionError, but an InvalidVersionError
 // must not wrap a ModuleError.
 type InvalidVersionError struct {
 	Version string
@@ -193,8 +193,8 @@ func (e *InvalidVersionError) Error() string {
 func (e *InvalidVersionError) Unwrap() error { return e.Err }
 
 // An InvalidPathError indicates a module, import, or file path doesn't
-// satisfy all naming constraints. See CheckPath, CheckImportPath,
-// and CheckFilePath for specific restrictions.
+// satisfy all naming constraints. See [CheckPath], [CheckImportPath],
+// and [CheckFilePath] for specific restrictions.
 type InvalidPathError struct {
 	Kind string // "module", "import", or "file"
 	Path string
@@ -294,7 +294,7 @@ func fileNameOK(r rune) bool {
 }
 
 // CheckPath checks that a module path is valid.
-// A valid module path is a valid import path, as checked by CheckImportPath,
+// A valid module path is a valid import path, as checked by [CheckImportPath],
 // with three additional constraints.
 // First, the leading path element (up to the first slash, if any),
 // by convention a domain name, must contain only lower-case ASCII letters,
@@ -380,7 +380,7 @@ const (
 // checkPath returns an error describing why the path is not valid.
 // Because these checks apply to module, import, and file paths,
 // and because other checks may be applied, the caller is expected to wrap
-// this error with InvalidPathError.
+// this error with [InvalidPathError].
 func checkPath(path string, kind pathKind) error {
 	if !utf8.ValidString(path) {
 		return fmt.Errorf("invalid UTF-8")
@@ -532,7 +532,7 @@ var badWindowsNames = []string{
 // they require ".vN" instead of "/vN", and for all N, not just N >= 2.
 // SplitPathVersion returns with ok = false when presented with
 // a path whose last path element does not satisfy the constraints
-// applied by CheckPath, such as "example.com/pkg/v1" or "example.com/pkg/v1.2".
+// applied by [CheckPath], such as "example.com/pkg/v1" or "example.com/pkg/v1.2".
 func SplitPathVersion(path string) (prefix, pathMajor string, ok bool) {
 	if strings.HasPrefix(path, "gopkg.in/") {
 		return splitGopkgIn(path)
@@ -582,7 +582,7 @@ func splitGopkgIn(path string) (prefix, pathMajor string, ok bool) {
 // MatchPathMajor reports whether the semantic version v
 // matches the path major version pathMajor.
 //
-// MatchPathMajor returns true if and only if CheckPathMajor returns nil.
+// MatchPathMajor returns true if and only if [CheckPathMajor] returns nil.
 func MatchPathMajor(v, pathMajor string) bool {
 	return CheckPathMajor(v, pathMajor) == nil
 }
@@ -622,7 +622,7 @@ func CheckPathMajor(v, pathMajor string) error {
 // PathMajorPrefix returns the major-version tag prefix implied by pathMajor.
 // An empty PathMajorPrefix allows either v0 or v1.
 //
-// Note that MatchPathMajor may accept some versions that do not actually begin
+// Note that [MatchPathMajor] may accept some versions that do not actually begin
 // with this prefix: namely, it accepts a 'v0.0.0-' prefix for a '.v1'
 // pathMajor, even though that pathMajor implies 'v1' tagging.
 func PathMajorPrefix(pathMajor string) string {
@@ -643,7 +643,7 @@ func PathMajorPrefix(pathMajor string) string {
 }
 
 // CanonicalVersion returns the canonical form of the version string v.
-// It is the same as semver.Canonical(v) except that it preserves the special build suffix "+incompatible".
+// It is the same as [semver.Canonical] except that it preserves the special build suffix "+incompatible".
 func CanonicalVersion(v string) string {
 	cv := semver.Canonical(v)
 	if semver.Build(v) == "+incompatible" {
@@ -652,8 +652,8 @@ func CanonicalVersion(v string) string {
 	return cv
 }
 
-// Sort sorts the list by Path, breaking ties by comparing Version fields.
-// The Version fields are interpreted as semantic versions (using semver.Compare)
+// Sort sorts the list by Path, breaking ties by comparing [Version] fields.
+// The Version fields are interpreted as semantic versions (using [semver.Compare])
 // optionally followed by a tie-breaking suffix introduced by a slash character,
 // like in "v0.0.1/go.mod".
 func Sort(list []Version) {
@@ -793,7 +793,7 @@ func unescapeString(escaped string) (string, bool) {
 }
 
 // MatchPrefixPatterns reports whether any path prefix of target matches one of
-// the glob patterns (as defined by path.Match) in the comma-separated globs
+// the glob patterns (as defined by [path.Match]) in the comma-separated globs
 // list. This implements the algorithm used when matching a module path to the
 // GOPRIVATE environment variable, as described by 'go help module-private'.
 //
diff --git a/vendor/golang.org/x/mod/module/pseudo.go b/vendor/golang.org/x/mod/module/pseudo.go
index f04ad3788..9cf19d325 100644
--- a/vendor/golang.org/x/mod/module/pseudo.go
+++ b/vendor/golang.org/x/mod/module/pseudo.go
@@ -125,7 +125,7 @@ func IsPseudoVersion(v string) bool {
 }
 
 // IsZeroPseudoVersion returns whether v is a pseudo-version with a zero base,
-// timestamp, and revision, as returned by ZeroPseudoVersion.
+// timestamp, and revision, as returned by [ZeroPseudoVersion].
 func IsZeroPseudoVersion(v string) bool {
 	return v == ZeroPseudoVersion(semver.Major(v))
 }
diff --git a/vendor/golang.org/x/mod/semver/semver.go b/vendor/golang.org/x/mod/semver/semver.go
index a30a22bf2..9a2dfd33a 100644
--- a/vendor/golang.org/x/mod/semver/semver.go
+++ b/vendor/golang.org/x/mod/semver/semver.go
@@ -140,7 +140,7 @@ func Compare(v, w string) int {
 // Max canonicalizes its arguments and then returns the version string
 // that compares greater.
 //
-// Deprecated: use Compare instead. In most cases, returning a canonicalized
+// Deprecated: use [Compare] instead. In most cases, returning a canonicalized
 // version is not expected or desired.
 func Max(v, w string) string {
 	v = Canonical(v)
@@ -151,7 +151,7 @@ func Max(v, w string) string {
 	return w
 }
 
-// ByVersion implements sort.Interface for sorting semantic version strings.
+// ByVersion implements [sort.Interface] for sorting semantic version strings.
 type ByVersion []string
 
 func (vs ByVersion) Len() int      { return len(vs) }
@@ -164,7 +164,7 @@ func (vs ByVersion) Less(i, j int) bool {
 	return vs[i] < vs[j]
 }
 
-// Sort sorts a list of semantic version strings using ByVersion.
+// Sort sorts a list of semantic version strings using [ByVersion].
 func Sort(list []string) {
 	sort.Sort(ByVersion(list))
 }
diff --git a/vendor/golang.org/x/sys/execabs/execabs.go b/vendor/golang.org/x/sys/execabs/execabs.go
deleted file mode 100644
index 3bf40fdfe..000000000
--- a/vendor/golang.org/x/sys/execabs/execabs.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// Copyright 2020 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package execabs is a drop-in replacement for os/exec
-// that requires PATH lookups to find absolute paths.
-// That is, execabs.Command("cmd") runs the same PATH lookup
-// as exec.Command("cmd"), but if the result is a path
-// which is relative, the Run and Start methods will report
-// an error instead of running the executable.
-//
-// See https://blog.golang.org/path-security for more information
-// about when it may be necessary or appropriate to use this package.
-package execabs
-
-import (
-	"context"
-	"fmt"
-	"os/exec"
-	"path/filepath"
-	"reflect"
-	"unsafe"
-)
-
-// ErrNotFound is the error resulting if a path search failed to find an executable file.
-// It is an alias for exec.ErrNotFound.
-var ErrNotFound = exec.ErrNotFound
-
-// Cmd represents an external command being prepared or run.
-// It is an alias for exec.Cmd.
-type Cmd = exec.Cmd
-
-// Error is returned by LookPath when it fails to classify a file as an executable.
-// It is an alias for exec.Error.
-type Error = exec.Error
-
-// An ExitError reports an unsuccessful exit by a command.
-// It is an alias for exec.ExitError.
-type ExitError = exec.ExitError
-
-func relError(file, path string) error {
-	return fmt.Errorf("%s resolves to executable in current directory (.%c%s)", file, filepath.Separator, path)
-}
-
-// LookPath searches for an executable named file in the directories
-// named by the PATH environment variable. If file contains a slash,
-// it is tried directly and the PATH is not consulted. The result will be
-// an absolute path.
-//
-// LookPath differs from exec.LookPath in its handling of PATH lookups,
-// which are used for file names without slashes. If exec.LookPath's
-// PATH lookup would have returned an executable from the current directory,
-// LookPath instead returns an error.
-func LookPath(file string) (string, error) {
-	path, err := exec.LookPath(file)
-	if err != nil && !isGo119ErrDot(err) {
-		return "", err
-	}
-	if filepath.Base(file) == file && !filepath.IsAbs(path) {
-		return "", relError(file, path)
-	}
-	return path, nil
-}
-
-func fixCmd(name string, cmd *exec.Cmd) {
-	if filepath.Base(name) == name && !filepath.IsAbs(cmd.Path) && !isGo119ErrFieldSet(cmd) {
-		// exec.Command was called with a bare binary name and
-		// exec.LookPath returned a path which is not absolute.
-		// Set cmd.lookPathErr and clear cmd.Path so that it
-		// cannot be run.
-		lookPathErr := (*error)(unsafe.Pointer(reflect.ValueOf(cmd).Elem().FieldByName("lookPathErr").Addr().Pointer()))
-		if *lookPathErr == nil {
-			*lookPathErr = relError(name, cmd.Path)
-		}
-		cmd.Path = ""
-	}
-}
-
-// CommandContext is like Command but includes a context.
-//
-// The provided context is used to kill the process (by calling os.Process.Kill)
-// if the context becomes done before the command completes on its own.
-func CommandContext(ctx context.Context, name string, arg ...string) *exec.Cmd {
-	cmd := exec.CommandContext(ctx, name, arg...)
-	fixCmd(name, cmd)
-	return cmd
-
-}
-
-// Command returns the Cmd struct to execute the named program with the given arguments.
-// See exec.Command for most details.
-//
-// Command differs from exec.Command in its handling of PATH lookups,
-// which are used when the program name contains no slashes.
-// If exec.Command would have returned an exec.Cmd configured to run an
-// executable from the current directory, Command instead
-// returns an exec.Cmd that will return an error from Start or Run.
-func Command(name string, arg ...string) *exec.Cmd {
-	cmd := exec.Command(name, arg...)
-	fixCmd(name, cmd)
-	return cmd
-}
diff --git a/vendor/golang.org/x/sys/execabs/execabs_go118.go b/vendor/golang.org/x/sys/execabs/execabs_go118.go
deleted file mode 100644
index 5627d70e3..000000000
--- a/vendor/golang.org/x/sys/execabs/execabs_go118.go
+++ /dev/null
@@ -1,17 +0,0 @@
-// Copyright 2022 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build !go1.19
-
-package execabs
-
-import "os/exec"
-
-func isGo119ErrDot(err error) bool {
-	return false
-}
-
-func isGo119ErrFieldSet(cmd *exec.Cmd) bool {
-	return false
-}
diff --git a/vendor/golang.org/x/sys/execabs/execabs_go119.go b/vendor/golang.org/x/sys/execabs/execabs_go119.go
deleted file mode 100644
index d60ab1b41..000000000
--- a/vendor/golang.org/x/sys/execabs/execabs_go119.go
+++ /dev/null
@@ -1,20 +0,0 @@
-// Copyright 2022 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build go1.19
-
-package execabs
-
-import (
-	"errors"
-	"os/exec"
-)
-
-func isGo119ErrDot(err error) bool {
-	return errors.Is(err, exec.ErrDot)
-}
-
-func isGo119ErrFieldSet(cmd *exec.Cmd) bool {
-	return cmd.Err != nil
-}
diff --git a/vendor/golang.org/x/tools/cover/profile.go b/vendor/golang.org/x/tools/cover/profile.go
new file mode 100644
index 000000000..47a9a5411
--- /dev/null
+++ b/vendor/golang.org/x/tools/cover/profile.go
@@ -0,0 +1,266 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package cover provides support for parsing coverage profiles
+// generated by "go test -coverprofile=cover.out".
+package cover // import "golang.org/x/tools/cover"
+
+import (
+	"bufio"
+	"errors"
+	"fmt"
+	"io"
+	"math"
+	"os"
+	"sort"
+	"strconv"
+	"strings"
+)
+
+// Profile represents the profiling data for a specific file.
+type Profile struct {
+	FileName string
+	Mode     string
+	Blocks   []ProfileBlock
+}
+
+// ProfileBlock represents a single block of profiling data.
+type ProfileBlock struct {
+	StartLine, StartCol int
+	EndLine, EndCol     int
+	NumStmt, Count      int
+}
+
+type byFileName []*Profile
+
+func (p byFileName) Len() int           { return len(p) }
+func (p byFileName) Less(i, j int) bool { return p[i].FileName < p[j].FileName }
+func (p byFileName) Swap(i, j int)      { p[i], p[j] = p[j], p[i] }
+
+// ParseProfiles parses profile data in the specified file and returns a
+// Profile for each source file described therein.
+func ParseProfiles(fileName string) ([]*Profile, error) {
+	pf, err := os.Open(fileName)
+	if err != nil {
+		return nil, err
+	}
+	defer pf.Close()
+	return ParseProfilesFromReader(pf)
+}
+
+// ParseProfilesFromReader parses profile data from the Reader and
+// returns a Profile for each source file described therein.
+func ParseProfilesFromReader(rd io.Reader) ([]*Profile, error) {
+	// First line is "mode: foo", where foo is "set", "count", or "atomic".
+	// Rest of file is in the format
+	//	encoding/base64/base64.go:34.44,37.40 3 1
+	// where the fields are: name.go:line.column,line.column numberOfStatements count
+	files := make(map[string]*Profile)
+	s := bufio.NewScanner(rd)
+	mode := ""
+	for s.Scan() {
+		line := s.Text()
+		if mode == "" {
+			const p = "mode: "
+			if !strings.HasPrefix(line, p) || line == p {
+				return nil, fmt.Errorf("bad mode line: %v", line)
+			}
+			mode = line[len(p):]
+			continue
+		}
+		fn, b, err := parseLine(line)
+		if err != nil {
+			return nil, fmt.Errorf("line %q doesn't match expected format: %v", line, err)
+		}
+		p := files[fn]
+		if p == nil {
+			p = &Profile{
+				FileName: fn,
+				Mode:     mode,
+			}
+			files[fn] = p
+		}
+		p.Blocks = append(p.Blocks, b)
+	}
+	if err := s.Err(); err != nil {
+		return nil, err
+	}
+	for _, p := range files {
+		sort.Sort(blocksByStart(p.Blocks))
+		// Merge samples from the same location.
+		j := 1
+		for i := 1; i < len(p.Blocks); i++ {
+			b := p.Blocks[i]
+			last := p.Blocks[j-1]
+			if b.StartLine == last.StartLine &&
+				b.StartCol == last.StartCol &&
+				b.EndLine == last.EndLine &&
+				b.EndCol == last.EndCol {
+				if b.NumStmt != last.NumStmt {
+					return nil, fmt.Errorf("inconsistent NumStmt: changed from %d to %d", last.NumStmt, b.NumStmt)
+				}
+				if mode == "set" {
+					p.Blocks[j-1].Count |= b.Count
+				} else {
+					p.Blocks[j-1].Count += b.Count
+				}
+				continue
+			}
+			p.Blocks[j] = b
+			j++
+		}
+		p.Blocks = p.Blocks[:j]
+	}
+	// Generate a sorted slice.
+	profiles := make([]*Profile, 0, len(files))
+	for _, profile := range files {
+		profiles = append(profiles, profile)
+	}
+	sort.Sort(byFileName(profiles))
+	return profiles, nil
+}
+
+// parseLine parses a line from a coverage file.
+// It is equivalent to the regex
+// ^(.+):([0-9]+)\.([0-9]+),([0-9]+)\.([0-9]+) ([0-9]+) ([0-9]+)$
+//
+// However, it is much faster: https://golang.org/cl/179377
+func parseLine(l string) (fileName string, block ProfileBlock, err error) {
+	end := len(l)
+
+	b := ProfileBlock{}
+	b.Count, end, err = seekBack(l, ' ', end, "Count")
+	if err != nil {
+		return "", b, err
+	}
+	b.NumStmt, end, err = seekBack(l, ' ', end, "NumStmt")
+	if err != nil {
+		return "", b, err
+	}
+	b.EndCol, end, err = seekBack(l, '.', end, "EndCol")
+	if err != nil {
+		return "", b, err
+	}
+	b.EndLine, end, err = seekBack(l, ',', end, "EndLine")
+	if err != nil {
+		return "", b, err
+	}
+	b.StartCol, end, err = seekBack(l, '.', end, "StartCol")
+	if err != nil {
+		return "", b, err
+	}
+	b.StartLine, end, err = seekBack(l, ':', end, "StartLine")
+	if err != nil {
+		return "", b, err
+	}
+	fn := l[0:end]
+	if fn == "" {
+		return "", b, errors.New("a FileName cannot be blank")
+	}
+	return fn, b, nil
+}
+
+// seekBack searches backwards from end to find sep in l, then returns the
+// value between sep and end as an integer.
+// If seekBack fails, the returned error will reference what.
+func seekBack(l string, sep byte, end int, what string) (value int, nextSep int, err error) {
+	// Since we're seeking backwards and we know only ASCII is legal for these values,
+	// we can ignore the possibility of non-ASCII characters.
+	for start := end - 1; start >= 0; start-- {
+		if l[start] == sep {
+			i, err := strconv.Atoi(l[start+1 : end])
+			if err != nil {
+				return 0, 0, fmt.Errorf("couldn't parse %q: %v", what, err)
+			}
+			if i < 0 {
+				return 0, 0, fmt.Errorf("negative values are not allowed for %s, found %d", what, i)
+			}
+			return i, start, nil
+		}
+	}
+	return 0, 0, fmt.Errorf("couldn't find a %s before %s", string(sep), what)
+}
+
+type blocksByStart []ProfileBlock
+
+func (b blocksByStart) Len() int      { return len(b) }
+func (b blocksByStart) Swap(i, j int) { b[i], b[j] = b[j], b[i] }
+func (b blocksByStart) Less(i, j int) bool {
+	bi, bj := b[i], b[j]
+	return bi.StartLine < bj.StartLine || bi.StartLine == bj.StartLine && bi.StartCol < bj.StartCol
+}
+
+// Boundary represents the position in a source file of the beginning or end of a
+// block as reported by the coverage profile. In HTML mode, it will correspond to
+// the opening or closing of a <span> tag and will be used to colorize the source
+type Boundary struct {
+	Offset int     // Location as a byte offset in the source file.
+	Start  bool    // Is this the start of a block?
+	Count  int     // Event count from the cover profile.
+	Norm   float64 // Count normalized to [0..1].
+	Index  int     // Order in input file.
+}
+
+// Boundaries returns a Profile as a set of Boundary objects within the provided src.
+func (p *Profile) Boundaries(src []byte) (boundaries []Boundary) {
+	// Find maximum count.
+	max := 0
+	for _, b := range p.Blocks {
+		if b.Count > max {
+			max = b.Count
+		}
+	}
+	// Divisor for normalization.
+	divisor := math.Log(float64(max))
+
+	// boundary returns a Boundary, populating the Norm field with a normalized Count.
+	index := 0
+	boundary := func(offset int, start bool, count int) Boundary {
+		b := Boundary{Offset: offset, Start: start, Count: count, Index: index}
+		index++
+		if !start || count == 0 {
+			return b
+		}
+		if max <= 1 {
+			b.Norm = 0.8 // Profile is in"set" mode; we want a heat map. Use cov8 in the CSS.
+		} else if count > 0 {
+			b.Norm = math.Log(float64(count)) / divisor
+		}
+		return b
+	}
+
+	line, col := 1, 2 // TODO: Why is this 2?
+	for si, bi := 0, 0; si < len(src) && bi < len(p.Blocks); {
+		b := p.Blocks[bi]
+		if b.StartLine == line && b.StartCol == col {
+			boundaries = append(boundaries, boundary(si, true, b.Count))
+		}
+		if b.EndLine == line && b.EndCol == col || line > b.EndLine {
+			boundaries = append(boundaries, boundary(si, false, 0))
+			bi++
+			continue // Don't advance through src; maybe the next block starts here.
+		}
+		if src[si] == '\n' {
+			line++
+			col = 0
+		}
+		col++
+		si++
+	}
+	sort.Sort(boundariesByPos(boundaries))
+	return
+}
+
+type boundariesByPos []Boundary
+
+func (b boundariesByPos) Len() int      { return len(b) }
+func (b boundariesByPos) Swap(i, j int) { b[i], b[j] = b[j], b[i] }
+func (b boundariesByPos) Less(i, j int) bool {
+	if b[i].Offset == b[j].Offset {
+		// Boundaries at the same offset should be ordered according to
+		// their original position.
+		return b[i].Index < b[j].Index
+	}
+	return b[i].Offset < b[j].Offset
+}
diff --git a/vendor/golang.org/x/tools/go/ast/astutil/enclosing.go b/vendor/golang.org/x/tools/go/ast/astutil/enclosing.go
index 9fa5aa192..2c4c4e232 100644
--- a/vendor/golang.org/x/tools/go/ast/astutil/enclosing.go
+++ b/vendor/golang.org/x/tools/go/ast/astutil/enclosing.go
@@ -11,8 +11,6 @@ import (
 	"go/ast"
 	"go/token"
 	"sort"
-
-	"golang.org/x/tools/internal/typeparams"
 )
 
 // PathEnclosingInterval returns the node that encloses the source
@@ -322,7 +320,7 @@ func childrenOf(n ast.Node) []ast.Node {
 			children = append(children, n.Recv)
 		}
 		children = append(children, n.Name)
-		if tparams := typeparams.ForFuncType(n.Type); tparams != nil {
+		if tparams := n.Type.TypeParams; tparams != nil {
 			children = append(children, tparams)
 		}
 		if n.Type.Params != nil {
@@ -377,7 +375,7 @@ func childrenOf(n ast.Node) []ast.Node {
 			tok(n.Lbrack, len("[")),
 			tok(n.Rbrack, len("]")))
 
-	case *typeparams.IndexListExpr:
+	case *ast.IndexListExpr:
 		children = append(children,
 			tok(n.Lbrack, len("[")),
 			tok(n.Rbrack, len("]")))
@@ -588,7 +586,7 @@ func NodeDescription(n ast.Node) string {
 		return "decrement statement"
 	case *ast.IndexExpr:
 		return "index expression"
-	case *typeparams.IndexListExpr:
+	case *ast.IndexListExpr:
 		return "index list expression"
 	case *ast.InterfaceType:
 		return "interface type"
diff --git a/vendor/golang.org/x/tools/go/ast/astutil/rewrite.go b/vendor/golang.org/x/tools/go/ast/astutil/rewrite.go
index f430b21b9..58934f766 100644
--- a/vendor/golang.org/x/tools/go/ast/astutil/rewrite.go
+++ b/vendor/golang.org/x/tools/go/ast/astutil/rewrite.go
@@ -9,8 +9,6 @@ import (
 	"go/ast"
 	"reflect"
 	"sort"
-
-	"golang.org/x/tools/internal/typeparams"
 )
 
 // An ApplyFunc is invoked by Apply for each node n, even if n is nil,
@@ -252,7 +250,7 @@ func (a *application) apply(parent ast.Node, name string, iter *iterator, n ast.
 		a.apply(n, "X", nil, n.X)
 		a.apply(n, "Index", nil, n.Index)
 
-	case *typeparams.IndexListExpr:
+	case *ast.IndexListExpr:
 		a.apply(n, "X", nil, n.X)
 		a.applyList(n, "Indices")
 
@@ -293,7 +291,7 @@ func (a *application) apply(parent ast.Node, name string, iter *iterator, n ast.
 		a.apply(n, "Fields", nil, n.Fields)
 
 	case *ast.FuncType:
-		if tparams := typeparams.ForFuncType(n); tparams != nil {
+		if tparams := n.TypeParams; tparams != nil {
 			a.apply(n, "TypeParams", nil, tparams)
 		}
 		a.apply(n, "Params", nil, n.Params)
@@ -408,7 +406,7 @@ func (a *application) apply(parent ast.Node, name string, iter *iterator, n ast.
 	case *ast.TypeSpec:
 		a.apply(n, "Doc", nil, n.Doc)
 		a.apply(n, "Name", nil, n.Name)
-		if tparams := typeparams.ForTypeSpec(n); tparams != nil {
+		if tparams := n.TypeParams; tparams != nil {
 			a.apply(n, "TypeParams", nil, tparams)
 		}
 		a.apply(n, "Type", nil, n.Type)
diff --git a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go b/vendor/golang.org/x/tools/go/ast/inspector/inspector.go
index 3fbfebf36..1fc1de0bd 100644
--- a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go
+++ b/vendor/golang.org/x/tools/go/ast/inspector/inspector.go
@@ -64,8 +64,9 @@ type event struct {
 // depth-first order. It calls f(n) for each node n before it visits
 // n's children.
 //
+// The complete traversal sequence is determined by ast.Inspect.
 // The types argument, if non-empty, enables type-based filtering of
-// events. The function f if is called only for nodes whose type
+// events. The function f is called only for nodes whose type
 // matches an element of the types slice.
 func (in *Inspector) Preorder(types []ast.Node, f func(ast.Node)) {
 	// Because it avoids postorder calls to f, and the pruning
@@ -97,6 +98,7 @@ func (in *Inspector) Preorder(types []ast.Node, f func(ast.Node)) {
 // of the non-nil children of the node, followed by a call of
 // f(n, false).
 //
+// The complete traversal sequence is determined by ast.Inspect.
 // The types argument, if non-empty, enables type-based filtering of
 // events. The function f if is called only for nodes whose type
 // matches an element of the types slice.
diff --git a/vendor/golang.org/x/tools/go/ast/inspector/typeof.go b/vendor/golang.org/x/tools/go/ast/inspector/typeof.go
index 703c81395..2a872f89d 100644
--- a/vendor/golang.org/x/tools/go/ast/inspector/typeof.go
+++ b/vendor/golang.org/x/tools/go/ast/inspector/typeof.go
@@ -12,8 +12,6 @@ package inspector
 import (
 	"go/ast"
 	"math"
-
-	"golang.org/x/tools/internal/typeparams"
 )
 
 const (
@@ -171,7 +169,7 @@ func typeOf(n ast.Node) uint64 {
 		return 1 << nIncDecStmt
 	case *ast.IndexExpr:
 		return 1 << nIndexExpr
-	case *typeparams.IndexListExpr:
+	case *ast.IndexListExpr:
 		return 1 << nIndexListExpr
 	case *ast.InterfaceType:
 		return 1 << nInterfaceType
diff --git a/vendor/golang.org/x/tools/imports/forward.go b/vendor/golang.org/x/tools/imports/forward.go
index d2547c743..cb6db8893 100644
--- a/vendor/golang.org/x/tools/imports/forward.go
+++ b/vendor/golang.org/x/tools/imports/forward.go
@@ -7,8 +7,8 @@
 package imports // import "golang.org/x/tools/imports"
 
 import (
-	"io/ioutil"
 	"log"
+	"os"
 
 	"golang.org/x/tools/internal/gocommand"
 	intimp "golang.org/x/tools/internal/imports"
@@ -44,7 +44,7 @@ var LocalPrefix string
 func Process(filename string, src []byte, opt *Options) ([]byte, error) {
 	var err error
 	if src == nil {
-		src, err = ioutil.ReadFile(filename)
+		src, err = os.ReadFile(filename)
 		if err != nil {
 			return nil, err
 		}
diff --git a/vendor/golang.org/x/tools/internal/event/keys/util.go b/vendor/golang.org/x/tools/internal/event/keys/util.go
new file mode 100644
index 000000000..c0e8e731c
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/event/keys/util.go
@@ -0,0 +1,21 @@
+// Copyright 2023 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package keys
+
+import (
+	"sort"
+	"strings"
+)
+
+// Join returns a canonical join of the keys in S:
+// a sorted comma-separated string list.
+func Join[S ~[]T, T ~string](s S) string {
+	strs := make([]string, 0, len(s))
+	for _, v := range s {
+		strs = append(strs, string(v))
+	}
+	sort.Strings(strs)
+	return strings.Join(strs, ",")
+}
diff --git a/vendor/golang.org/x/tools/internal/event/tag/tag.go b/vendor/golang.org/x/tools/internal/event/tag/tag.go
new file mode 100644
index 000000000..581b26c20
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/event/tag/tag.go
@@ -0,0 +1,59 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package tag provides the labels used for telemetry throughout gopls.
+package tag
+
+import (
+	"golang.org/x/tools/internal/event/keys"
+)
+
+var (
+	// create the label keys we use
+	Method        = keys.NewString("method", "")
+	StatusCode    = keys.NewString("status.code", "")
+	StatusMessage = keys.NewString("status.message", "")
+	RPCID         = keys.NewString("id", "")
+	RPCDirection  = keys.NewString("direction", "")
+	File          = keys.NewString("file", "")
+	Directory     = keys.New("directory", "")
+	URI           = keys.New("URI", "")
+	Package       = keys.NewString("package", "") // sorted comma-separated list of Package IDs
+	PackagePath   = keys.NewString("package_path", "")
+	Query         = keys.New("query", "")
+	Snapshot      = keys.NewUInt64("snapshot", "")
+	Operation     = keys.NewString("operation", "")
+
+	Position     = keys.New("position", "")
+	Category     = keys.NewString("category", "")
+	PackageCount = keys.NewInt("packages", "")
+	Files        = keys.New("files", "")
+	Port         = keys.NewInt("port", "")
+	Type         = keys.New("type", "")
+	HoverKind    = keys.NewString("hoverkind", "")
+
+	NewServer = keys.NewString("new_server", "A new server was added")
+	EndServer = keys.NewString("end_server", "A server was shut down")
+
+	ServerID     = keys.NewString("server", "The server ID an event is related to")
+	Logfile      = keys.NewString("logfile", "")
+	DebugAddress = keys.NewString("debug_address", "")
+	GoplsPath    = keys.NewString("gopls_path", "")
+	ClientID     = keys.NewString("client_id", "")
+
+	Level = keys.NewInt("level", "The logging level")
+)
+
+var (
+	// create the stats we measure
+	Started       = keys.NewInt64("started", "Count of started RPCs.")
+	ReceivedBytes = keys.NewInt64("received_bytes", "Bytes received.")            //, unit.Bytes)
+	SentBytes     = keys.NewInt64("sent_bytes", "Bytes sent.")                    //, unit.Bytes)
+	Latency       = keys.NewFloat64("latency_ms", "Elapsed time in milliseconds") //, unit.Milliseconds)
+)
+
+const (
+	Inbound  = "in"
+	Outbound = "out"
+)
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go
deleted file mode 100644
index 798fe599b..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go
+++ /dev/null
@@ -1,196 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package fastwalk provides a faster version of filepath.Walk for file system
-// scanning tools.
-package fastwalk
-
-import (
-	"errors"
-	"os"
-	"path/filepath"
-	"runtime"
-	"sync"
-)
-
-// ErrTraverseLink is used as a return value from WalkFuncs to indicate that the
-// symlink named in the call may be traversed.
-var ErrTraverseLink = errors.New("fastwalk: traverse symlink, assuming target is a directory")
-
-// ErrSkipFiles is a used as a return value from WalkFuncs to indicate that the
-// callback should not be called for any other files in the current directory.
-// Child directories will still be traversed.
-var ErrSkipFiles = errors.New("fastwalk: skip remaining files in directory")
-
-// Walk is a faster implementation of filepath.Walk.
-//
-// filepath.Walk's design necessarily calls os.Lstat on each file,
-// even if the caller needs less info.
-// Many tools need only the type of each file.
-// On some platforms, this information is provided directly by the readdir
-// system call, avoiding the need to stat each file individually.
-// fastwalk_unix.go contains a fork of the syscall routines.
-//
-// See golang.org/issue/16399
-//
-// Walk walks the file tree rooted at root, calling walkFn for
-// each file or directory in the tree, including root.
-//
-// If fastWalk returns filepath.SkipDir, the directory is skipped.
-//
-// Unlike filepath.Walk:
-//   - file stat calls must be done by the user.
-//     The only provided metadata is the file type, which does not include
-//     any permission bits.
-//   - multiple goroutines stat the filesystem concurrently. The provided
-//     walkFn must be safe for concurrent use.
-//   - fastWalk can follow symlinks if walkFn returns the TraverseLink
-//     sentinel error. It is the walkFn's responsibility to prevent
-//     fastWalk from going into symlink cycles.
-func Walk(root string, walkFn func(path string, typ os.FileMode) error) error {
-	// TODO(bradfitz): make numWorkers configurable? We used a
-	// minimum of 4 to give the kernel more info about multiple
-	// things we want, in hopes its I/O scheduling can take
-	// advantage of that. Hopefully most are in cache. Maybe 4 is
-	// even too low of a minimum. Profile more.
-	numWorkers := 4
-	if n := runtime.NumCPU(); n > numWorkers {
-		numWorkers = n
-	}
-
-	// Make sure to wait for all workers to finish, otherwise
-	// walkFn could still be called after returning. This Wait call
-	// runs after close(e.donec) below.
-	var wg sync.WaitGroup
-	defer wg.Wait()
-
-	w := &walker{
-		fn:       walkFn,
-		enqueuec: make(chan walkItem, numWorkers), // buffered for performance
-		workc:    make(chan walkItem, numWorkers), // buffered for performance
-		donec:    make(chan struct{}),
-
-		// buffered for correctness & not leaking goroutines:
-		resc: make(chan error, numWorkers),
-	}
-	defer close(w.donec)
-
-	for i := 0; i < numWorkers; i++ {
-		wg.Add(1)
-		go w.doWork(&wg)
-	}
-	todo := []walkItem{{dir: root}}
-	out := 0
-	for {
-		workc := w.workc
-		var workItem walkItem
-		if len(todo) == 0 {
-			workc = nil
-		} else {
-			workItem = todo[len(todo)-1]
-		}
-		select {
-		case workc <- workItem:
-			todo = todo[:len(todo)-1]
-			out++
-		case it := <-w.enqueuec:
-			todo = append(todo, it)
-		case err := <-w.resc:
-			out--
-			if err != nil {
-				return err
-			}
-			if out == 0 && len(todo) == 0 {
-				// It's safe to quit here, as long as the buffered
-				// enqueue channel isn't also readable, which might
-				// happen if the worker sends both another unit of
-				// work and its result before the other select was
-				// scheduled and both w.resc and w.enqueuec were
-				// readable.
-				select {
-				case it := <-w.enqueuec:
-					todo = append(todo, it)
-				default:
-					return nil
-				}
-			}
-		}
-	}
-}
-
-// doWork reads directories as instructed (via workc) and runs the
-// user's callback function.
-func (w *walker) doWork(wg *sync.WaitGroup) {
-	defer wg.Done()
-	for {
-		select {
-		case <-w.donec:
-			return
-		case it := <-w.workc:
-			select {
-			case <-w.donec:
-				return
-			case w.resc <- w.walk(it.dir, !it.callbackDone):
-			}
-		}
-	}
-}
-
-type walker struct {
-	fn func(path string, typ os.FileMode) error
-
-	donec    chan struct{} // closed on fastWalk's return
-	workc    chan walkItem // to workers
-	enqueuec chan walkItem // from workers
-	resc     chan error    // from workers
-}
-
-type walkItem struct {
-	dir          string
-	callbackDone bool // callback already called; don't do it again
-}
-
-func (w *walker) enqueue(it walkItem) {
-	select {
-	case w.enqueuec <- it:
-	case <-w.donec:
-	}
-}
-
-func (w *walker) onDirEnt(dirName, baseName string, typ os.FileMode) error {
-	joined := dirName + string(os.PathSeparator) + baseName
-	if typ == os.ModeDir {
-		w.enqueue(walkItem{dir: joined})
-		return nil
-	}
-
-	err := w.fn(joined, typ)
-	if typ == os.ModeSymlink {
-		if err == ErrTraverseLink {
-			// Set callbackDone so we don't call it twice for both the
-			// symlink-as-symlink and the symlink-as-directory later:
-			w.enqueue(walkItem{dir: joined, callbackDone: true})
-			return nil
-		}
-		if err == filepath.SkipDir {
-			// Permit SkipDir on symlinks too.
-			return nil
-		}
-	}
-	return err
-}
-
-func (w *walker) walk(root string, runUserCallback bool) error {
-	if runUserCallback {
-		err := w.fn(root, os.ModeDir)
-		if err == filepath.SkipDir {
-			return nil
-		}
-		if err != nil {
-			return err
-		}
-	}
-
-	return readDir(root, w.onDirEnt)
-}
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_darwin.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_darwin.go
deleted file mode 100644
index 0ca55e0d5..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_darwin.go
+++ /dev/null
@@ -1,119 +0,0 @@
-// Copyright 2022 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build darwin && cgo
-// +build darwin,cgo
-
-package fastwalk
-
-/*
-#include <dirent.h>
-
-// fastwalk_readdir_r wraps readdir_r so that we don't have to pass a dirent**
-// result pointer which triggers CGO's "Go pointer to Go pointer" check unless
-// we allocat the result dirent* with malloc.
-//
-// fastwalk_readdir_r returns 0 on success, -1 upon reaching the end of the
-// directory, or a positive error number to indicate failure.
-static int fastwalk_readdir_r(DIR *fd, struct dirent *entry) {
-	struct dirent *result;
-	int ret = readdir_r(fd, entry, &result);
-	if (ret == 0 && result == NULL) {
-		ret = -1; // EOF
-	}
-	return ret;
-}
-*/
-import "C"
-
-import (
-	"os"
-	"syscall"
-	"unsafe"
-)
-
-func readDir(dirName string, fn func(dirName, entName string, typ os.FileMode) error) error {
-	fd, err := openDir(dirName)
-	if err != nil {
-		return &os.PathError{Op: "opendir", Path: dirName, Err: err}
-	}
-	defer C.closedir(fd)
-
-	skipFiles := false
-	var dirent syscall.Dirent
-	for {
-		ret := int(C.fastwalk_readdir_r(fd, (*C.struct_dirent)(unsafe.Pointer(&dirent))))
-		if ret != 0 {
-			if ret == -1 {
-				break // EOF
-			}
-			if ret == int(syscall.EINTR) {
-				continue
-			}
-			return &os.PathError{Op: "readdir", Path: dirName, Err: syscall.Errno(ret)}
-		}
-		if dirent.Ino == 0 {
-			continue
-		}
-		typ := dtToType(dirent.Type)
-		if skipFiles && typ.IsRegular() {
-			continue
-		}
-		name := (*[len(syscall.Dirent{}.Name)]byte)(unsafe.Pointer(&dirent.Name))[:]
-		name = name[:dirent.Namlen]
-		for i, c := range name {
-			if c == 0 {
-				name = name[:i]
-				break
-			}
-		}
-		// Check for useless names before allocating a string.
-		if string(name) == "." || string(name) == ".." {
-			continue
-		}
-		if err := fn(dirName, string(name), typ); err != nil {
-			if err != ErrSkipFiles {
-				return err
-			}
-			skipFiles = true
-		}
-	}
-
-	return nil
-}
-
-func dtToType(typ uint8) os.FileMode {
-	switch typ {
-	case syscall.DT_BLK:
-		return os.ModeDevice
-	case syscall.DT_CHR:
-		return os.ModeDevice | os.ModeCharDevice
-	case syscall.DT_DIR:
-		return os.ModeDir
-	case syscall.DT_FIFO:
-		return os.ModeNamedPipe
-	case syscall.DT_LNK:
-		return os.ModeSymlink
-	case syscall.DT_REG:
-		return 0
-	case syscall.DT_SOCK:
-		return os.ModeSocket
-	}
-	return ^os.FileMode(0)
-}
-
-// openDir wraps opendir(3) and handles any EINTR errors. The returned *DIR
-// needs to be closed with closedir(3).
-func openDir(path string) (*C.DIR, error) {
-	name, err := syscall.BytePtrFromString(path)
-	if err != nil {
-		return nil, err
-	}
-	for {
-		fd, err := C.opendir((*C.char)(unsafe.Pointer(name)))
-		if err != syscall.EINTR {
-			return fd, err
-		}
-	}
-}
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_fileno.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_fileno.go
deleted file mode 100644
index d58595dbd..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_fileno.go
+++ /dev/null
@@ -1,14 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build freebsd || openbsd || netbsd
-// +build freebsd openbsd netbsd
-
-package fastwalk
-
-import "syscall"
-
-func direntInode(dirent *syscall.Dirent) uint64 {
-	return uint64(dirent.Fileno)
-}
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_ino.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_ino.go
deleted file mode 100644
index d3922890b..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_ino.go
+++ /dev/null
@@ -1,15 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build (linux || (darwin && !cgo)) && !appengine
-// +build linux darwin,!cgo
-// +build !appengine
-
-package fastwalk
-
-import "syscall"
-
-func direntInode(dirent *syscall.Dirent) uint64 {
-	return dirent.Ino
-}
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_namlen_bsd.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_namlen_bsd.go
deleted file mode 100644
index 38a4db6af..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_namlen_bsd.go
+++ /dev/null
@@ -1,14 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build (darwin && !cgo) || freebsd || openbsd || netbsd
-// +build darwin,!cgo freebsd openbsd netbsd
-
-package fastwalk
-
-import "syscall"
-
-func direntNamlen(dirent *syscall.Dirent) uint64 {
-	return uint64(dirent.Namlen)
-}
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_namlen_linux.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_namlen_linux.go
deleted file mode 100644
index c82e57df8..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_dirent_namlen_linux.go
+++ /dev/null
@@ -1,29 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build linux && !appengine
-// +build linux,!appengine
-
-package fastwalk
-
-import (
-	"bytes"
-	"syscall"
-	"unsafe"
-)
-
-func direntNamlen(dirent *syscall.Dirent) uint64 {
-	const fixedHdr = uint16(unsafe.Offsetof(syscall.Dirent{}.Name))
-	nameBuf := (*[unsafe.Sizeof(dirent.Name)]byte)(unsafe.Pointer(&dirent.Name[0]))
-	const nameBufLen = uint16(len(nameBuf))
-	limit := dirent.Reclen - fixedHdr
-	if limit > nameBufLen {
-		limit = nameBufLen
-	}
-	nameLen := bytes.IndexByte(nameBuf[:limit], 0)
-	if nameLen < 0 {
-		panic("failed to find terminating 0 byte in dirent")
-	}
-	return uint64(nameLen)
-}
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_portable.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_portable.go
deleted file mode 100644
index 085d31160..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_portable.go
+++ /dev/null
@@ -1,38 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build appengine || (!linux && !darwin && !freebsd && !openbsd && !netbsd)
-// +build appengine !linux,!darwin,!freebsd,!openbsd,!netbsd
-
-package fastwalk
-
-import (
-	"io/ioutil"
-	"os"
-)
-
-// readDir calls fn for each directory entry in dirName.
-// It does not descend into directories or follow symlinks.
-// If fn returns a non-nil error, readDir returns with that error
-// immediately.
-func readDir(dirName string, fn func(dirName, entName string, typ os.FileMode) error) error {
-	fis, err := ioutil.ReadDir(dirName)
-	if err != nil {
-		return err
-	}
-	skipFiles := false
-	for _, fi := range fis {
-		if fi.Mode().IsRegular() && skipFiles {
-			continue
-		}
-		if err := fn(dirName, fi.Name(), fi.Mode()&os.ModeType); err != nil {
-			if err == ErrSkipFiles {
-				skipFiles = true
-				continue
-			}
-			return err
-		}
-	}
-	return nil
-}
diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_unix.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_unix.go
deleted file mode 100644
index f12f1a734..000000000
--- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk_unix.go
+++ /dev/null
@@ -1,153 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build (linux || freebsd || openbsd || netbsd || (darwin && !cgo)) && !appengine
-// +build linux freebsd openbsd netbsd darwin,!cgo
-// +build !appengine
-
-package fastwalk
-
-import (
-	"fmt"
-	"os"
-	"syscall"
-	"unsafe"
-)
-
-const blockSize = 8 << 10
-
-// unknownFileMode is a sentinel (and bogus) os.FileMode
-// value used to represent a syscall.DT_UNKNOWN Dirent.Type.
-const unknownFileMode os.FileMode = os.ModeNamedPipe | os.ModeSocket | os.ModeDevice
-
-func readDir(dirName string, fn func(dirName, entName string, typ os.FileMode) error) error {
-	fd, err := open(dirName, 0, 0)
-	if err != nil {
-		return &os.PathError{Op: "open", Path: dirName, Err: err}
-	}
-	defer syscall.Close(fd)
-
-	// The buffer must be at least a block long.
-	buf := make([]byte, blockSize) // stack-allocated; doesn't escape
-	bufp := 0                      // starting read position in buf
-	nbuf := 0                      // end valid data in buf
-	skipFiles := false
-	for {
-		if bufp >= nbuf {
-			bufp = 0
-			nbuf, err = readDirent(fd, buf)
-			if err != nil {
-				return os.NewSyscallError("readdirent", err)
-			}
-			if nbuf <= 0 {
-				return nil
-			}
-		}
-		consumed, name, typ := parseDirEnt(buf[bufp:nbuf])
-		bufp += consumed
-		if name == "" || name == "." || name == ".." {
-			continue
-		}
-		// Fallback for filesystems (like old XFS) that don't
-		// support Dirent.Type and have DT_UNKNOWN (0) there
-		// instead.
-		if typ == unknownFileMode {
-			fi, err := os.Lstat(dirName + "/" + name)
-			if err != nil {
-				// It got deleted in the meantime.
-				if os.IsNotExist(err) {
-					continue
-				}
-				return err
-			}
-			typ = fi.Mode() & os.ModeType
-		}
-		if skipFiles && typ.IsRegular() {
-			continue
-		}
-		if err := fn(dirName, name, typ); err != nil {
-			if err == ErrSkipFiles {
-				skipFiles = true
-				continue
-			}
-			return err
-		}
-	}
-}
-
-func parseDirEnt(buf []byte) (consumed int, name string, typ os.FileMode) {
-	// golang.org/issue/37269
-	dirent := &syscall.Dirent{}
-	copy((*[unsafe.Sizeof(syscall.Dirent{})]byte)(unsafe.Pointer(dirent))[:], buf)
-	if v := unsafe.Offsetof(dirent.Reclen) + unsafe.Sizeof(dirent.Reclen); uintptr(len(buf)) < v {
-		panic(fmt.Sprintf("buf size of %d smaller than dirent header size %d", len(buf), v))
-	}
-	if len(buf) < int(dirent.Reclen) {
-		panic(fmt.Sprintf("buf size %d < record length %d", len(buf), dirent.Reclen))
-	}
-	consumed = int(dirent.Reclen)
-	if direntInode(dirent) == 0 { // File absent in directory.
-		return
-	}
-	switch dirent.Type {
-	case syscall.DT_REG:
-		typ = 0
-	case syscall.DT_DIR:
-		typ = os.ModeDir
-	case syscall.DT_LNK:
-		typ = os.ModeSymlink
-	case syscall.DT_BLK:
-		typ = os.ModeDevice
-	case syscall.DT_FIFO:
-		typ = os.ModeNamedPipe
-	case syscall.DT_SOCK:
-		typ = os.ModeSocket
-	case syscall.DT_UNKNOWN:
-		typ = unknownFileMode
-	default:
-		// Skip weird things.
-		// It's probably a DT_WHT (http://lwn.net/Articles/325369/)
-		// or something. Revisit if/when this package is moved outside
-		// of goimports. goimports only cares about regular files,
-		// symlinks, and directories.
-		return
-	}
-
-	nameBuf := (*[unsafe.Sizeof(dirent.Name)]byte)(unsafe.Pointer(&dirent.Name[0]))
-	nameLen := direntNamlen(dirent)
-
-	// Special cases for common things:
-	if nameLen == 1 && nameBuf[0] == '.' {
-		name = "."
-	} else if nameLen == 2 && nameBuf[0] == '.' && nameBuf[1] == '.' {
-		name = ".."
-	} else {
-		name = string(nameBuf[:nameLen])
-	}
-	return
-}
-
-// According to https://golang.org/doc/go1.14#runtime
-// A consequence of the implementation of preemption is that on Unix systems, including Linux and macOS
-// systems, programs built with Go 1.14 will receive more signals than programs built with earlier releases.
-//
-// This causes syscall.Open and syscall.ReadDirent sometimes fail with EINTR errors.
-// We need to retry in this case.
-func open(path string, mode int, perm uint32) (fd int, err error) {
-	for {
-		fd, err := syscall.Open(path, mode, perm)
-		if err != syscall.EINTR {
-			return fd, err
-		}
-	}
-}
-
-func readDirent(fd int, buf []byte) (n int, err error) {
-	for {
-		nbuf, err := syscall.ReadDirent(fd, buf)
-		if err != syscall.EINTR {
-			return nbuf, err
-		}
-	}
-}
diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go
index 3c0afe723..f7de3c828 100644
--- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go
+++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go
@@ -13,6 +13,7 @@ import (
 	"io"
 	"log"
 	"os"
+	"os/exec"
 	"reflect"
 	"regexp"
 	"runtime"
@@ -21,9 +22,10 @@ import (
 	"sync"
 	"time"
 
-	exec "golang.org/x/sys/execabs"
-
 	"golang.org/x/tools/internal/event"
+	"golang.org/x/tools/internal/event/keys"
+	"golang.org/x/tools/internal/event/label"
+	"golang.org/x/tools/internal/event/tag"
 )
 
 // An Runner will run go command invocations and serialize
@@ -53,9 +55,19 @@ func (runner *Runner) initialize() {
 // 1.14: go: updating go.mod: existing contents have changed since last read
 var modConcurrencyError = regexp.MustCompile(`go:.*go.mod.*contents have changed`)
 
+// verb is an event label for the go command verb.
+var verb = keys.NewString("verb", "go command verb")
+
+func invLabels(inv Invocation) []label.Label {
+	return []label.Label{verb.Of(inv.Verb), tag.Directory.Of(inv.WorkingDir)}
+}
+
 // Run is a convenience wrapper around RunRaw.
 // It returns only stdout and a "friendly" error.
 func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, error) {
+	ctx, done := event.Start(ctx, "gocommand.Runner.Run", invLabels(inv)...)
+	defer done()
+
 	stdout, _, friendly, _ := runner.RunRaw(ctx, inv)
 	return stdout, friendly
 }
@@ -63,13 +75,19 @@ func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, e
 // RunPiped runs the invocation serially, always waiting for any concurrent
 // invocations to complete first.
 func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) error {
+	ctx, done := event.Start(ctx, "gocommand.Runner.RunPiped", invLabels(inv)...)
+	defer done()
+
 	_, err := runner.runPiped(ctx, inv, stdout, stderr)
 	return err
 }
 
 // RunRaw runs the invocation, serializing requests only if they fight over
 // go.mod changes.
+// Postcondition: both error results have same nilness.
 func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) {
+	ctx, done := event.Start(ctx, "gocommand.Runner.RunRaw", invLabels(inv)...)
+	defer done()
 	// Make sure the runner is always initialized.
 	runner.initialize()
 
@@ -77,23 +95,24 @@ func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer
 	stdout, stderr, friendlyErr, err := runner.runConcurrent(ctx, inv)
 
 	// If we encounter a load concurrency error, we need to retry serially.
-	if friendlyErr == nil || !modConcurrencyError.MatchString(friendlyErr.Error()) {
-		return stdout, stderr, friendlyErr, err
+	if friendlyErr != nil && modConcurrencyError.MatchString(friendlyErr.Error()) {
+		event.Error(ctx, "Load concurrency error, will retry serially", err)
+
+		// Run serially by calling runPiped.
+		stdout.Reset()
+		stderr.Reset()
+		friendlyErr, err = runner.runPiped(ctx, inv, stdout, stderr)
 	}
-	event.Error(ctx, "Load concurrency error, will retry serially", err)
 
-	// Run serially by calling runPiped.
-	stdout.Reset()
-	stderr.Reset()
-	friendlyErr, err = runner.runPiped(ctx, inv, stdout, stderr)
 	return stdout, stderr, friendlyErr, err
 }
 
+// Postcondition: both error results have same nilness.
 func (runner *Runner) runConcurrent(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) {
 	// Wait for 1 worker to become available.
 	select {
 	case <-ctx.Done():
-		return nil, nil, nil, ctx.Err()
+		return nil, nil, ctx.Err(), ctx.Err()
 	case runner.inFlight <- struct{}{}:
 		defer func() { <-runner.inFlight }()
 	}
@@ -103,6 +122,7 @@ func (runner *Runner) runConcurrent(ctx context.Context, inv Invocation) (*bytes
 	return stdout, stderr, friendlyErr, err
 }
 
+// Postcondition: both error results have same nilness.
 func (runner *Runner) runPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) (error, error) {
 	// Make sure the runner is always initialized.
 	runner.initialize()
@@ -111,7 +131,7 @@ func (runner *Runner) runPiped(ctx context.Context, inv Invocation, stdout, stde
 	// runPiped commands.
 	select {
 	case <-ctx.Done():
-		return nil, ctx.Err()
+		return ctx.Err(), ctx.Err()
 	case runner.serialized <- struct{}{}:
 		defer func() { <-runner.serialized }()
 	}
@@ -121,7 +141,7 @@ func (runner *Runner) runPiped(ctx context.Context, inv Invocation, stdout, stde
 	for i := 0; i < maxInFlight; i++ {
 		select {
 		case <-ctx.Done():
-			return nil, ctx.Err()
+			return ctx.Err(), ctx.Err()
 		case runner.inFlight <- struct{}{}:
 			// Make sure we always "return" any workers we took.
 			defer func() { <-runner.inFlight }()
@@ -138,12 +158,15 @@ type Invocation struct {
 	BuildFlags []string
 
 	// If ModFlag is set, the go command is invoked with -mod=ModFlag.
+	// TODO(rfindley): remove, in favor of Args.
 	ModFlag string
 
 	// If ModFile is set, the go command is invoked with -modfile=ModFile.
+	// TODO(rfindley): remove, in favor of Args.
 	ModFile string
 
 	// If Overlay is set, the go command is invoked with -overlay=Overlay.
+	// TODO(rfindley): remove, in favor of Args.
 	Overlay string
 
 	// If CleanEnv is set, the invocation will run only with the environment
@@ -154,6 +177,7 @@ type Invocation struct {
 	Logf       func(format string, args ...interface{})
 }
 
+// Postcondition: both error results have same nilness.
 func (i *Invocation) runWithFriendlyError(ctx context.Context, stdout, stderr io.Writer) (friendlyError error, rawError error) {
 	rawError = i.run(ctx, stdout, stderr)
 	if rawError != nil {
@@ -301,7 +325,7 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) (err error) {
 					// Per https://pkg.go.dev/os#File.Close, the call to stdoutR.Close
 					// should cause the Read call in io.Copy to unblock and return
 					// immediately, but we still need to receive from stdoutErr to confirm
-					// that that has happened.
+					// that it has happened.
 					<-stdoutErr
 					err2 = ctx.Err()
 				}
@@ -315,7 +339,7 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) (err error) {
 			// one goroutine at a time will call Write.�
 			//
 			// Since we're starting a goroutine that writes to cmd.Stdout, we must
-			// also update cmd.Stderr so that that still holds.
+			// also update cmd.Stderr so that it still holds.
 			func() {
 				defer func() { recover() }()
 				if cmd.Stderr == prevStdout {
diff --git a/vendor/golang.org/x/tools/internal/gopathwalk/walk.go b/vendor/golang.org/x/tools/internal/gopathwalk/walk.go
index 168405322..836151551 100644
--- a/vendor/golang.org/x/tools/internal/gopathwalk/walk.go
+++ b/vendor/golang.org/x/tools/internal/gopathwalk/walk.go
@@ -9,23 +9,27 @@ package gopathwalk
 import (
 	"bufio"
 	"bytes"
-	"fmt"
-	"io/ioutil"
-	"log"
+	"io"
+	"io/fs"
 	"os"
 	"path/filepath"
+	"runtime"
 	"strings"
+	"sync"
 	"time"
-
-	"golang.org/x/tools/internal/fastwalk"
 )
 
 // Options controls the behavior of a Walk call.
 type Options struct {
 	// If Logf is non-nil, debug logging is enabled through this function.
 	Logf func(format string, args ...interface{})
+
 	// Search module caches. Also disables legacy goimports ignore rules.
 	ModulesEnabled bool
+
+	// Maximum number of concurrent calls to user-provided callbacks,
+	// or 0 for GOMAXPROCS.
+	Concurrency int
 }
 
 // RootType indicates the type of a Root.
@@ -46,22 +50,28 @@ type Root struct {
 	Type RootType
 }
 
-// Walk walks Go source directories ($GOROOT, $GOPATH, etc) to find packages.
-// For each package found, add will be called (concurrently) with the absolute
+// Walk concurrently walks Go source directories ($GOROOT, $GOPATH, etc) to find packages.
+//
+// For each package found, add will be called with the absolute
 // paths of the containing source directory and the package directory.
-// add will be called concurrently.
+//
+// Unlike filepath.WalkDir, Walk follows symbolic links
+// (while guarding against cycles).
 func Walk(roots []Root, add func(root Root, dir string), opts Options) {
 	WalkSkip(roots, add, func(Root, string) bool { return false }, opts)
 }
 
-// WalkSkip walks Go source directories ($GOROOT, $GOPATH, etc) to find packages.
-// For each package found, add will be called (concurrently) with the absolute
+// WalkSkip concurrently walks Go source directories ($GOROOT, $GOPATH, etc) to
+// find packages.
+//
+// For each package found, add will be called with the absolute
 // paths of the containing source directory and the package directory.
-// For each directory that will be scanned, skip will be called (concurrently)
+// For each directory that will be scanned, skip will be called
 // with the absolute paths of the containing source directory and the directory.
 // If skip returns false on a directory it will be processed.
-// add will be called concurrently.
-// skip will be called concurrently.
+//
+// Unlike filepath.WalkDir, WalkSkip follows symbolic links
+// (while guarding against cycles).
 func WalkSkip(roots []Root, add func(root Root, dir string), skip func(root Root, dir string) bool, opts Options) {
 	for _, root := range roots {
 		walkDir(root, add, skip, opts)
@@ -70,30 +80,51 @@ func WalkSkip(roots []Root, add func(root Root, dir string), skip func(root Root
 
 // walkDir creates a walker and starts fastwalk with this walker.
 func walkDir(root Root, add func(Root, string), skip func(root Root, dir string) bool, opts Options) {
+	if opts.Logf == nil {
+		opts.Logf = func(format string, args ...interface{}) {}
+	}
 	if _, err := os.Stat(root.Path); os.IsNotExist(err) {
-		if opts.Logf != nil {
-			opts.Logf("skipping nonexistent directory: %v", root.Path)
-		}
+		opts.Logf("skipping nonexistent directory: %v", root.Path)
 		return
 	}
 	start := time.Now()
-	if opts.Logf != nil {
-		opts.Logf("gopathwalk: scanning %s", root.Path)
+	opts.Logf("scanning %s", root.Path)
+
+	concurrency := opts.Concurrency
+	if concurrency == 0 {
+		// The walk be either CPU-bound or I/O-bound, depending on what the
+		// caller-supplied add function does and the details of the user's platform
+		// and machine. Rather than trying to fine-tune the concurrency level for a
+		// specific environment, we default to GOMAXPROCS: it is likely to be a good
+		// choice for a CPU-bound add function, and if it is instead I/O-bound, then
+		// dealing with I/O saturation is arguably the job of the kernel and/or
+		// runtime. (Oversaturating I/O seems unlikely to harm performance as badly
+		// as failing to saturate would.)
+		concurrency = runtime.GOMAXPROCS(0)
 	}
 	w := &walker{
 		root: root,
 		add:  add,
 		skip: skip,
 		opts: opts,
+		sem:  make(chan struct{}, concurrency),
 	}
 	w.init()
-	if err := fastwalk.Walk(root.Path, w.walk); err != nil {
-		log.Printf("gopathwalk: scanning directory %v: %v", root.Path, err)
-	}
 
-	if opts.Logf != nil {
-		opts.Logf("gopathwalk: scanned %s in %v", root.Path, time.Since(start))
+	w.sem <- struct{}{}
+	path := root.Path
+	if path == "" {
+		path = "."
+	}
+	if fi, err := os.Lstat(path); err == nil {
+		w.walk(path, nil, fs.FileInfoToDirEntry(fi))
+	} else {
+		w.opts.Logf("scanning directory %v: %v", root.Path, err)
 	}
+	<-w.sem
+	w.walking.Wait()
+
+	opts.Logf("scanned %s in %v", root.Path, time.Since(start))
 }
 
 // walker is the callback for fastwalk.Walk.
@@ -103,7 +134,18 @@ type walker struct {
 	skip func(Root, string) bool // The callback that will be invoked for every dir. dir is skipped if it returns true.
 	opts Options                 // Options passed to Walk by the user.
 
-	ignoredDirs []os.FileInfo // The ignored directories, loaded from .goimportsignore files.
+	walking     sync.WaitGroup
+	sem         chan struct{} // Channel of semaphore tokens; send to acquire, receive to release.
+	ignoredDirs []string
+
+	added sync.Map // map[string]bool
+}
+
+// A symlinkList is a linked list of os.FileInfos for parent directories
+// reached via symlinks.
+type symlinkList struct {
+	info os.FileInfo
+	prev *symlinkList
 }
 
 // init initializes the walker based on its Options
@@ -119,14 +161,8 @@ func (w *walker) init() {
 
 	for _, p := range ignoredPaths {
 		full := filepath.Join(w.root.Path, p)
-		if fi, err := os.Stat(full); err == nil {
-			w.ignoredDirs = append(w.ignoredDirs, fi)
-			if w.opts.Logf != nil {
-				w.opts.Logf("Directory added to ignore list: %s", full)
-			}
-		} else if w.opts.Logf != nil {
-			w.opts.Logf("Error statting ignored directory: %v", err)
-		}
+		w.ignoredDirs = append(w.ignoredDirs, full)
+		w.opts.Logf("Directory added to ignore list: %s", full)
 	}
 }
 
@@ -135,13 +171,11 @@ func (w *walker) init() {
 // The provided path is one of the $GOPATH entries with "src" appended.
 func (w *walker) getIgnoredDirs(path string) []string {
 	file := filepath.Join(path, ".goimportsignore")
-	slurp, err := ioutil.ReadFile(file)
-	if w.opts.Logf != nil {
-		if err != nil {
-			w.opts.Logf("%v", err)
-		} else {
-			w.opts.Logf("Read %s", file)
-		}
+	slurp, err := os.ReadFile(file)
+	if err != nil {
+		w.opts.Logf("%v", err)
+	} else {
+		w.opts.Logf("Read %s", file)
 	}
 	if err != nil {
 		return nil
@@ -160,9 +194,9 @@ func (w *walker) getIgnoredDirs(path string) []string {
 }
 
 // shouldSkipDir reports whether the file should be skipped or not.
-func (w *walker) shouldSkipDir(fi os.FileInfo, dir string) bool {
+func (w *walker) shouldSkipDir(dir string) bool {
 	for _, ignoredDir := range w.ignoredDirs {
-		if os.SameFile(fi, ignoredDir) {
+		if dir == ignoredDir {
 			return true
 		}
 	}
@@ -174,81 +208,130 @@ func (w *walker) shouldSkipDir(fi os.FileInfo, dir string) bool {
 }
 
 // walk walks through the given path.
-func (w *walker) walk(path string, typ os.FileMode) error {
-	if typ.IsRegular() {
-		dir := filepath.Dir(path)
-		if dir == w.root.Path && (w.root.Type == RootGOROOT || w.root.Type == RootGOPATH) {
-			// Doesn't make sense to have regular files
-			// directly in your $GOPATH/src or $GOROOT/src.
-			return fastwalk.ErrSkipFiles
-		}
-		if !strings.HasSuffix(path, ".go") {
-			return nil
+//
+// Errors are logged if w.opts.Logf is non-nil, but otherwise ignored.
+func (w *walker) walk(path string, pathSymlinks *symlinkList, d fs.DirEntry) {
+	if d.Type()&os.ModeSymlink != 0 {
+		// Walk the symlink's target rather than the symlink itself.
+		//
+		// (Note that os.Stat, unlike the lower-lever os.Readlink,
+		// follows arbitrarily many layers of symlinks, so it will eventually
+		// reach either a non-symlink or a nonexistent target.)
+		//
+		// TODO(bcmills): 'go list all' itself ignores symlinks within GOROOT/src
+		// and GOPATH/src. Do we really need to traverse them here? If so, why?
+
+		fi, err := os.Stat(path)
+		if err != nil {
+			w.opts.Logf("%v", err)
+			return
 		}
 
-		w.add(w.root, dir)
-		return fastwalk.ErrSkipFiles
-	}
-	if typ == os.ModeDir {
-		base := filepath.Base(path)
-		if base == "" || base[0] == '.' || base[0] == '_' ||
-			base == "testdata" ||
-			(w.root.Type == RootGOROOT && w.opts.ModulesEnabled && base == "vendor") ||
-			(!w.opts.ModulesEnabled && base == "node_modules") {
-			return filepath.SkipDir
+		// Avoid walking symlink cycles: if we have already followed a symlink to
+		// this directory as a parent of itself, don't follow it again.
+		//
+		// This doesn't catch the first time through a cycle, but it also minimizes
+		// the number of extra stat calls we make if we *don't* encounter a cycle.
+		// Since we don't actually expect to encounter symlink cycles in practice,
+		// this seems like the right tradeoff.
+		for parent := pathSymlinks; parent != nil; parent = parent.prev {
+			if os.SameFile(fi, parent.info) {
+				return
+			}
 		}
-		fi, err := os.Lstat(path)
-		if err == nil && w.shouldSkipDir(fi, path) {
-			return filepath.SkipDir
+
+		pathSymlinks = &symlinkList{
+			info: fi,
+			prev: pathSymlinks,
 		}
-		return nil
+		d = fs.FileInfoToDirEntry(fi)
 	}
-	if typ == os.ModeSymlink {
-		base := filepath.Base(path)
-		if strings.HasPrefix(base, ".#") {
-			// Emacs noise.
-			return nil
+
+	if d.Type().IsRegular() {
+		if !strings.HasSuffix(path, ".go") {
+			return
 		}
-		if w.shouldTraverse(path) {
-			return fastwalk.ErrTraverseLink
+
+		dir := filepath.Dir(path)
+		if dir == w.root.Path && (w.root.Type == RootGOROOT || w.root.Type == RootGOPATH) {
+			// Doesn't make sense to have regular files
+			// directly in your $GOPATH/src or $GOROOT/src.
+			//
+			// TODO(bcmills): there are many levels of directory within
+			// RootModuleCache where this also wouldn't make sense,
+			// Can we generalize this to any directory without a corresponding
+			// import path?
+			return
+		}
+
+		if _, dup := w.added.LoadOrStore(dir, true); !dup {
+			w.add(w.root, dir)
 		}
 	}
-	return nil
-}
 
-// shouldTraverse reports whether the symlink fi, found in dir,
-// should be followed.  It makes sure symlinks were never visited
-// before to avoid symlink loops.
-func (w *walker) shouldTraverse(path string) bool {
-	ts, err := os.Stat(path)
-	if err != nil {
-		fmt.Fprintln(os.Stderr, err)
-		return false
+	if !d.IsDir() {
+		return
 	}
-	if !ts.IsDir() {
-		return false
+
+	base := filepath.Base(path)
+	if base == "" || base[0] == '.' || base[0] == '_' ||
+		base == "testdata" ||
+		(w.root.Type == RootGOROOT && w.opts.ModulesEnabled && base == "vendor") ||
+		(!w.opts.ModulesEnabled && base == "node_modules") ||
+		w.shouldSkipDir(path) {
+		return
 	}
-	if w.shouldSkipDir(ts, filepath.Dir(path)) {
-		return false
+
+	// Read the directory and walk its entries.
+
+	f, err := os.Open(path)
+	if err != nil {
+		w.opts.Logf("%v", err)
+		return
 	}
-	// Check for symlink loops by statting each directory component
-	// and seeing if any are the same file as ts.
+	defer f.Close()
+
 	for {
-		parent := filepath.Dir(path)
-		if parent == path {
-			// Made it to the root without seeing a cycle.
-			// Use this symlink.
-			return true
-		}
-		parentInfo, err := os.Stat(parent)
+		// We impose an arbitrary limit on the number of ReadDir results per
+		// directory to limit the amount of memory consumed for stale or upcoming
+		// directory entries. The limit trades off CPU (number of syscalls to read
+		// the whole directory) against RAM (reachable directory entries other than
+		// the one currently being processed).
+		//
+		// Since we process the directories recursively, we will end up maintaining
+		// a slice of entries for each level of the directory tree.
+		// (Compare https://go.dev/issue/36197.)
+		ents, err := f.ReadDir(1024)
 		if err != nil {
-			return false
+			if err != io.EOF {
+				w.opts.Logf("%v", err)
+			}
+			break
 		}
-		if os.SameFile(ts, parentInfo) {
-			// Cycle. Don't traverse.
-			return false
+
+		for _, d := range ents {
+			nextPath := filepath.Join(path, d.Name())
+			if d.IsDir() {
+				select {
+				case w.sem <- struct{}{}:
+					// Got a new semaphore token, so we can traverse the directory concurrently.
+					d := d
+					w.walking.Add(1)
+					go func() {
+						defer func() {
+							<-w.sem
+							w.walking.Done()
+						}()
+						w.walk(nextPath, pathSymlinks, d)
+					}()
+					continue
+
+				default:
+					// No tokens available, so traverse serially.
+				}
+			}
+
+			w.walk(nextPath, pathSymlinks, d)
 		}
-		path = parent
 	}
-
 }
diff --git a/vendor/golang.org/x/tools/internal/imports/fix.go b/vendor/golang.org/x/tools/internal/imports/fix.go
index 6b4935257..559803276 100644
--- a/vendor/golang.org/x/tools/internal/imports/fix.go
+++ b/vendor/golang.org/x/tools/internal/imports/fix.go
@@ -13,6 +13,8 @@ import (
 	"go/build"
 	"go/parser"
 	"go/token"
+	"go/types"
+	"io/fs"
 	"io/ioutil"
 	"os"
 	"path"
@@ -26,8 +28,10 @@ import (
 	"unicode/utf8"
 
 	"golang.org/x/tools/go/ast/astutil"
+	"golang.org/x/tools/internal/event"
 	"golang.org/x/tools/internal/gocommand"
 	"golang.org/x/tools/internal/gopathwalk"
+	"golang.org/x/tools/internal/stdlib"
 )
 
 // importToGroup is a list of functions which map from an import path to
@@ -106,7 +110,7 @@ func parseOtherFiles(fset *token.FileSet, srcDir, filename string) []*ast.File {
 	considerTests := strings.HasSuffix(filename, "_test.go")
 
 	fileBase := filepath.Base(filename)
-	packageFileInfos, err := ioutil.ReadDir(srcDir)
+	packageFileInfos, err := os.ReadDir(srcDir)
 	if err != nil {
 		return nil
 	}
@@ -252,7 +256,7 @@ type pass struct {
 	otherFiles           []*ast.File    // sibling files.
 
 	// Intermediate state, generated by load.
-	existingImports map[string]*ImportInfo
+	existingImports map[string][]*ImportInfo
 	allRefs         references
 	missingRefs     references
 
@@ -317,7 +321,7 @@ func (p *pass) importIdentifier(imp *ImportInfo) string {
 func (p *pass) load() ([]*ImportFix, bool) {
 	p.knownPackages = map[string]*packageInfo{}
 	p.missingRefs = references{}
-	p.existingImports = map[string]*ImportInfo{}
+	p.existingImports = map[string][]*ImportInfo{}
 
 	// Load basic information about the file in question.
 	p.allRefs = collectReferences(p.f)
@@ -348,7 +352,7 @@ func (p *pass) load() ([]*ImportFix, bool) {
 		}
 	}
 	for _, imp := range imports {
-		p.existingImports[p.importIdentifier(imp)] = imp
+		p.existingImports[p.importIdentifier(imp)] = append(p.existingImports[p.importIdentifier(imp)], imp)
 	}
 
 	// Find missing references.
@@ -387,31 +391,33 @@ func (p *pass) fix() ([]*ImportFix, bool) {
 
 	// Found everything, or giving up. Add the new imports and remove any unused.
 	var fixes []*ImportFix
-	for _, imp := range p.existingImports {
-		// We deliberately ignore globals here, because we can't be sure
-		// they're in the same package. People do things like put multiple
-		// main packages in the same directory, and we don't want to
-		// remove imports if they happen to have the same name as a var in
-		// a different package.
-		if _, ok := p.allRefs[p.importIdentifier(imp)]; !ok {
-			fixes = append(fixes, &ImportFix{
-				StmtInfo:  *imp,
-				IdentName: p.importIdentifier(imp),
-				FixType:   DeleteImport,
-			})
-			continue
-		}
+	for _, identifierImports := range p.existingImports {
+		for _, imp := range identifierImports {
+			// We deliberately ignore globals here, because we can't be sure
+			// they're in the same package. People do things like put multiple
+			// main packages in the same directory, and we don't want to
+			// remove imports if they happen to have the same name as a var in
+			// a different package.
+			if _, ok := p.allRefs[p.importIdentifier(imp)]; !ok {
+				fixes = append(fixes, &ImportFix{
+					StmtInfo:  *imp,
+					IdentName: p.importIdentifier(imp),
+					FixType:   DeleteImport,
+				})
+				continue
+			}
 
-		// An existing import may need to update its import name to be correct.
-		if name := p.importSpecName(imp); name != imp.Name {
-			fixes = append(fixes, &ImportFix{
-				StmtInfo: ImportInfo{
-					Name:       name,
-					ImportPath: imp.ImportPath,
-				},
-				IdentName: p.importIdentifier(imp),
-				FixType:   SetImportName,
-			})
+			// An existing import may need to update its import name to be correct.
+			if name := p.importSpecName(imp); name != imp.Name {
+				fixes = append(fixes, &ImportFix{
+					StmtInfo: ImportInfo{
+						Name:       name,
+						ImportPath: imp.ImportPath,
+					},
+					IdentName: p.importIdentifier(imp),
+					FixType:   SetImportName,
+				})
+			}
 		}
 	}
 	// Collecting fixes involved map iteration, so sort for stability. See
@@ -506,9 +512,9 @@ func (p *pass) assumeSiblingImportsValid() {
 		}
 		for left, rights := range refs {
 			if imp, ok := importsByName[left]; ok {
-				if m, ok := stdlib[imp.ImportPath]; ok {
+				if m, ok := stdlib.PackageSymbols[imp.ImportPath]; ok {
 					// We have the stdlib in memory; no need to guess.
-					rights = copyExports(m)
+					rights = symbolNameSet(m)
 				}
 				p.addCandidate(imp, &packageInfo{
 					// no name; we already know it.
@@ -543,7 +549,7 @@ func (p *pass) addCandidate(imp *ImportInfo, pkg *packageInfo) {
 var fixImports = fixImportsDefault
 
 func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) error {
-	fixes, err := getFixes(fset, f, filename, env)
+	fixes, err := getFixes(context.Background(), fset, f, filename, env)
 	if err != nil {
 		return err
 	}
@@ -553,7 +559,7 @@ func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *P
 
 // getFixes gets the import fixes that need to be made to f in order to fix the imports.
 // It does not modify the ast.
-func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) {
+func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) {
 	abs, err := filepath.Abs(filename)
 	if err != nil {
 		return nil, err
@@ -607,7 +613,7 @@ func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv
 
 	// Go look for candidates in $GOPATH, etc. We don't necessarily load
 	// the real exports of sibling imports, so keep assuming their contents.
-	if err := addExternalCandidates(p, p.missingRefs, filename); err != nil {
+	if err := addExternalCandidates(ctx, p, p.missingRefs, filename); err != nil {
 		return nil, err
 	}
 
@@ -636,7 +642,7 @@ func getCandidatePkgs(ctx context.Context, wrappedCallback *scanCallback, filena
 	dupCheck := map[string]struct{}{}
 
 	// Start off with the standard library.
-	for importPath, exports := range stdlib {
+	for importPath, symbols := range stdlib.PackageSymbols {
 		p := &pkg{
 			dir:             filepath.Join(goenv["GOROOT"], "src", importPath),
 			importPathShort: importPath,
@@ -645,6 +651,13 @@ func getCandidatePkgs(ctx context.Context, wrappedCallback *scanCallback, filena
 		}
 		dupCheck[importPath] = struct{}{}
 		if notSelf(p) && wrappedCallback.dirFound(p) && wrappedCallback.packageNameLoaded(p) {
+			var exports []stdlib.Symbol
+			for _, sym := range symbols {
+				switch sym.Kind {
+				case stdlib.Func, stdlib.Type, stdlib.Var, stdlib.Const:
+					exports = append(exports, sym)
+				}
+			}
 			wrappedCallback.exportsLoaded(p, exports)
 		}
 	}
@@ -665,7 +678,7 @@ func getCandidatePkgs(ctx context.Context, wrappedCallback *scanCallback, filena
 			dupCheck[pkg.importPathShort] = struct{}{}
 			return notSelf(pkg) && wrappedCallback.packageNameLoaded(pkg)
 		},
-		exportsLoaded: func(pkg *pkg, exports []string) {
+		exportsLoaded: func(pkg *pkg, exports []stdlib.Symbol) {
 			// If we're an x_test, load the package under test's test variant.
 			if strings.HasSuffix(filePkg, "_test") && pkg.dir == filepath.Dir(filename) {
 				var err error
@@ -696,20 +709,21 @@ func ScoreImportPaths(ctx context.Context, env *ProcessEnv, paths []string) (map
 	return result, nil
 }
 
-func PrimeCache(ctx context.Context, env *ProcessEnv) error {
+func PrimeCache(ctx context.Context, resolver Resolver) error {
 	// Fully scan the disk for directories, but don't actually read any Go files.
 	callback := &scanCallback{
-		rootFound: func(gopathwalk.Root) bool {
-			return true
+		rootFound: func(root gopathwalk.Root) bool {
+			// See getCandidatePkgs: walking GOROOT is apparently expensive and
+			// unnecessary.
+			return root.Type != gopathwalk.RootGOROOT
 		},
 		dirFound: func(pkg *pkg) bool {
 			return false
 		},
-		packageNameLoaded: func(pkg *pkg) bool {
-			return false
-		},
+		// packageNameLoaded and exportsLoaded must never be called.
 	}
-	return getCandidatePkgs(ctx, callback, "", "", env)
+
+	return resolver.scan(ctx, callback)
 }
 
 func candidateImportName(pkg *pkg) string {
@@ -789,7 +803,7 @@ func GetImportPaths(ctx context.Context, wrapped func(ImportFix), searchPrefix,
 // A PackageExport is a package and its exports.
 type PackageExport struct {
 	Fix     *ImportFix
-	Exports []string
+	Exports []stdlib.Symbol
 }
 
 // GetPackageExports returns all known packages with name pkg and their exports.
@@ -804,8 +818,8 @@ func GetPackageExports(ctx context.Context, wrapped func(PackageExport), searchP
 		packageNameLoaded: func(pkg *pkg) bool {
 			return pkg.packageName == searchPkg
 		},
-		exportsLoaded: func(pkg *pkg, exports []string) {
-			sort.Strings(exports)
+		exportsLoaded: func(pkg *pkg, exports []stdlib.Symbol) {
+			sortSymbols(exports)
 			wrapped(PackageExport{
 				Fix: &ImportFix{
 					StmtInfo: ImportInfo{
@@ -823,16 +837,45 @@ func GetPackageExports(ctx context.Context, wrapped func(PackageExport), searchP
 	return getCandidatePkgs(ctx, callback, filename, filePkg, env)
 }
 
-var requiredGoEnvVars = []string{"GO111MODULE", "GOFLAGS", "GOINSECURE", "GOMOD", "GOMODCACHE", "GONOPROXY", "GONOSUMDB", "GOPATH", "GOPROXY", "GOROOT", "GOSUMDB", "GOWORK"}
+// TODO(rfindley): we should depend on GOOS and GOARCH, to provide accurate
+// imports when doing cross-platform development.
+var requiredGoEnvVars = []string{
+	"GO111MODULE",
+	"GOFLAGS",
+	"GOINSECURE",
+	"GOMOD",
+	"GOMODCACHE",
+	"GONOPROXY",
+	"GONOSUMDB",
+	"GOPATH",
+	"GOPROXY",
+	"GOROOT",
+	"GOSUMDB",
+	"GOWORK",
+}
 
 // ProcessEnv contains environment variables and settings that affect the use of
 // the go command, the go/build package, etc.
+//
+// ...a ProcessEnv *also* overwrites its Env along with derived state in the
+// form of the resolver. And because it is lazily initialized, an env may just
+// be broken and unusable, but there is no way for the caller to detect that:
+// all queries will just fail.
+//
+// TODO(rfindley): refactor this package so that this type (perhaps renamed to
+// just Env or Config) is an immutable configuration struct, to be exchanged
+// for an initialized object via a constructor that returns an error. Perhaps
+// the signature should be `func NewResolver(*Env) (*Resolver, error)`, where
+// resolver is a concrete type used for resolving imports. Via this
+// refactoring, we can avoid the need to call ProcessEnv.init and
+// ProcessEnv.GoEnv everywhere, and implicitly fix all the places where this
+// these are misused. Also, we'd delegate the caller the decision of how to
+// handle a broken environment.
 type ProcessEnv struct {
 	GocmdRunner *gocommand.Runner
 
 	BuildFlags []string
 	ModFlag    string
-	ModFile    string
 
 	// SkipPathInScan returns true if the path should be skipped from scans of
 	// the RootCurrentModule root type. The function argument is a clean,
@@ -842,7 +885,7 @@ type ProcessEnv struct {
 	// Env overrides the OS environment, and can be used to specify
 	// GOPROXY, GO111MODULE, etc. PATH cannot be set here, because
 	// exec.Command will not honor it.
-	// Specifying all of RequiredGoEnvVars avoids a call to `go env`.
+	// Specifying all of requiredGoEnvVars avoids a call to `go env`.
 	Env map[string]string
 
 	WorkingDir string
@@ -850,9 +893,17 @@ type ProcessEnv struct {
 	// If Logf is non-nil, debug logging is enabled through this function.
 	Logf func(format string, args ...interface{})
 
-	initialized bool
+	// If set, ModCache holds a shared cache of directory info to use across
+	// multiple ProcessEnvs.
+	ModCache *DirInfoCache
+
+	initialized bool // see TODO above
 
-	resolver Resolver
+	// resolver and resolverErr are lazily evaluated (see GetResolver).
+	// This is unclean, but see the big TODO in the docstring for ProcessEnv
+	// above: for now, we can't be sure that the ProcessEnv is fully initialized.
+	resolver    Resolver
+	resolverErr error
 }
 
 func (e *ProcessEnv) goEnv() (map[string]string, error) {
@@ -932,20 +983,33 @@ func (e *ProcessEnv) env() []string {
 }
 
 func (e *ProcessEnv) GetResolver() (Resolver, error) {
-	if e.resolver != nil {
-		return e.resolver, nil
-	}
 	if err := e.init(); err != nil {
 		return nil, err
 	}
-	if len(e.Env["GOMOD"]) == 0 && len(e.Env["GOWORK"]) == 0 {
-		e.resolver = newGopathResolver(e)
-		return e.resolver, nil
+
+	if e.resolver == nil && e.resolverErr == nil {
+		// TODO(rfindley): we should only use a gopathResolver here if the working
+		// directory is actually *in* GOPATH. (I seem to recall an open gopls issue
+		// for this behavior, but I can't find it).
+		//
+		// For gopls, we can optionally explicitly choose a resolver type, since we
+		// already know the view type.
+		if len(e.Env["GOMOD"]) == 0 && len(e.Env["GOWORK"]) == 0 {
+			e.resolver = newGopathResolver(e)
+		} else if r, err := newModuleResolver(e, e.ModCache); err != nil {
+			e.resolverErr = err
+		} else {
+			e.resolver = Resolver(r)
+		}
 	}
-	e.resolver = newModuleResolver(e)
-	return e.resolver, nil
+
+	return e.resolver, e.resolverErr
 }
 
+// buildContext returns the build.Context to use for matching files.
+//
+// TODO(rfindley): support dynamic GOOS, GOARCH here, when doing cross-platform
+// development.
 func (e *ProcessEnv) buildContext() (*build.Context, error) {
 	ctx := build.Default
 	goenv, err := e.goEnv()
@@ -1000,7 +1064,7 @@ func addStdlibCandidates(pass *pass, refs references) error {
 		if path.Base(pkg) == pass.f.Name.Name && filepath.Join(goenv["GOROOT"], "src", pkg) == pass.srcDir {
 			return
 		}
-		exports := copyExports(stdlib[pkg])
+		exports := symbolNameSet(stdlib.PackageSymbols[pkg])
 		pass.addCandidate(
 			&ImportInfo{ImportPath: pkg},
 			&packageInfo{name: path.Base(pkg), exports: exports})
@@ -1012,7 +1076,7 @@ func addStdlibCandidates(pass *pass, refs references) error {
 			add("math/rand")
 			continue
 		}
-		for importPath := range stdlib {
+		for importPath := range stdlib.PackageSymbols {
 			if path.Base(importPath) == left {
 				add(importPath)
 			}
@@ -1025,15 +1089,23 @@ func addStdlibCandidates(pass *pass, refs references) error {
 type Resolver interface {
 	// loadPackageNames loads the package names in importPaths.
 	loadPackageNames(importPaths []string, srcDir string) (map[string]string, error)
+
 	// scan works with callback to search for packages. See scanCallback for details.
 	scan(ctx context.Context, callback *scanCallback) error
+
 	// loadExports returns the set of exported symbols in the package at dir.
 	// loadExports may be called concurrently.
-	loadExports(ctx context.Context, pkg *pkg, includeTest bool) (string, []string, error)
+	loadExports(ctx context.Context, pkg *pkg, includeTest bool) (string, []stdlib.Symbol, error)
+
 	// scoreImportPath returns the relevance for an import path.
 	scoreImportPath(ctx context.Context, path string) float64
 
-	ClearForNewScan()
+	// ClearForNewScan returns a new Resolver based on the receiver that has
+	// cleared its internal caches of directory contents.
+	//
+	// The new resolver should be primed and then set via
+	// [ProcessEnv.UpdateResolver].
+	ClearForNewScan() Resolver
 }
 
 // A scanCallback controls a call to scan and receives its results.
@@ -1052,10 +1124,13 @@ type scanCallback struct {
 	// If it returns true, the package's exports will be loaded.
 	packageNameLoaded func(pkg *pkg) bool
 	// exportsLoaded is called when a package's exports have been loaded.
-	exportsLoaded func(pkg *pkg, exports []string)
+	exportsLoaded func(pkg *pkg, exports []stdlib.Symbol)
 }
 
-func addExternalCandidates(pass *pass, refs references, filename string) error {
+func addExternalCandidates(ctx context.Context, pass *pass, refs references, filename string) error {
+	ctx, done := event.Start(ctx, "imports.addExternalCandidates")
+	defer done()
+
 	var mu sync.Mutex
 	found := make(map[string][]pkgDistance)
 	callback := &scanCallback{
@@ -1113,7 +1188,7 @@ func addExternalCandidates(pass *pass, refs references, filename string) error {
 		go func(pkgName string, symbols map[string]bool) {
 			defer wg.Done()
 
-			found, err := findImport(ctx, pass, found[pkgName], pkgName, symbols, filename)
+			found, err := findImport(ctx, pass, found[pkgName], pkgName, symbols)
 
 			if err != nil {
 				firstErrOnce.Do(func() {
@@ -1144,6 +1219,17 @@ func addExternalCandidates(pass *pass, refs references, filename string) error {
 	}()
 
 	for result := range results {
+		// Don't offer completions that would shadow predeclared
+		// names, such as github.com/coreos/etcd/error.
+		if types.Universe.Lookup(result.pkg.name) != nil { // predeclared
+			// Ideally we would skip this candidate only
+			// if the predeclared name is actually
+			// referenced by the file, but that's a lot
+			// trickier to compute and would still create
+			// an import that is likely to surprise the
+			// user before long.
+			continue
+		}
 		pass.addCandidate(result.imp, result.pkg)
 	}
 	return firstErr
@@ -1186,31 +1272,22 @@ func ImportPathToAssumedName(importPath string) string {
 type gopathResolver struct {
 	env      *ProcessEnv
 	walked   bool
-	cache    *dirInfoCache
+	cache    *DirInfoCache
 	scanSema chan struct{} // scanSema prevents concurrent scans.
 }
 
 func newGopathResolver(env *ProcessEnv) *gopathResolver {
 	r := &gopathResolver{
-		env: env,
-		cache: &dirInfoCache{
-			dirs:      map[string]*directoryPackageInfo{},
-			listeners: map[*int]cacheListener{},
-		},
+		env:      env,
+		cache:    NewDirInfoCache(),
 		scanSema: make(chan struct{}, 1),
 	}
 	r.scanSema <- struct{}{}
 	return r
 }
 
-func (r *gopathResolver) ClearForNewScan() {
-	<-r.scanSema
-	r.cache = &dirInfoCache{
-		dirs:      map[string]*directoryPackageInfo{},
-		listeners: map[*int]cacheListener{},
-	}
-	r.walked = false
-	r.scanSema <- struct{}{}
+func (r *gopathResolver) ClearForNewScan() Resolver {
+	return newGopathResolver(r.env)
 }
 
 func (r *gopathResolver) loadPackageNames(importPaths []string, srcDir string) (map[string]string, error) {
@@ -1228,7 +1305,7 @@ func (r *gopathResolver) loadPackageNames(importPaths []string, srcDir string) (
 // importPathToName finds out the actual package name, as declared in its .go files.
 func importPathToName(bctx *build.Context, importPath, srcDir string) string {
 	// Fast path for standard library without going to disk.
-	if _, ok := stdlib[importPath]; ok {
+	if stdlib.HasPackage(importPath) {
 		return path.Base(importPath) // stdlib packages always match their paths.
 	}
 
@@ -1426,7 +1503,7 @@ func (r *gopathResolver) scan(ctx context.Context, callback *scanCallback) error
 }
 
 func (r *gopathResolver) scoreImportPath(ctx context.Context, path string) float64 {
-	if _, ok := stdlib[path]; ok {
+	if stdlib.HasPackage(path) {
 		return MaxRelevance
 	}
 	return MaxRelevance - 1
@@ -1443,7 +1520,7 @@ func filterRoots(roots []gopathwalk.Root, include func(gopathwalk.Root) bool) []
 	return result
 }
 
-func (r *gopathResolver) loadExports(ctx context.Context, pkg *pkg, includeTest bool) (string, []string, error) {
+func (r *gopathResolver) loadExports(ctx context.Context, pkg *pkg, includeTest bool) (string, []stdlib.Symbol, error) {
 	if info, ok := r.cache.Load(pkg.dir); ok && !includeTest {
 		return r.cache.CacheExports(ctx, r.env, info)
 	}
@@ -1463,13 +1540,13 @@ func VendorlessPath(ipath string) string {
 	return ipath
 }
 
-func loadExportsFromFiles(ctx context.Context, env *ProcessEnv, dir string, includeTest bool) (string, []string, error) {
+func loadExportsFromFiles(ctx context.Context, env *ProcessEnv, dir string, includeTest bool) (string, []stdlib.Symbol, error) {
 	// Look for non-test, buildable .go files which could provide exports.
-	all, err := ioutil.ReadDir(dir)
+	all, err := os.ReadDir(dir)
 	if err != nil {
 		return "", nil, err
 	}
-	var files []os.FileInfo
+	var files []fs.DirEntry
 	for _, fi := range all {
 		name := fi.Name()
 		if !strings.HasSuffix(name, ".go") || (!includeTest && strings.HasSuffix(name, "_test.go")) {
@@ -1487,7 +1564,7 @@ func loadExportsFromFiles(ctx context.Context, env *ProcessEnv, dir string, incl
 	}
 
 	var pkgName string
-	var exports []string
+	var exports []stdlib.Symbol
 	fset := token.NewFileSet()
 	for _, fi := range files {
 		select {
@@ -1514,24 +1591,44 @@ func loadExportsFromFiles(ctx context.Context, env *ProcessEnv, dir string, incl
 			continue
 		}
 		pkgName = f.Name.Name
-		for name := range f.Scope.Objects {
+		for name, obj := range f.Scope.Objects {
 			if ast.IsExported(name) {
-				exports = append(exports, name)
+				var kind stdlib.Kind
+				switch obj.Kind {
+				case ast.Con:
+					kind = stdlib.Const
+				case ast.Typ:
+					kind = stdlib.Type
+				case ast.Var:
+					kind = stdlib.Var
+				case ast.Fun:
+					kind = stdlib.Func
+				}
+				exports = append(exports, stdlib.Symbol{
+					Name:    name,
+					Kind:    kind,
+					Version: 0, // unknown; be permissive
+				})
 			}
 		}
 	}
+	sortSymbols(exports)
 
 	if env.Logf != nil {
-		sortedExports := append([]string(nil), exports...)
-		sort.Strings(sortedExports)
-		env.Logf("loaded exports in dir %v (package %v): %v", dir, pkgName, strings.Join(sortedExports, ", "))
+		env.Logf("loaded exports in dir %v (package %v): %v", dir, pkgName, exports)
 	}
 	return pkgName, exports, nil
 }
 
+func sortSymbols(syms []stdlib.Symbol) {
+	sort.Slice(syms, func(i, j int) bool {
+		return syms[i].Name < syms[j].Name
+	})
+}
+
 // findImport searches for a package with the given symbols.
 // If no package is found, findImport returns ("", false, nil)
-func findImport(ctx context.Context, pass *pass, candidates []pkgDistance, pkgName string, symbols map[string]bool, filename string) (*pkg, error) {
+func findImport(ctx context.Context, pass *pass, candidates []pkgDistance, pkgName string, symbols map[string]bool) (*pkg, error) {
 	// Sort the candidates by their import package length,
 	// assuming that shorter package names are better than long
 	// ones.  Note that this sorts by the de-vendored name, so
@@ -1595,7 +1692,7 @@ func findImport(ctx context.Context, pass *pass, candidates []pkgDistance, pkgNa
 
 				exportsMap := make(map[string]bool, len(exports))
 				for _, sym := range exports {
-					exportsMap[sym] = true
+					exportsMap[sym.Name] = true
 				}
 
 				// If it doesn't have the right
@@ -1753,10 +1850,13 @@ func (fn visitFn) Visit(node ast.Node) ast.Visitor {
 	return fn(node)
 }
 
-func copyExports(pkg []string) map[string]bool {
-	m := make(map[string]bool, len(pkg))
-	for _, v := range pkg {
-		m[v] = true
+func symbolNameSet(symbols []stdlib.Symbol) map[string]bool {
+	names := make(map[string]bool)
+	for _, sym := range symbols {
+		switch sym.Kind {
+		case stdlib.Const, stdlib.Var, stdlib.Type, stdlib.Func:
+			names[sym.Name] = true
+		}
 	}
-	return m
+	return names
 }
diff --git a/vendor/golang.org/x/tools/internal/imports/imports.go b/vendor/golang.org/x/tools/internal/imports/imports.go
index 95a88383a..f83465520 100644
--- a/vendor/golang.org/x/tools/internal/imports/imports.go
+++ b/vendor/golang.org/x/tools/internal/imports/imports.go
@@ -2,8 +2,6 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:generate go run mkstdlib.go
-
 // Package imports implements a Go pretty-printer (like package "go/format")
 // that also adds or removes import statements as necessary.
 package imports
@@ -11,6 +9,7 @@ package imports
 import (
 	"bufio"
 	"bytes"
+	"context"
 	"fmt"
 	"go/ast"
 	"go/format"
@@ -23,6 +22,7 @@ import (
 	"strings"
 
 	"golang.org/x/tools/go/ast/astutil"
+	"golang.org/x/tools/internal/event"
 )
 
 // Options is golang.org/x/tools/imports.Options with extra internal-only options.
@@ -66,14 +66,17 @@ func Process(filename string, src []byte, opt *Options) (formatted []byte, err e
 //
 // Note that filename's directory influences which imports can be chosen,
 // so it is important that filename be accurate.
-func FixImports(filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) {
+func FixImports(ctx context.Context, filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) {
+	ctx, done := event.Start(ctx, "imports.FixImports")
+	defer done()
+
 	fileSet := token.NewFileSet()
 	file, _, err := parse(fileSet, filename, src, opt)
 	if err != nil {
 		return nil, err
 	}
 
-	return getFixes(fileSet, file, filename, opt.Env)
+	return getFixes(ctx, fileSet, file, filename, opt.Env)
 }
 
 // ApplyFixes applies all of the fixes to the file and formats it. extraMode
@@ -104,7 +107,7 @@ func ApplyFixes(fixes []*ImportFix, filename string, src []byte, opt *Options, e
 }
 
 // formatFile formats the file syntax tree.
-// It may mutate the token.FileSet.
+// It may mutate the token.FileSet and the ast.File.
 //
 // If an adjust function is provided, it is called after formatting
 // with the original source (formatFile's src parameter) and the
@@ -231,7 +234,7 @@ func parse(fset *token.FileSet, filename string, src []byte, opt *Options) (*ast
 			src = src[:len(src)-len("}\n")]
 			// Gofmt has also indented the function body one level.
 			// Remove that indent.
-			src = bytes.Replace(src, []byte("\n\t"), []byte("\n"), -1)
+			src = bytes.ReplaceAll(src, []byte("\n\t"), []byte("\n"))
 			return matchSpace(orig, src)
 		}
 		return file, adjust, nil
diff --git a/vendor/golang.org/x/tools/internal/imports/mod.go b/vendor/golang.org/x/tools/internal/imports/mod.go
index 7d99d04ca..21ef93897 100644
--- a/vendor/golang.org/x/tools/internal/imports/mod.go
+++ b/vendor/golang.org/x/tools/internal/imports/mod.go
@@ -9,7 +9,6 @@ import (
 	"context"
 	"encoding/json"
 	"fmt"
-	"io/ioutil"
 	"os"
 	"path"
 	"path/filepath"
@@ -19,53 +18,94 @@ import (
 	"strings"
 
 	"golang.org/x/mod/module"
+	"golang.org/x/tools/internal/event"
 	"golang.org/x/tools/internal/gocommand"
 	"golang.org/x/tools/internal/gopathwalk"
+	"golang.org/x/tools/internal/stdlib"
 )
 
-// ModuleResolver implements resolver for modules using the go command as little
-// as feasible.
+// Notes(rfindley): ModuleResolver appears to be heavily optimized for scanning
+// as fast as possible, which is desirable for a call to goimports from the
+// command line, but it doesn't work as well for gopls, where it suffers from
+// slow startup (golang/go#44863) and intermittent hanging (golang/go#59216),
+// both caused by populating the cache, albeit in slightly different ways.
+//
+// A high level list of TODOs:
+//  - Optimize the scan itself, as there is some redundancy statting and
+//    reading go.mod files.
+//  - Invert the relationship between ProcessEnv and Resolver (see the
+//    docstring of ProcessEnv).
+//  - Make it easier to use an external resolver implementation.
+//
+// Smaller TODOs are annotated in the code below.
+
+// ModuleResolver implements the Resolver interface for a workspace using
+// modules.
+//
+// A goal of the ModuleResolver is to invoke the Go command as little as
+// possible. To this end, it runs the Go command only for listing module
+// information (i.e. `go list -m -e -json ...`). Package scanning, the process
+// of loading package information for the modules, is implemented internally
+// via the scan method.
+//
+// It has two types of state: the state derived from the go command, which
+// is populated by init, and the state derived from scans, which is populated
+// via scan. A root is considered scanned if it has been walked to discover
+// directories. However, if the scan did not require additional information
+// from the directory (such as package name or exports), the directory
+// information itself may be partially populated. It will be lazily filled in
+// as needed by scans, using the scanCallback.
 type ModuleResolver struct {
-	env            *ProcessEnv
-	moduleCacheDir string
-	dummyVendorMod *gocommand.ModuleJSON // If vendoring is enabled, the pseudo-module that represents the /vendor directory.
-	roots          []gopathwalk.Root
-	scanSema       chan struct{} // scanSema prevents concurrent scans and guards scannedRoots.
-	scannedRoots   map[gopathwalk.Root]bool
-
-	initialized   bool
-	mains         []*gocommand.ModuleJSON
-	mainByDir     map[string]*gocommand.ModuleJSON
-	modsByModPath []*gocommand.ModuleJSON // All modules, ordered by # of path components in module Path...
-	modsByDir     []*gocommand.ModuleJSON // ...or Dir.
-
-	// moduleCacheCache stores information about the module cache.
-	moduleCacheCache *dirInfoCache
-	otherCache       *dirInfoCache
+	env *ProcessEnv
+
+	// Module state, populated during construction
+	dummyVendorMod *gocommand.ModuleJSON            // if vendoring is enabled, a pseudo-module to represent the /vendor directory
+	moduleCacheDir string                           // GOMODCACHE, inferred from GOPATH if unset
+	roots          []gopathwalk.Root                // roots to scan, in approximate order of importance
+	mains          []*gocommand.ModuleJSON          // main modules
+	mainByDir      map[string]*gocommand.ModuleJSON // module information by dir, to join with roots
+	modsByModPath  []*gocommand.ModuleJSON          // all modules, ordered by # of path components in their module path
+	modsByDir      []*gocommand.ModuleJSON          // ...or by the number of path components in their Dir.
+
+	// Scanning state, populated by scan
+
+	// scanSema prevents concurrent scans, and guards scannedRoots and the cache
+	// fields below (though the caches themselves are concurrency safe).
+	// Receive to acquire, send to release.
+	scanSema     chan struct{}
+	scannedRoots map[gopathwalk.Root]bool // if true, root has been walked
+
+	// Caches of directory info, populated by scans and scan callbacks
+	//
+	// moduleCacheCache stores cached information about roots in the module
+	// cache, which are immutable and therefore do not need to be invalidated.
+	//
+	// otherCache stores information about all other roots (even GOROOT), which
+	// may change.
+	moduleCacheCache *DirInfoCache
+	otherCache       *DirInfoCache
 }
 
-func newModuleResolver(e *ProcessEnv) *ModuleResolver {
+// newModuleResolver returns a new module-aware goimports resolver.
+//
+// Note: use caution when modifying this constructor: changes must also be
+// reflected in ModuleResolver.ClearForNewScan.
+func newModuleResolver(e *ProcessEnv, moduleCacheCache *DirInfoCache) (*ModuleResolver, error) {
 	r := &ModuleResolver{
 		env:      e,
 		scanSema: make(chan struct{}, 1),
 	}
-	r.scanSema <- struct{}{}
-	return r
-}
-
-func (r *ModuleResolver) init() error {
-	if r.initialized {
-		return nil
-	}
+	r.scanSema <- struct{}{} // release
 
 	goenv, err := r.env.goEnv()
 	if err != nil {
-		return err
+		return nil, err
 	}
+
+	// TODO(rfindley): can we refactor to share logic with r.env.invokeGo?
 	inv := gocommand.Invocation{
 		BuildFlags: r.env.BuildFlags,
 		ModFlag:    r.env.ModFlag,
-		ModFile:    r.env.ModFile,
 		Env:        r.env.env(),
 		Logf:       r.env.Logf,
 		WorkingDir: r.env.WorkingDir,
@@ -77,9 +117,12 @@ func (r *ModuleResolver) init() error {
 	// Module vendor directories are ignored in workspace mode:
 	// https://go.googlesource.com/proposal/+/master/design/45713-workspace.md
 	if len(r.env.Env["GOWORK"]) == 0 {
+		// TODO(rfindley): VendorEnabled runs the go command to get GOFLAGS, but
+		// they should be available from the ProcessEnv. Can we avoid the redundant
+		// invocation?
 		vendorEnabled, mainModVendor, err = gocommand.VendorEnabled(context.TODO(), inv, r.env.GocmdRunner)
 		if err != nil {
-			return err
+			return nil, err
 		}
 	}
 
@@ -100,19 +143,14 @@ func (r *ModuleResolver) init() error {
 		// GO111MODULE=on. Other errors are fatal.
 		if err != nil {
 			if errMsg := err.Error(); !strings.Contains(errMsg, "working directory is not part of a module") && !strings.Contains(errMsg, "go.mod file not found") {
-				return err
+				return nil, err
 			}
 		}
 	}
 
-	if gmc := r.env.Env["GOMODCACHE"]; gmc != "" {
-		r.moduleCacheDir = gmc
-	} else {
-		gopaths := filepath.SplitList(goenv["GOPATH"])
-		if len(gopaths) == 0 {
-			return fmt.Errorf("empty GOPATH")
-		}
-		r.moduleCacheDir = filepath.Join(gopaths[0], "/pkg/mod")
+	r.moduleCacheDir = gomodcacheForEnv(goenv)
+	if r.moduleCacheDir == "" {
+		return nil, fmt.Errorf("cannot resolve GOMODCACHE")
 	}
 
 	sort.Slice(r.modsByModPath, func(i, j int) bool {
@@ -123,7 +161,7 @@ func (r *ModuleResolver) init() error {
 	})
 	sort.Slice(r.modsByDir, func(i, j int) bool {
 		count := func(x int) int {
-			return strings.Count(r.modsByDir[x].Dir, "/")
+			return strings.Count(r.modsByDir[x].Dir, string(filepath.Separator))
 		}
 		return count(j) < count(i) // descending order
 	})
@@ -141,7 +179,11 @@ func (r *ModuleResolver) init() error {
 	} else {
 		addDep := func(mod *gocommand.ModuleJSON) {
 			if mod.Replace == nil {
-				// This is redundant with the cache, but we'll skip it cheaply enough.
+				// This is redundant with the cache, but we'll skip it cheaply enough
+				// when we encounter it in the module cache scan.
+				//
+				// Including it at a lower index in r.roots than the module cache dir
+				// helps prioritize matches from within existing dependencies.
 				r.roots = append(r.roots, gopathwalk.Root{Path: mod.Dir, Type: gopathwalk.RootModuleCache})
 			} else {
 				r.roots = append(r.roots, gopathwalk.Root{Path: mod.Dir, Type: gopathwalk.RootOther})
@@ -158,24 +200,40 @@ func (r *ModuleResolver) init() error {
 				addDep(mod)
 			}
 		}
+		// If provided, share the moduleCacheCache.
+		//
+		// TODO(rfindley): The module cache is immutable. However, the loaded
+		// exports do depend on GOOS and GOARCH. Fortunately, the
+		// ProcessEnv.buildContext does not adjust these from build.DefaultContext
+		// (even though it should). So for now, this is OK to share, but we need to
+		// add logic for handling GOOS/GOARCH.
+		r.moduleCacheCache = moduleCacheCache
 		r.roots = append(r.roots, gopathwalk.Root{Path: r.moduleCacheDir, Type: gopathwalk.RootModuleCache})
 	}
 
 	r.scannedRoots = map[gopathwalk.Root]bool{}
 	if r.moduleCacheCache == nil {
-		r.moduleCacheCache = &dirInfoCache{
-			dirs:      map[string]*directoryPackageInfo{},
-			listeners: map[*int]cacheListener{},
-		}
+		r.moduleCacheCache = NewDirInfoCache()
 	}
-	if r.otherCache == nil {
-		r.otherCache = &dirInfoCache{
-			dirs:      map[string]*directoryPackageInfo{},
-			listeners: map[*int]cacheListener{},
-		}
-	}
-	r.initialized = true
-	return nil
+	r.otherCache = NewDirInfoCache()
+	return r, nil
+}
+
+// gomodcacheForEnv returns the GOMODCACHE value to use based on the given env
+// map, which must have GOMODCACHE and GOPATH populated.
+//
+// TODO(rfindley): this is defensive refactoring.
+//  1. Is this even relevant anymore? Can't we just read GOMODCACHE.
+//  2. Use this to separate module cache scanning from other scanning.
+func gomodcacheForEnv(goenv map[string]string) string {
+	if gmc := goenv["GOMODCACHE"]; gmc != "" {
+		return gmc
+	}
+	gopaths := filepath.SplitList(goenv["GOPATH"])
+	if len(gopaths) == 0 {
+		return ""
+	}
+	return filepath.Join(gopaths[0], "/pkg/mod")
 }
 
 func (r *ModuleResolver) initAllMods() error {
@@ -206,30 +264,86 @@ func (r *ModuleResolver) initAllMods() error {
 	return nil
 }
 
-func (r *ModuleResolver) ClearForNewScan() {
-	<-r.scanSema
-	r.scannedRoots = map[gopathwalk.Root]bool{}
-	r.otherCache = &dirInfoCache{
-		dirs:      map[string]*directoryPackageInfo{},
-		listeners: map[*int]cacheListener{},
+// ClearForNewScan invalidates the last scan.
+//
+// It preserves the set of roots, but forgets about the set of directories.
+// Though it forgets the set of module cache directories, it remembers their
+// contents, since they are assumed to be immutable.
+func (r *ModuleResolver) ClearForNewScan() Resolver {
+	<-r.scanSema // acquire r, to guard scannedRoots
+	r2 := &ModuleResolver{
+		env:            r.env,
+		dummyVendorMod: r.dummyVendorMod,
+		moduleCacheDir: r.moduleCacheDir,
+		roots:          r.roots,
+		mains:          r.mains,
+		mainByDir:      r.mainByDir,
+		modsByModPath:  r.modsByModPath,
+
+		scanSema:         make(chan struct{}, 1),
+		scannedRoots:     make(map[gopathwalk.Root]bool),
+		otherCache:       NewDirInfoCache(),
+		moduleCacheCache: r.moduleCacheCache,
 	}
-	r.scanSema <- struct{}{}
+	r2.scanSema <- struct{}{} // r2 must start released
+	// Invalidate root scans. We don't need to invalidate module cache roots,
+	// because they are immutable.
+	// (We don't support a use case where GOMODCACHE is cleaned in the middle of
+	// e.g. a gopls session: the user must restart gopls to get accurate
+	// imports.)
+	//
+	// Scanning for new directories in GOMODCACHE should be handled elsewhere,
+	// via a call to ScanModuleCache.
+	for _, root := range r.roots {
+		if root.Type == gopathwalk.RootModuleCache && r.scannedRoots[root] {
+			r2.scannedRoots[root] = true
+		}
+	}
+	r.scanSema <- struct{}{} // release r
+	return r2
 }
 
-func (r *ModuleResolver) ClearForNewMod() {
-	<-r.scanSema
-	*r = ModuleResolver{
-		env:              r.env,
-		moduleCacheCache: r.moduleCacheCache,
-		otherCache:       r.otherCache,
-		scanSema:         r.scanSema,
+// ClearModuleInfo invalidates resolver state that depends on go.mod file
+// contents (essentially, the output of go list -m -json ...).
+//
+// Notably, it does not forget directory contents, which are reset
+// asynchronously via ClearForNewScan.
+//
+// If the ProcessEnv is a GOPATH environment, ClearModuleInfo is a no op.
+//
+// TODO(rfindley): move this to a new env.go, consolidating ProcessEnv methods.
+func (e *ProcessEnv) ClearModuleInfo() {
+	if r, ok := e.resolver.(*ModuleResolver); ok {
+		resolver, err := newModuleResolver(e, e.ModCache)
+		if err != nil {
+			e.resolver = nil
+			e.resolverErr = err
+			return
+		}
+
+		<-r.scanSema // acquire (guards caches)
+		resolver.moduleCacheCache = r.moduleCacheCache
+		resolver.otherCache = r.otherCache
+		r.scanSema <- struct{}{} // release
+
+		e.UpdateResolver(resolver)
 	}
-	r.init()
-	r.scanSema <- struct{}{}
 }
 
-// findPackage returns the module and directory that contains the package at
-// the given import path, or returns nil, "" if no module is in scope.
+// UpdateResolver sets the resolver for the ProcessEnv to use in imports
+// operations. Only for use with the result of [Resolver.ClearForNewScan].
+//
+// TODO(rfindley): this awkward API is a result of the (arguably) inverted
+// relationship between configuration and state described in the doc comment
+// for [ProcessEnv].
+func (e *ProcessEnv) UpdateResolver(r Resolver) {
+	e.resolver = r
+	e.resolverErr = nil
+}
+
+// findPackage returns the module and directory from within the main modules
+// and their dependencies that contains the package at the given import path,
+// or returns nil, "" if no module is in scope.
 func (r *ModuleResolver) findPackage(importPath string) (*gocommand.ModuleJSON, string) {
 	// This can't find packages in the stdlib, but that's harmless for all
 	// the existing code paths.
@@ -264,7 +378,7 @@ func (r *ModuleResolver) findPackage(importPath string) (*gocommand.ModuleJSON,
 		}
 
 		// Not cached. Read the filesystem.
-		pkgFiles, err := ioutil.ReadDir(pkgDir)
+		pkgFiles, err := os.ReadDir(pkgDir)
 		if err != nil {
 			continue
 		}
@@ -295,10 +409,6 @@ func (r *ModuleResolver) cacheStore(info directoryPackageInfo) {
 	}
 }
 
-func (r *ModuleResolver) cacheKeys() []string {
-	return append(r.moduleCacheCache.Keys(), r.otherCache.Keys()...)
-}
-
 // cachePackageName caches the package name for a dir already in the cache.
 func (r *ModuleResolver) cachePackageName(info directoryPackageInfo) (string, error) {
 	if info.rootType == gopathwalk.RootModuleCache {
@@ -307,7 +417,7 @@ func (r *ModuleResolver) cachePackageName(info directoryPackageInfo) (string, er
 	return r.otherCache.CachePackageName(info)
 }
 
-func (r *ModuleResolver) cacheExports(ctx context.Context, env *ProcessEnv, info directoryPackageInfo) (string, []string, error) {
+func (r *ModuleResolver) cacheExports(ctx context.Context, env *ProcessEnv, info directoryPackageInfo) (string, []stdlib.Symbol, error) {
 	if info.rootType == gopathwalk.RootModuleCache {
 		return r.moduleCacheCache.CacheExports(ctx, env, info)
 	}
@@ -327,6 +437,10 @@ func (r *ModuleResolver) findModuleByDir(dir string) *gocommand.ModuleJSON {
 	// - in /vendor/ in -mod=vendor mode.
 	//    - nested module? Dunno.
 	// Rumor has it that replace targets cannot contain other replace targets.
+	//
+	// Note that it is critical here that modsByDir is sorted to have deeper dirs
+	// first. This ensures that findModuleByDir finds the innermost module.
+	// See also golang/go#56291.
 	for _, m := range r.modsByDir {
 		if !strings.HasPrefix(dir, m.Dir) {
 			continue
@@ -363,15 +477,15 @@ func (r *ModuleResolver) dirIsNestedModule(dir string, mod *gocommand.ModuleJSON
 	return modDir != mod.Dir
 }
 
-func (r *ModuleResolver) modInfo(dir string) (modDir string, modName string) {
-	readModName := func(modFile string) string {
-		modBytes, err := ioutil.ReadFile(modFile)
-		if err != nil {
-			return ""
-		}
-		return modulePath(modBytes)
+func readModName(modFile string) string {
+	modBytes, err := os.ReadFile(modFile)
+	if err != nil {
+		return ""
 	}
+	return modulePath(modBytes)
+}
 
+func (r *ModuleResolver) modInfo(dir string) (modDir, modName string) {
 	if r.dirInModuleCache(dir) {
 		if matches := modCacheRegexp.FindStringSubmatch(dir); len(matches) == 3 {
 			index := strings.Index(dir, matches[1]+"@"+matches[2])
@@ -405,11 +519,9 @@ func (r *ModuleResolver) dirInModuleCache(dir string) bool {
 }
 
 func (r *ModuleResolver) loadPackageNames(importPaths []string, srcDir string) (map[string]string, error) {
-	if err := r.init(); err != nil {
-		return nil, err
-	}
 	names := map[string]string{}
 	for _, path := range importPaths {
+		// TODO(rfindley): shouldn't this use the dirInfoCache?
 		_, packageDir := r.findPackage(path)
 		if packageDir == "" {
 			continue
@@ -424,9 +536,8 @@ func (r *ModuleResolver) loadPackageNames(importPaths []string, srcDir string) (
 }
 
 func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error {
-	if err := r.init(); err != nil {
-		return err
-	}
+	ctx, done := event.Start(ctx, "imports.ModuleResolver.scan")
+	defer done()
 
 	processDir := func(info directoryPackageInfo) {
 		// Skip this directory if we were not able to get the package information successfully.
@@ -437,18 +548,18 @@ func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error
 		if err != nil {
 			return
 		}
-
 		if !callback.dirFound(pkg) {
 			return
 		}
+
 		pkg.packageName, err = r.cachePackageName(info)
 		if err != nil {
 			return
 		}
-
 		if !callback.packageNameLoaded(pkg) {
 			return
 		}
+
 		_, exports, err := r.loadExports(ctx, pkg, false)
 		if err != nil {
 			return
@@ -487,7 +598,6 @@ func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error
 		return packageScanned
 	}
 
-	// Add anything new to the cache, and process it if we're still listening.
 	add := func(root gopathwalk.Root, dir string) {
 		r.cacheStore(r.scanDirForPackage(root, dir))
 	}
@@ -502,9 +612,9 @@ func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error
 		select {
 		case <-ctx.Done():
 			return
-		case <-r.scanSema:
+		case <-r.scanSema: // acquire
 		}
-		defer func() { r.scanSema <- struct{}{} }()
+		defer func() { r.scanSema <- struct{}{} }() // release
 		// We have the lock on r.scannedRoots, and no other scans can run.
 		for _, root := range roots {
 			if ctx.Err() != nil {
@@ -527,7 +637,7 @@ func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error
 }
 
 func (r *ModuleResolver) scoreImportPath(ctx context.Context, path string) float64 {
-	if _, ok := stdlib[path]; ok {
+	if stdlib.HasPackage(path) {
 		return MaxRelevance
 	}
 	mod, _ := r.findPackage(path)
@@ -605,10 +715,7 @@ func (r *ModuleResolver) canonicalize(info directoryPackageInfo) (*pkg, error) {
 	return res, nil
 }
 
-func (r *ModuleResolver) loadExports(ctx context.Context, pkg *pkg, includeTest bool) (string, []string, error) {
-	if err := r.init(); err != nil {
-		return "", nil, err
-	}
+func (r *ModuleResolver) loadExports(ctx context.Context, pkg *pkg, includeTest bool) (string, []stdlib.Symbol, error) {
 	if info, ok := r.cacheLoad(pkg.dir); ok && !includeTest {
 		return r.cacheExports(ctx, r.env, info)
 	}
diff --git a/vendor/golang.org/x/tools/internal/imports/mod_cache.go b/vendor/golang.org/x/tools/internal/imports/mod_cache.go
index 18dada495..b1192696b 100644
--- a/vendor/golang.org/x/tools/internal/imports/mod_cache.go
+++ b/vendor/golang.org/x/tools/internal/imports/mod_cache.go
@@ -7,12 +7,17 @@ package imports
 import (
 	"context"
 	"fmt"
+	"path"
+	"path/filepath"
+	"strings"
 	"sync"
 
+	"golang.org/x/mod/module"
 	"golang.org/x/tools/internal/gopathwalk"
+	"golang.org/x/tools/internal/stdlib"
 )
 
-// To find packages to import, the resolver needs to know about all of the
+// To find packages to import, the resolver needs to know about all of
 // the packages that could be imported. This includes packages that are
 // already in modules that are in (1) the current module, (2) replace targets,
 // and (3) packages in the module cache. Packages in (1) and (2) may change over
@@ -39,6 +44,8 @@ const (
 	exportsLoaded
 )
 
+// directoryPackageInfo holds (possibly incomplete) information about packages
+// contained in a given directory.
 type directoryPackageInfo struct {
 	// status indicates the extent to which this struct has been filled in.
 	status directoryPackageStatus
@@ -63,8 +70,11 @@ type directoryPackageInfo struct {
 	packageName string // the package name, as declared in the source.
 
 	// Set when status >= exportsLoaded.
-
-	exports []string
+	// TODO(rfindley): it's hard to see this, but exports depend implicitly on
+	// the default build context GOOS and GOARCH.
+	//
+	// We can make this explicit, and key exports by GOOS, GOARCH.
+	exports []stdlib.Symbol
 }
 
 // reachedStatus returns true when info has a status at least target and any error associated with
@@ -79,7 +89,7 @@ func (info *directoryPackageInfo) reachedStatus(target directoryPackageStatus) (
 	return true, nil
 }
 
-// dirInfoCache is a concurrency safe map for storing information about
+// DirInfoCache is a concurrency-safe map for storing information about
 // directories that may contain packages.
 //
 // The information in this cache is built incrementally. Entries are initialized in scan.
@@ -92,21 +102,26 @@ func (info *directoryPackageInfo) reachedStatus(target directoryPackageStatus) (
 // The information in the cache is not expected to change for the cache's
 // lifetime, so there is no protection against competing writes. Users should
 // take care not to hold the cache across changes to the underlying files.
-//
-// TODO(suzmue): consider other concurrency strategies and data structures (RWLocks, sync.Map, etc)
-type dirInfoCache struct {
+type DirInfoCache struct {
 	mu sync.Mutex
 	// dirs stores information about packages in directories, keyed by absolute path.
 	dirs      map[string]*directoryPackageInfo
 	listeners map[*int]cacheListener
 }
 
+func NewDirInfoCache() *DirInfoCache {
+	return &DirInfoCache{
+		dirs:      make(map[string]*directoryPackageInfo),
+		listeners: make(map[*int]cacheListener),
+	}
+}
+
 type cacheListener func(directoryPackageInfo)
 
 // ScanAndListen calls listener on all the items in the cache, and on anything
 // newly added. The returned stop function waits for all in-flight callbacks to
 // finish and blocks new ones.
-func (d *dirInfoCache) ScanAndListen(ctx context.Context, listener cacheListener) func() {
+func (d *DirInfoCache) ScanAndListen(ctx context.Context, listener cacheListener) func() {
 	ctx, cancel := context.WithCancel(ctx)
 
 	// Flushing out all the callbacks is tricky without knowing how many there
@@ -162,8 +177,10 @@ func (d *dirInfoCache) ScanAndListen(ctx context.Context, listener cacheListener
 }
 
 // Store stores the package info for dir.
-func (d *dirInfoCache) Store(dir string, info directoryPackageInfo) {
+func (d *DirInfoCache) Store(dir string, info directoryPackageInfo) {
 	d.mu.Lock()
+	// TODO(rfindley, golang/go#59216): should we overwrite an existing entry?
+	// That seems incorrect as the cache should be idempotent.
 	_, old := d.dirs[dir]
 	d.dirs[dir] = &info
 	var listeners []cacheListener
@@ -180,7 +197,7 @@ func (d *dirInfoCache) Store(dir string, info directoryPackageInfo) {
 }
 
 // Load returns a copy of the directoryPackageInfo for absolute directory dir.
-func (d *dirInfoCache) Load(dir string) (directoryPackageInfo, bool) {
+func (d *DirInfoCache) Load(dir string) (directoryPackageInfo, bool) {
 	d.mu.Lock()
 	defer d.mu.Unlock()
 	info, ok := d.dirs[dir]
@@ -191,7 +208,7 @@ func (d *dirInfoCache) Load(dir string) (directoryPackageInfo, bool) {
 }
 
 // Keys returns the keys currently present in d.
-func (d *dirInfoCache) Keys() (keys []string) {
+func (d *DirInfoCache) Keys() (keys []string) {
 	d.mu.Lock()
 	defer d.mu.Unlock()
 	for key := range d.dirs {
@@ -200,7 +217,7 @@ func (d *dirInfoCache) Keys() (keys []string) {
 	return keys
 }
 
-func (d *dirInfoCache) CachePackageName(info directoryPackageInfo) (string, error) {
+func (d *DirInfoCache) CachePackageName(info directoryPackageInfo) (string, error) {
 	if loaded, err := info.reachedStatus(nameLoaded); loaded {
 		return info.packageName, err
 	}
@@ -213,7 +230,7 @@ func (d *dirInfoCache) CachePackageName(info directoryPackageInfo) (string, erro
 	return info.packageName, info.err
 }
 
-func (d *dirInfoCache) CacheExports(ctx context.Context, env *ProcessEnv, info directoryPackageInfo) (string, []string, error) {
+func (d *DirInfoCache) CacheExports(ctx context.Context, env *ProcessEnv, info directoryPackageInfo) (string, []stdlib.Symbol, error) {
 	if reached, _ := info.reachedStatus(exportsLoaded); reached {
 		return info.packageName, info.exports, info.err
 	}
@@ -234,3 +251,81 @@ func (d *dirInfoCache) CacheExports(ctx context.Context, env *ProcessEnv, info d
 	d.Store(info.dir, info)
 	return info.packageName, info.exports, info.err
 }
+
+// ScanModuleCache walks the given directory, which must be a GOMODCACHE value,
+// for directory package information, storing the results in cache.
+func ScanModuleCache(dir string, cache *DirInfoCache, logf func(string, ...any)) {
+	// Note(rfindley): it's hard to see, but this function attempts to implement
+	// just the side effects on cache of calling PrimeCache with a ProcessEnv
+	// that has the given dir as its GOMODCACHE.
+	//
+	// Teasing out the control flow, we see that we can avoid any handling of
+	// vendor/ and can infer module info entirely from the path, simplifying the
+	// logic here.
+
+	root := gopathwalk.Root{
+		Path: filepath.Clean(dir),
+		Type: gopathwalk.RootModuleCache,
+	}
+
+	directoryInfo := func(root gopathwalk.Root, dir string) directoryPackageInfo {
+		// This is a copy of ModuleResolver.scanDirForPackage, trimmed down to
+		// logic that applies to a module cache directory.
+
+		subdir := ""
+		if dir != root.Path {
+			subdir = dir[len(root.Path)+len("/"):]
+		}
+
+		matches := modCacheRegexp.FindStringSubmatch(subdir)
+		if len(matches) == 0 {
+			return directoryPackageInfo{
+				status: directoryScanned,
+				err:    fmt.Errorf("invalid module cache path: %v", subdir),
+			}
+		}
+		modPath, err := module.UnescapePath(filepath.ToSlash(matches[1]))
+		if err != nil {
+			if logf != nil {
+				logf("decoding module cache path %q: %v", subdir, err)
+			}
+			return directoryPackageInfo{
+				status: directoryScanned,
+				err:    fmt.Errorf("decoding module cache path %q: %v", subdir, err),
+			}
+		}
+		importPath := path.Join(modPath, filepath.ToSlash(matches[3]))
+		index := strings.Index(dir, matches[1]+"@"+matches[2])
+		modDir := filepath.Join(dir[:index], matches[1]+"@"+matches[2])
+		modName := readModName(filepath.Join(modDir, "go.mod"))
+		return directoryPackageInfo{
+			status:                 directoryScanned,
+			dir:                    dir,
+			rootType:               root.Type,
+			nonCanonicalImportPath: importPath,
+			moduleDir:              modDir,
+			moduleName:             modName,
+		}
+	}
+
+	add := func(root gopathwalk.Root, dir string) {
+		info := directoryInfo(root, dir)
+		cache.Store(info.dir, info)
+	}
+
+	skip := func(_ gopathwalk.Root, dir string) bool {
+		// Skip directories that have already been scanned.
+		//
+		// Note that gopathwalk only adds "package" directories, which must contain
+		// a .go file, and all such package directories in the module cache are
+		// immutable. So if we can load a dir, it can be skipped.
+		info, ok := cache.Load(dir)
+		if !ok {
+			return false
+		}
+		packageScanned, _ := info.reachedStatus(directoryScanned)
+		return packageScanned
+	}
+
+	gopathwalk.WalkSkip([]gopathwalk.Root{root}, add, skip, gopathwalk.Options{Logf: logf, ModulesEnabled: true})
+}
diff --git a/vendor/golang.org/x/tools/internal/imports/sortimports.go b/vendor/golang.org/x/tools/internal/imports/sortimports.go
index 1a0a7ebd9..da8194fd9 100644
--- a/vendor/golang.org/x/tools/internal/imports/sortimports.go
+++ b/vendor/golang.org/x/tools/internal/imports/sortimports.go
@@ -18,7 +18,7 @@ import (
 // sortImports sorts runs of consecutive import lines in import blocks in f.
 // It also removes duplicate imports when it is possible to do so without data loss.
 //
-// It may mutate the token.File.
+// It may mutate the token.File and the ast.File.
 func sortImports(localPrefix string, tokFile *token.File, f *ast.File) {
 	for i, d := range f.Decls {
 		d, ok := d.(*ast.GenDecl)
diff --git a/vendor/golang.org/x/tools/internal/imports/zstdlib.go b/vendor/golang.org/x/tools/internal/imports/zstdlib.go
deleted file mode 100644
index 31a75949c..000000000
--- a/vendor/golang.org/x/tools/internal/imports/zstdlib.go
+++ /dev/null
@@ -1,11115 +0,0 @@
-// Copyright 2022 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Code generated by mkstdlib.go. DO NOT EDIT.
-
-package imports
-
-var stdlib = map[string][]string{
-	"archive/tar": {
-		"ErrFieldTooLong",
-		"ErrHeader",
-		"ErrInsecurePath",
-		"ErrWriteAfterClose",
-		"ErrWriteTooLong",
-		"FileInfoHeader",
-		"Format",
-		"FormatGNU",
-		"FormatPAX",
-		"FormatUSTAR",
-		"FormatUnknown",
-		"Header",
-		"NewReader",
-		"NewWriter",
-		"Reader",
-		"TypeBlock",
-		"TypeChar",
-		"TypeCont",
-		"TypeDir",
-		"TypeFifo",
-		"TypeGNULongLink",
-		"TypeGNULongName",
-		"TypeGNUSparse",
-		"TypeLink",
-		"TypeReg",
-		"TypeRegA",
-		"TypeSymlink",
-		"TypeXGlobalHeader",
-		"TypeXHeader",
-		"Writer",
-	},
-	"archive/zip": {
-		"Compressor",
-		"Decompressor",
-		"Deflate",
-		"ErrAlgorithm",
-		"ErrChecksum",
-		"ErrFormat",
-		"ErrInsecurePath",
-		"File",
-		"FileHeader",
-		"FileInfoHeader",
-		"NewReader",
-		"NewWriter",
-		"OpenReader",
-		"ReadCloser",
-		"Reader",
-		"RegisterCompressor",
-		"RegisterDecompressor",
-		"Store",
-		"Writer",
-	},
-	"bufio": {
-		"ErrAdvanceTooFar",
-		"ErrBadReadCount",
-		"ErrBufferFull",
-		"ErrFinalToken",
-		"ErrInvalidUnreadByte",
-		"ErrInvalidUnreadRune",
-		"ErrNegativeAdvance",
-		"ErrNegativeCount",
-		"ErrTooLong",
-		"MaxScanTokenSize",
-		"NewReadWriter",
-		"NewReader",
-		"NewReaderSize",
-		"NewScanner",
-		"NewWriter",
-		"NewWriterSize",
-		"ReadWriter",
-		"Reader",
-		"ScanBytes",
-		"ScanLines",
-		"ScanRunes",
-		"ScanWords",
-		"Scanner",
-		"SplitFunc",
-		"Writer",
-	},
-	"bytes": {
-		"Buffer",
-		"Clone",
-		"Compare",
-		"Contains",
-		"ContainsAny",
-		"ContainsRune",
-		"Count",
-		"Cut",
-		"CutPrefix",
-		"CutSuffix",
-		"Equal",
-		"EqualFold",
-		"ErrTooLarge",
-		"Fields",
-		"FieldsFunc",
-		"HasPrefix",
-		"HasSuffix",
-		"Index",
-		"IndexAny",
-		"IndexByte",
-		"IndexFunc",
-		"IndexRune",
-		"Join",
-		"LastIndex",
-		"LastIndexAny",
-		"LastIndexByte",
-		"LastIndexFunc",
-		"Map",
-		"MinRead",
-		"NewBuffer",
-		"NewBufferString",
-		"NewReader",
-		"Reader",
-		"Repeat",
-		"Replace",
-		"ReplaceAll",
-		"Runes",
-		"Split",
-		"SplitAfter",
-		"SplitAfterN",
-		"SplitN",
-		"Title",
-		"ToLower",
-		"ToLowerSpecial",
-		"ToTitle",
-		"ToTitleSpecial",
-		"ToUpper",
-		"ToUpperSpecial",
-		"ToValidUTF8",
-		"Trim",
-		"TrimFunc",
-		"TrimLeft",
-		"TrimLeftFunc",
-		"TrimPrefix",
-		"TrimRight",
-		"TrimRightFunc",
-		"TrimSpace",
-		"TrimSuffix",
-	},
-	"compress/bzip2": {
-		"NewReader",
-		"StructuralError",
-	},
-	"compress/flate": {
-		"BestCompression",
-		"BestSpeed",
-		"CorruptInputError",
-		"DefaultCompression",
-		"HuffmanOnly",
-		"InternalError",
-		"NewReader",
-		"NewReaderDict",
-		"NewWriter",
-		"NewWriterDict",
-		"NoCompression",
-		"ReadError",
-		"Reader",
-		"Resetter",
-		"WriteError",
-		"Writer",
-	},
-	"compress/gzip": {
-		"BestCompression",
-		"BestSpeed",
-		"DefaultCompression",
-		"ErrChecksum",
-		"ErrHeader",
-		"Header",
-		"HuffmanOnly",
-		"NewReader",
-		"NewWriter",
-		"NewWriterLevel",
-		"NoCompression",
-		"Reader",
-		"Writer",
-	},
-	"compress/lzw": {
-		"LSB",
-		"MSB",
-		"NewReader",
-		"NewWriter",
-		"Order",
-		"Reader",
-		"Writer",
-	},
-	"compress/zlib": {
-		"BestCompression",
-		"BestSpeed",
-		"DefaultCompression",
-		"ErrChecksum",
-		"ErrDictionary",
-		"ErrHeader",
-		"HuffmanOnly",
-		"NewReader",
-		"NewReaderDict",
-		"NewWriter",
-		"NewWriterLevel",
-		"NewWriterLevelDict",
-		"NoCompression",
-		"Resetter",
-		"Writer",
-	},
-	"container/heap": {
-		"Fix",
-		"Init",
-		"Interface",
-		"Pop",
-		"Push",
-		"Remove",
-	},
-	"container/list": {
-		"Element",
-		"List",
-		"New",
-	},
-	"container/ring": {
-		"New",
-		"Ring",
-	},
-	"context": {
-		"Background",
-		"CancelCauseFunc",
-		"CancelFunc",
-		"Canceled",
-		"Cause",
-		"Context",
-		"DeadlineExceeded",
-		"TODO",
-		"WithCancel",
-		"WithCancelCause",
-		"WithDeadline",
-		"WithTimeout",
-		"WithValue",
-	},
-	"crypto": {
-		"BLAKE2b_256",
-		"BLAKE2b_384",
-		"BLAKE2b_512",
-		"BLAKE2s_256",
-		"Decrypter",
-		"DecrypterOpts",
-		"Hash",
-		"MD4",
-		"MD5",
-		"MD5SHA1",
-		"PrivateKey",
-		"PublicKey",
-		"RIPEMD160",
-		"RegisterHash",
-		"SHA1",
-		"SHA224",
-		"SHA256",
-		"SHA384",
-		"SHA3_224",
-		"SHA3_256",
-		"SHA3_384",
-		"SHA3_512",
-		"SHA512",
-		"SHA512_224",
-		"SHA512_256",
-		"Signer",
-		"SignerOpts",
-	},
-	"crypto/aes": {
-		"BlockSize",
-		"KeySizeError",
-		"NewCipher",
-	},
-	"crypto/cipher": {
-		"AEAD",
-		"Block",
-		"BlockMode",
-		"NewCBCDecrypter",
-		"NewCBCEncrypter",
-		"NewCFBDecrypter",
-		"NewCFBEncrypter",
-		"NewCTR",
-		"NewGCM",
-		"NewGCMWithNonceSize",
-		"NewGCMWithTagSize",
-		"NewOFB",
-		"Stream",
-		"StreamReader",
-		"StreamWriter",
-	},
-	"crypto/des": {
-		"BlockSize",
-		"KeySizeError",
-		"NewCipher",
-		"NewTripleDESCipher",
-	},
-	"crypto/dsa": {
-		"ErrInvalidPublicKey",
-		"GenerateKey",
-		"GenerateParameters",
-		"L1024N160",
-		"L2048N224",
-		"L2048N256",
-		"L3072N256",
-		"ParameterSizes",
-		"Parameters",
-		"PrivateKey",
-		"PublicKey",
-		"Sign",
-		"Verify",
-	},
-	"crypto/ecdh": {
-		"Curve",
-		"P256",
-		"P384",
-		"P521",
-		"PrivateKey",
-		"PublicKey",
-		"X25519",
-	},
-	"crypto/ecdsa": {
-		"GenerateKey",
-		"PrivateKey",
-		"PublicKey",
-		"Sign",
-		"SignASN1",
-		"Verify",
-		"VerifyASN1",
-	},
-	"crypto/ed25519": {
-		"GenerateKey",
-		"NewKeyFromSeed",
-		"Options",
-		"PrivateKey",
-		"PrivateKeySize",
-		"PublicKey",
-		"PublicKeySize",
-		"SeedSize",
-		"Sign",
-		"SignatureSize",
-		"Verify",
-		"VerifyWithOptions",
-	},
-	"crypto/elliptic": {
-		"Curve",
-		"CurveParams",
-		"GenerateKey",
-		"Marshal",
-		"MarshalCompressed",
-		"P224",
-		"P256",
-		"P384",
-		"P521",
-		"Unmarshal",
-		"UnmarshalCompressed",
-	},
-	"crypto/hmac": {
-		"Equal",
-		"New",
-	},
-	"crypto/md5": {
-		"BlockSize",
-		"New",
-		"Size",
-		"Sum",
-	},
-	"crypto/rand": {
-		"Int",
-		"Prime",
-		"Read",
-		"Reader",
-	},
-	"crypto/rc4": {
-		"Cipher",
-		"KeySizeError",
-		"NewCipher",
-	},
-	"crypto/rsa": {
-		"CRTValue",
-		"DecryptOAEP",
-		"DecryptPKCS1v15",
-		"DecryptPKCS1v15SessionKey",
-		"EncryptOAEP",
-		"EncryptPKCS1v15",
-		"ErrDecryption",
-		"ErrMessageTooLong",
-		"ErrVerification",
-		"GenerateKey",
-		"GenerateMultiPrimeKey",
-		"OAEPOptions",
-		"PKCS1v15DecryptOptions",
-		"PSSOptions",
-		"PSSSaltLengthAuto",
-		"PSSSaltLengthEqualsHash",
-		"PrecomputedValues",
-		"PrivateKey",
-		"PublicKey",
-		"SignPKCS1v15",
-		"SignPSS",
-		"VerifyPKCS1v15",
-		"VerifyPSS",
-	},
-	"crypto/sha1": {
-		"BlockSize",
-		"New",
-		"Size",
-		"Sum",
-	},
-	"crypto/sha256": {
-		"BlockSize",
-		"New",
-		"New224",
-		"Size",
-		"Size224",
-		"Sum224",
-		"Sum256",
-	},
-	"crypto/sha512": {
-		"BlockSize",
-		"New",
-		"New384",
-		"New512_224",
-		"New512_256",
-		"Size",
-		"Size224",
-		"Size256",
-		"Size384",
-		"Sum384",
-		"Sum512",
-		"Sum512_224",
-		"Sum512_256",
-	},
-	"crypto/subtle": {
-		"ConstantTimeByteEq",
-		"ConstantTimeCompare",
-		"ConstantTimeCopy",
-		"ConstantTimeEq",
-		"ConstantTimeLessOrEq",
-		"ConstantTimeSelect",
-		"XORBytes",
-	},
-	"crypto/tls": {
-		"Certificate",
-		"CertificateRequestInfo",
-		"CertificateVerificationError",
-		"CipherSuite",
-		"CipherSuiteName",
-		"CipherSuites",
-		"Client",
-		"ClientAuthType",
-		"ClientHelloInfo",
-		"ClientSessionCache",
-		"ClientSessionState",
-		"Config",
-		"Conn",
-		"ConnectionState",
-		"CurveID",
-		"CurveP256",
-		"CurveP384",
-		"CurveP521",
-		"Dial",
-		"DialWithDialer",
-		"Dialer",
-		"ECDSAWithP256AndSHA256",
-		"ECDSAWithP384AndSHA384",
-		"ECDSAWithP521AndSHA512",
-		"ECDSAWithSHA1",
-		"Ed25519",
-		"InsecureCipherSuites",
-		"Listen",
-		"LoadX509KeyPair",
-		"NewLRUClientSessionCache",
-		"NewListener",
-		"NoClientCert",
-		"PKCS1WithSHA1",
-		"PKCS1WithSHA256",
-		"PKCS1WithSHA384",
-		"PKCS1WithSHA512",
-		"PSSWithSHA256",
-		"PSSWithSHA384",
-		"PSSWithSHA512",
-		"RecordHeaderError",
-		"RenegotiateFreelyAsClient",
-		"RenegotiateNever",
-		"RenegotiateOnceAsClient",
-		"RenegotiationSupport",
-		"RequestClientCert",
-		"RequireAndVerifyClientCert",
-		"RequireAnyClientCert",
-		"Server",
-		"SignatureScheme",
-		"TLS_AES_128_GCM_SHA256",
-		"TLS_AES_256_GCM_SHA384",
-		"TLS_CHACHA20_POLY1305_SHA256",
-		"TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA",
-		"TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256",
-		"TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256",
-		"TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA",
-		"TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384",
-		"TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305",
-		"TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256",
-		"TLS_ECDHE_ECDSA_WITH_RC4_128_SHA",
-		"TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA",
-		"TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA",
-		"TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256",
-		"TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256",
-		"TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA",
-		"TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384",
-		"TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305",
-		"TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256",
-		"TLS_ECDHE_RSA_WITH_RC4_128_SHA",
-		"TLS_FALLBACK_SCSV",
-		"TLS_RSA_WITH_3DES_EDE_CBC_SHA",
-		"TLS_RSA_WITH_AES_128_CBC_SHA",
-		"TLS_RSA_WITH_AES_128_CBC_SHA256",
-		"TLS_RSA_WITH_AES_128_GCM_SHA256",
-		"TLS_RSA_WITH_AES_256_CBC_SHA",
-		"TLS_RSA_WITH_AES_256_GCM_SHA384",
-		"TLS_RSA_WITH_RC4_128_SHA",
-		"VerifyClientCertIfGiven",
-		"VersionSSL30",
-		"VersionTLS10",
-		"VersionTLS11",
-		"VersionTLS12",
-		"VersionTLS13",
-		"X25519",
-		"X509KeyPair",
-	},
-	"crypto/x509": {
-		"CANotAuthorizedForExtKeyUsage",
-		"CANotAuthorizedForThisName",
-		"CertPool",
-		"Certificate",
-		"CertificateInvalidError",
-		"CertificateRequest",
-		"ConstraintViolationError",
-		"CreateCertificate",
-		"CreateCertificateRequest",
-		"CreateRevocationList",
-		"DSA",
-		"DSAWithSHA1",
-		"DSAWithSHA256",
-		"DecryptPEMBlock",
-		"ECDSA",
-		"ECDSAWithSHA1",
-		"ECDSAWithSHA256",
-		"ECDSAWithSHA384",
-		"ECDSAWithSHA512",
-		"Ed25519",
-		"EncryptPEMBlock",
-		"ErrUnsupportedAlgorithm",
-		"Expired",
-		"ExtKeyUsage",
-		"ExtKeyUsageAny",
-		"ExtKeyUsageClientAuth",
-		"ExtKeyUsageCodeSigning",
-		"ExtKeyUsageEmailProtection",
-		"ExtKeyUsageIPSECEndSystem",
-		"ExtKeyUsageIPSECTunnel",
-		"ExtKeyUsageIPSECUser",
-		"ExtKeyUsageMicrosoftCommercialCodeSigning",
-		"ExtKeyUsageMicrosoftKernelCodeSigning",
-		"ExtKeyUsageMicrosoftServerGatedCrypto",
-		"ExtKeyUsageNetscapeServerGatedCrypto",
-		"ExtKeyUsageOCSPSigning",
-		"ExtKeyUsageServerAuth",
-		"ExtKeyUsageTimeStamping",
-		"HostnameError",
-		"IncompatibleUsage",
-		"IncorrectPasswordError",
-		"InsecureAlgorithmError",
-		"InvalidReason",
-		"IsEncryptedPEMBlock",
-		"KeyUsage",
-		"KeyUsageCRLSign",
-		"KeyUsageCertSign",
-		"KeyUsageContentCommitment",
-		"KeyUsageDataEncipherment",
-		"KeyUsageDecipherOnly",
-		"KeyUsageDigitalSignature",
-		"KeyUsageEncipherOnly",
-		"KeyUsageKeyAgreement",
-		"KeyUsageKeyEncipherment",
-		"MD2WithRSA",
-		"MD5WithRSA",
-		"MarshalECPrivateKey",
-		"MarshalPKCS1PrivateKey",
-		"MarshalPKCS1PublicKey",
-		"MarshalPKCS8PrivateKey",
-		"MarshalPKIXPublicKey",
-		"NameConstraintsWithoutSANs",
-		"NameMismatch",
-		"NewCertPool",
-		"NotAuthorizedToSign",
-		"PEMCipher",
-		"PEMCipher3DES",
-		"PEMCipherAES128",
-		"PEMCipherAES192",
-		"PEMCipherAES256",
-		"PEMCipherDES",
-		"ParseCRL",
-		"ParseCertificate",
-		"ParseCertificateRequest",
-		"ParseCertificates",
-		"ParseDERCRL",
-		"ParseECPrivateKey",
-		"ParsePKCS1PrivateKey",
-		"ParsePKCS1PublicKey",
-		"ParsePKCS8PrivateKey",
-		"ParsePKIXPublicKey",
-		"ParseRevocationList",
-		"PublicKeyAlgorithm",
-		"PureEd25519",
-		"RSA",
-		"RevocationList",
-		"SHA1WithRSA",
-		"SHA256WithRSA",
-		"SHA256WithRSAPSS",
-		"SHA384WithRSA",
-		"SHA384WithRSAPSS",
-		"SHA512WithRSA",
-		"SHA512WithRSAPSS",
-		"SetFallbackRoots",
-		"SignatureAlgorithm",
-		"SystemCertPool",
-		"SystemRootsError",
-		"TooManyConstraints",
-		"TooManyIntermediates",
-		"UnconstrainedName",
-		"UnhandledCriticalExtension",
-		"UnknownAuthorityError",
-		"UnknownPublicKeyAlgorithm",
-		"UnknownSignatureAlgorithm",
-		"VerifyOptions",
-	},
-	"crypto/x509/pkix": {
-		"AlgorithmIdentifier",
-		"AttributeTypeAndValue",
-		"AttributeTypeAndValueSET",
-		"CertificateList",
-		"Extension",
-		"Name",
-		"RDNSequence",
-		"RelativeDistinguishedNameSET",
-		"RevokedCertificate",
-		"TBSCertificateList",
-	},
-	"database/sql": {
-		"ColumnType",
-		"Conn",
-		"DB",
-		"DBStats",
-		"Drivers",
-		"ErrConnDone",
-		"ErrNoRows",
-		"ErrTxDone",
-		"IsolationLevel",
-		"LevelDefault",
-		"LevelLinearizable",
-		"LevelReadCommitted",
-		"LevelReadUncommitted",
-		"LevelRepeatableRead",
-		"LevelSerializable",
-		"LevelSnapshot",
-		"LevelWriteCommitted",
-		"Named",
-		"NamedArg",
-		"NullBool",
-		"NullByte",
-		"NullFloat64",
-		"NullInt16",
-		"NullInt32",
-		"NullInt64",
-		"NullString",
-		"NullTime",
-		"Open",
-		"OpenDB",
-		"Out",
-		"RawBytes",
-		"Register",
-		"Result",
-		"Row",
-		"Rows",
-		"Scanner",
-		"Stmt",
-		"Tx",
-		"TxOptions",
-	},
-	"database/sql/driver": {
-		"Bool",
-		"ColumnConverter",
-		"Conn",
-		"ConnBeginTx",
-		"ConnPrepareContext",
-		"Connector",
-		"DefaultParameterConverter",
-		"Driver",
-		"DriverContext",
-		"ErrBadConn",
-		"ErrRemoveArgument",
-		"ErrSkip",
-		"Execer",
-		"ExecerContext",
-		"Int32",
-		"IsScanValue",
-		"IsValue",
-		"IsolationLevel",
-		"NamedValue",
-		"NamedValueChecker",
-		"NotNull",
-		"Null",
-		"Pinger",
-		"Queryer",
-		"QueryerContext",
-		"Result",
-		"ResultNoRows",
-		"Rows",
-		"RowsAffected",
-		"RowsColumnTypeDatabaseTypeName",
-		"RowsColumnTypeLength",
-		"RowsColumnTypeNullable",
-		"RowsColumnTypePrecisionScale",
-		"RowsColumnTypeScanType",
-		"RowsNextResultSet",
-		"SessionResetter",
-		"Stmt",
-		"StmtExecContext",
-		"StmtQueryContext",
-		"String",
-		"Tx",
-		"TxOptions",
-		"Validator",
-		"Value",
-		"ValueConverter",
-		"Valuer",
-	},
-	"debug/buildinfo": {
-		"BuildInfo",
-		"Read",
-		"ReadFile",
-	},
-	"debug/dwarf": {
-		"AddrType",
-		"ArrayType",
-		"Attr",
-		"AttrAbstractOrigin",
-		"AttrAccessibility",
-		"AttrAddrBase",
-		"AttrAddrClass",
-		"AttrAlignment",
-		"AttrAllocated",
-		"AttrArtificial",
-		"AttrAssociated",
-		"AttrBaseTypes",
-		"AttrBinaryScale",
-		"AttrBitOffset",
-		"AttrBitSize",
-		"AttrByteSize",
-		"AttrCallAllCalls",
-		"AttrCallAllSourceCalls",
-		"AttrCallAllTailCalls",
-		"AttrCallColumn",
-		"AttrCallDataLocation",
-		"AttrCallDataValue",
-		"AttrCallFile",
-		"AttrCallLine",
-		"AttrCallOrigin",
-		"AttrCallPC",
-		"AttrCallParameter",
-		"AttrCallReturnPC",
-		"AttrCallTailCall",
-		"AttrCallTarget",
-		"AttrCallTargetClobbered",
-		"AttrCallValue",
-		"AttrCalling",
-		"AttrCommonRef",
-		"AttrCompDir",
-		"AttrConstExpr",
-		"AttrConstValue",
-		"AttrContainingType",
-		"AttrCount",
-		"AttrDataBitOffset",
-		"AttrDataLocation",
-		"AttrDataMemberLoc",
-		"AttrDecimalScale",
-		"AttrDecimalSign",
-		"AttrDeclColumn",
-		"AttrDeclFile",
-		"AttrDeclLine",
-		"AttrDeclaration",
-		"AttrDefaultValue",
-		"AttrDefaulted",
-		"AttrDeleted",
-		"AttrDescription",
-		"AttrDigitCount",
-		"AttrDiscr",
-		"AttrDiscrList",
-		"AttrDiscrValue",
-		"AttrDwoName",
-		"AttrElemental",
-		"AttrEncoding",
-		"AttrEndianity",
-		"AttrEntrypc",
-		"AttrEnumClass",
-		"AttrExplicit",
-		"AttrExportSymbols",
-		"AttrExtension",
-		"AttrExternal",
-		"AttrFrameBase",
-		"AttrFriend",
-		"AttrHighpc",
-		"AttrIdentifierCase",
-		"AttrImport",
-		"AttrInline",
-		"AttrIsOptional",
-		"AttrLanguage",
-		"AttrLinkageName",
-		"AttrLocation",
-		"AttrLoclistsBase",
-		"AttrLowerBound",
-		"AttrLowpc",
-		"AttrMacroInfo",
-		"AttrMacros",
-		"AttrMainSubprogram",
-		"AttrMutable",
-		"AttrName",
-		"AttrNamelistItem",
-		"AttrNoreturn",
-		"AttrObjectPointer",
-		"AttrOrdering",
-		"AttrPictureString",
-		"AttrPriority",
-		"AttrProducer",
-		"AttrPrototyped",
-		"AttrPure",
-		"AttrRanges",
-		"AttrRank",
-		"AttrRecursive",
-		"AttrReference",
-		"AttrReturnAddr",
-		"AttrRnglistsBase",
-		"AttrRvalueReference",
-		"AttrSegment",
-		"AttrSibling",
-		"AttrSignature",
-		"AttrSmall",
-		"AttrSpecification",
-		"AttrStartScope",
-		"AttrStaticLink",
-		"AttrStmtList",
-		"AttrStrOffsetsBase",
-		"AttrStride",
-		"AttrStrideSize",
-		"AttrStringLength",
-		"AttrStringLengthBitSize",
-		"AttrStringLengthByteSize",
-		"AttrThreadsScaled",
-		"AttrTrampoline",
-		"AttrType",
-		"AttrUpperBound",
-		"AttrUseLocation",
-		"AttrUseUTF8",
-		"AttrVarParam",
-		"AttrVirtuality",
-		"AttrVisibility",
-		"AttrVtableElemLoc",
-		"BasicType",
-		"BoolType",
-		"CharType",
-		"Class",
-		"ClassAddrPtr",
-		"ClassAddress",
-		"ClassBlock",
-		"ClassConstant",
-		"ClassExprLoc",
-		"ClassFlag",
-		"ClassLinePtr",
-		"ClassLocList",
-		"ClassLocListPtr",
-		"ClassMacPtr",
-		"ClassRangeListPtr",
-		"ClassReference",
-		"ClassReferenceAlt",
-		"ClassReferenceSig",
-		"ClassRngList",
-		"ClassRngListsPtr",
-		"ClassStrOffsetsPtr",
-		"ClassString",
-		"ClassStringAlt",
-		"ClassUnknown",
-		"CommonType",
-		"ComplexType",
-		"Data",
-		"DecodeError",
-		"DotDotDotType",
-		"Entry",
-		"EnumType",
-		"EnumValue",
-		"ErrUnknownPC",
-		"Field",
-		"FloatType",
-		"FuncType",
-		"IntType",
-		"LineEntry",
-		"LineFile",
-		"LineReader",
-		"LineReaderPos",
-		"New",
-		"Offset",
-		"PtrType",
-		"QualType",
-		"Reader",
-		"StructField",
-		"StructType",
-		"Tag",
-		"TagAccessDeclaration",
-		"TagArrayType",
-		"TagAtomicType",
-		"TagBaseType",
-		"TagCallSite",
-		"TagCallSiteParameter",
-		"TagCatchDwarfBlock",
-		"TagClassType",
-		"TagCoarrayType",
-		"TagCommonDwarfBlock",
-		"TagCommonInclusion",
-		"TagCompileUnit",
-		"TagCondition",
-		"TagConstType",
-		"TagConstant",
-		"TagDwarfProcedure",
-		"TagDynamicType",
-		"TagEntryPoint",
-		"TagEnumerationType",
-		"TagEnumerator",
-		"TagFileType",
-		"TagFormalParameter",
-		"TagFriend",
-		"TagGenericSubrange",
-		"TagImmutableType",
-		"TagImportedDeclaration",
-		"TagImportedModule",
-		"TagImportedUnit",
-		"TagInheritance",
-		"TagInlinedSubroutine",
-		"TagInterfaceType",
-		"TagLabel",
-		"TagLexDwarfBlock",
-		"TagMember",
-		"TagModule",
-		"TagMutableType",
-		"TagNamelist",
-		"TagNamelistItem",
-		"TagNamespace",
-		"TagPackedType",
-		"TagPartialUnit",
-		"TagPointerType",
-		"TagPtrToMemberType",
-		"TagReferenceType",
-		"TagRestrictType",
-		"TagRvalueReferenceType",
-		"TagSetType",
-		"TagSharedType",
-		"TagSkeletonUnit",
-		"TagStringType",
-		"TagStructType",
-		"TagSubprogram",
-		"TagSubrangeType",
-		"TagSubroutineType",
-		"TagTemplateAlias",
-		"TagTemplateTypeParameter",
-		"TagTemplateValueParameter",
-		"TagThrownType",
-		"TagTryDwarfBlock",
-		"TagTypeUnit",
-		"TagTypedef",
-		"TagUnionType",
-		"TagUnspecifiedParameters",
-		"TagUnspecifiedType",
-		"TagVariable",
-		"TagVariant",
-		"TagVariantPart",
-		"TagVolatileType",
-		"TagWithStmt",
-		"Type",
-		"TypedefType",
-		"UcharType",
-		"UintType",
-		"UnspecifiedType",
-		"UnsupportedType",
-		"VoidType",
-	},
-	"debug/elf": {
-		"ARM_MAGIC_TRAMP_NUMBER",
-		"COMPRESS_HIOS",
-		"COMPRESS_HIPROC",
-		"COMPRESS_LOOS",
-		"COMPRESS_LOPROC",
-		"COMPRESS_ZLIB",
-		"Chdr32",
-		"Chdr64",
-		"Class",
-		"CompressionType",
-		"DF_BIND_NOW",
-		"DF_ORIGIN",
-		"DF_STATIC_TLS",
-		"DF_SYMBOLIC",
-		"DF_TEXTREL",
-		"DT_ADDRRNGHI",
-		"DT_ADDRRNGLO",
-		"DT_AUDIT",
-		"DT_AUXILIARY",
-		"DT_BIND_NOW",
-		"DT_CHECKSUM",
-		"DT_CONFIG",
-		"DT_DEBUG",
-		"DT_DEPAUDIT",
-		"DT_ENCODING",
-		"DT_FEATURE",
-		"DT_FILTER",
-		"DT_FINI",
-		"DT_FINI_ARRAY",
-		"DT_FINI_ARRAYSZ",
-		"DT_FLAGS",
-		"DT_FLAGS_1",
-		"DT_GNU_CONFLICT",
-		"DT_GNU_CONFLICTSZ",
-		"DT_GNU_HASH",
-		"DT_GNU_LIBLIST",
-		"DT_GNU_LIBLISTSZ",
-		"DT_GNU_PRELINKED",
-		"DT_HASH",
-		"DT_HIOS",
-		"DT_HIPROC",
-		"DT_INIT",
-		"DT_INIT_ARRAY",
-		"DT_INIT_ARRAYSZ",
-		"DT_JMPREL",
-		"DT_LOOS",
-		"DT_LOPROC",
-		"DT_MIPS_AUX_DYNAMIC",
-		"DT_MIPS_BASE_ADDRESS",
-		"DT_MIPS_COMPACT_SIZE",
-		"DT_MIPS_CONFLICT",
-		"DT_MIPS_CONFLICTNO",
-		"DT_MIPS_CXX_FLAGS",
-		"DT_MIPS_DELTA_CLASS",
-		"DT_MIPS_DELTA_CLASSSYM",
-		"DT_MIPS_DELTA_CLASSSYM_NO",
-		"DT_MIPS_DELTA_CLASS_NO",
-		"DT_MIPS_DELTA_INSTANCE",
-		"DT_MIPS_DELTA_INSTANCE_NO",
-		"DT_MIPS_DELTA_RELOC",
-		"DT_MIPS_DELTA_RELOC_NO",
-		"DT_MIPS_DELTA_SYM",
-		"DT_MIPS_DELTA_SYM_NO",
-		"DT_MIPS_DYNSTR_ALIGN",
-		"DT_MIPS_FLAGS",
-		"DT_MIPS_GOTSYM",
-		"DT_MIPS_GP_VALUE",
-		"DT_MIPS_HIDDEN_GOTIDX",
-		"DT_MIPS_HIPAGENO",
-		"DT_MIPS_ICHECKSUM",
-		"DT_MIPS_INTERFACE",
-		"DT_MIPS_INTERFACE_SIZE",
-		"DT_MIPS_IVERSION",
-		"DT_MIPS_LIBLIST",
-		"DT_MIPS_LIBLISTNO",
-		"DT_MIPS_LOCALPAGE_GOTIDX",
-		"DT_MIPS_LOCAL_GOTIDX",
-		"DT_MIPS_LOCAL_GOTNO",
-		"DT_MIPS_MSYM",
-		"DT_MIPS_OPTIONS",
-		"DT_MIPS_PERF_SUFFIX",
-		"DT_MIPS_PIXIE_INIT",
-		"DT_MIPS_PLTGOT",
-		"DT_MIPS_PROTECTED_GOTIDX",
-		"DT_MIPS_RLD_MAP",
-		"DT_MIPS_RLD_MAP_REL",
-		"DT_MIPS_RLD_TEXT_RESOLVE_ADDR",
-		"DT_MIPS_RLD_VERSION",
-		"DT_MIPS_RWPLT",
-		"DT_MIPS_SYMBOL_LIB",
-		"DT_MIPS_SYMTABNO",
-		"DT_MIPS_TIME_STAMP",
-		"DT_MIPS_UNREFEXTNO",
-		"DT_MOVEENT",
-		"DT_MOVESZ",
-		"DT_MOVETAB",
-		"DT_NEEDED",
-		"DT_NULL",
-		"DT_PLTGOT",
-		"DT_PLTPAD",
-		"DT_PLTPADSZ",
-		"DT_PLTREL",
-		"DT_PLTRELSZ",
-		"DT_POSFLAG_1",
-		"DT_PPC64_GLINK",
-		"DT_PPC64_OPD",
-		"DT_PPC64_OPDSZ",
-		"DT_PPC64_OPT",
-		"DT_PPC_GOT",
-		"DT_PPC_OPT",
-		"DT_PREINIT_ARRAY",
-		"DT_PREINIT_ARRAYSZ",
-		"DT_REL",
-		"DT_RELA",
-		"DT_RELACOUNT",
-		"DT_RELAENT",
-		"DT_RELASZ",
-		"DT_RELCOUNT",
-		"DT_RELENT",
-		"DT_RELSZ",
-		"DT_RPATH",
-		"DT_RUNPATH",
-		"DT_SONAME",
-		"DT_SPARC_REGISTER",
-		"DT_STRSZ",
-		"DT_STRTAB",
-		"DT_SYMBOLIC",
-		"DT_SYMENT",
-		"DT_SYMINENT",
-		"DT_SYMINFO",
-		"DT_SYMINSZ",
-		"DT_SYMTAB",
-		"DT_SYMTAB_SHNDX",
-		"DT_TEXTREL",
-		"DT_TLSDESC_GOT",
-		"DT_TLSDESC_PLT",
-		"DT_USED",
-		"DT_VALRNGHI",
-		"DT_VALRNGLO",
-		"DT_VERDEF",
-		"DT_VERDEFNUM",
-		"DT_VERNEED",
-		"DT_VERNEEDNUM",
-		"DT_VERSYM",
-		"Data",
-		"Dyn32",
-		"Dyn64",
-		"DynFlag",
-		"DynTag",
-		"EI_ABIVERSION",
-		"EI_CLASS",
-		"EI_DATA",
-		"EI_NIDENT",
-		"EI_OSABI",
-		"EI_PAD",
-		"EI_VERSION",
-		"ELFCLASS32",
-		"ELFCLASS64",
-		"ELFCLASSNONE",
-		"ELFDATA2LSB",
-		"ELFDATA2MSB",
-		"ELFDATANONE",
-		"ELFMAG",
-		"ELFOSABI_86OPEN",
-		"ELFOSABI_AIX",
-		"ELFOSABI_ARM",
-		"ELFOSABI_AROS",
-		"ELFOSABI_CLOUDABI",
-		"ELFOSABI_FENIXOS",
-		"ELFOSABI_FREEBSD",
-		"ELFOSABI_HPUX",
-		"ELFOSABI_HURD",
-		"ELFOSABI_IRIX",
-		"ELFOSABI_LINUX",
-		"ELFOSABI_MODESTO",
-		"ELFOSABI_NETBSD",
-		"ELFOSABI_NONE",
-		"ELFOSABI_NSK",
-		"ELFOSABI_OPENBSD",
-		"ELFOSABI_OPENVMS",
-		"ELFOSABI_SOLARIS",
-		"ELFOSABI_STANDALONE",
-		"ELFOSABI_TRU64",
-		"EM_386",
-		"EM_486",
-		"EM_56800EX",
-		"EM_68HC05",
-		"EM_68HC08",
-		"EM_68HC11",
-		"EM_68HC12",
-		"EM_68HC16",
-		"EM_68K",
-		"EM_78KOR",
-		"EM_8051",
-		"EM_860",
-		"EM_88K",
-		"EM_960",
-		"EM_AARCH64",
-		"EM_ALPHA",
-		"EM_ALPHA_STD",
-		"EM_ALTERA_NIOS2",
-		"EM_AMDGPU",
-		"EM_ARC",
-		"EM_ARCA",
-		"EM_ARC_COMPACT",
-		"EM_ARC_COMPACT2",
-		"EM_ARM",
-		"EM_AVR",
-		"EM_AVR32",
-		"EM_BA1",
-		"EM_BA2",
-		"EM_BLACKFIN",
-		"EM_BPF",
-		"EM_C166",
-		"EM_CDP",
-		"EM_CE",
-		"EM_CLOUDSHIELD",
-		"EM_COGE",
-		"EM_COLDFIRE",
-		"EM_COOL",
-		"EM_COREA_1ST",
-		"EM_COREA_2ND",
-		"EM_CR",
-		"EM_CR16",
-		"EM_CRAYNV2",
-		"EM_CRIS",
-		"EM_CRX",
-		"EM_CSR_KALIMBA",
-		"EM_CUDA",
-		"EM_CYPRESS_M8C",
-		"EM_D10V",
-		"EM_D30V",
-		"EM_DSP24",
-		"EM_DSPIC30F",
-		"EM_DXP",
-		"EM_ECOG1",
-		"EM_ECOG16",
-		"EM_ECOG1X",
-		"EM_ECOG2",
-		"EM_ETPU",
-		"EM_EXCESS",
-		"EM_F2MC16",
-		"EM_FIREPATH",
-		"EM_FR20",
-		"EM_FR30",
-		"EM_FT32",
-		"EM_FX66",
-		"EM_H8S",
-		"EM_H8_300",
-		"EM_H8_300H",
-		"EM_H8_500",
-		"EM_HUANY",
-		"EM_IA_64",
-		"EM_INTEL205",
-		"EM_INTEL206",
-		"EM_INTEL207",
-		"EM_INTEL208",
-		"EM_INTEL209",
-		"EM_IP2K",
-		"EM_JAVELIN",
-		"EM_K10M",
-		"EM_KM32",
-		"EM_KMX16",
-		"EM_KMX32",
-		"EM_KMX8",
-		"EM_KVARC",
-		"EM_L10M",
-		"EM_LANAI",
-		"EM_LATTICEMICO32",
-		"EM_LOONGARCH",
-		"EM_M16C",
-		"EM_M32",
-		"EM_M32C",
-		"EM_M32R",
-		"EM_MANIK",
-		"EM_MAX",
-		"EM_MAXQ30",
-		"EM_MCHP_PIC",
-		"EM_MCST_ELBRUS",
-		"EM_ME16",
-		"EM_METAG",
-		"EM_MICROBLAZE",
-		"EM_MIPS",
-		"EM_MIPS_RS3_LE",
-		"EM_MIPS_RS4_BE",
-		"EM_MIPS_X",
-		"EM_MMA",
-		"EM_MMDSP_PLUS",
-		"EM_MMIX",
-		"EM_MN10200",
-		"EM_MN10300",
-		"EM_MOXIE",
-		"EM_MSP430",
-		"EM_NCPU",
-		"EM_NDR1",
-		"EM_NDS32",
-		"EM_NONE",
-		"EM_NORC",
-		"EM_NS32K",
-		"EM_OPEN8",
-		"EM_OPENRISC",
-		"EM_PARISC",
-		"EM_PCP",
-		"EM_PDP10",
-		"EM_PDP11",
-		"EM_PDSP",
-		"EM_PJ",
-		"EM_PPC",
-		"EM_PPC64",
-		"EM_PRISM",
-		"EM_QDSP6",
-		"EM_R32C",
-		"EM_RCE",
-		"EM_RH32",
-		"EM_RISCV",
-		"EM_RL78",
-		"EM_RS08",
-		"EM_RX",
-		"EM_S370",
-		"EM_S390",
-		"EM_SCORE7",
-		"EM_SEP",
-		"EM_SE_C17",
-		"EM_SE_C33",
-		"EM_SH",
-		"EM_SHARC",
-		"EM_SLE9X",
-		"EM_SNP1K",
-		"EM_SPARC",
-		"EM_SPARC32PLUS",
-		"EM_SPARCV9",
-		"EM_ST100",
-		"EM_ST19",
-		"EM_ST200",
-		"EM_ST7",
-		"EM_ST9PLUS",
-		"EM_STARCORE",
-		"EM_STM8",
-		"EM_STXP7X",
-		"EM_SVX",
-		"EM_TILE64",
-		"EM_TILEGX",
-		"EM_TILEPRO",
-		"EM_TINYJ",
-		"EM_TI_ARP32",
-		"EM_TI_C2000",
-		"EM_TI_C5500",
-		"EM_TI_C6000",
-		"EM_TI_PRU",
-		"EM_TMM_GPP",
-		"EM_TPC",
-		"EM_TRICORE",
-		"EM_TRIMEDIA",
-		"EM_TSK3000",
-		"EM_UNICORE",
-		"EM_V800",
-		"EM_V850",
-		"EM_VAX",
-		"EM_VIDEOCORE",
-		"EM_VIDEOCORE3",
-		"EM_VIDEOCORE5",
-		"EM_VISIUM",
-		"EM_VPP500",
-		"EM_X86_64",
-		"EM_XCORE",
-		"EM_XGATE",
-		"EM_XIMO16",
-		"EM_XTENSA",
-		"EM_Z80",
-		"EM_ZSP",
-		"ET_CORE",
-		"ET_DYN",
-		"ET_EXEC",
-		"ET_HIOS",
-		"ET_HIPROC",
-		"ET_LOOS",
-		"ET_LOPROC",
-		"ET_NONE",
-		"ET_REL",
-		"EV_CURRENT",
-		"EV_NONE",
-		"ErrNoSymbols",
-		"File",
-		"FileHeader",
-		"FormatError",
-		"Header32",
-		"Header64",
-		"ImportedSymbol",
-		"Machine",
-		"NT_FPREGSET",
-		"NT_PRPSINFO",
-		"NT_PRSTATUS",
-		"NType",
-		"NewFile",
-		"OSABI",
-		"Open",
-		"PF_MASKOS",
-		"PF_MASKPROC",
-		"PF_R",
-		"PF_W",
-		"PF_X",
-		"PT_AARCH64_ARCHEXT",
-		"PT_AARCH64_UNWIND",
-		"PT_ARM_ARCHEXT",
-		"PT_ARM_EXIDX",
-		"PT_DYNAMIC",
-		"PT_GNU_EH_FRAME",
-		"PT_GNU_MBIND_HI",
-		"PT_GNU_MBIND_LO",
-		"PT_GNU_PROPERTY",
-		"PT_GNU_RELRO",
-		"PT_GNU_STACK",
-		"PT_HIOS",
-		"PT_HIPROC",
-		"PT_INTERP",
-		"PT_LOAD",
-		"PT_LOOS",
-		"PT_LOPROC",
-		"PT_MIPS_ABIFLAGS",
-		"PT_MIPS_OPTIONS",
-		"PT_MIPS_REGINFO",
-		"PT_MIPS_RTPROC",
-		"PT_NOTE",
-		"PT_NULL",
-		"PT_OPENBSD_BOOTDATA",
-		"PT_OPENBSD_RANDOMIZE",
-		"PT_OPENBSD_WXNEEDED",
-		"PT_PAX_FLAGS",
-		"PT_PHDR",
-		"PT_S390_PGSTE",
-		"PT_SHLIB",
-		"PT_SUNWSTACK",
-		"PT_SUNW_EH_FRAME",
-		"PT_TLS",
-		"Prog",
-		"Prog32",
-		"Prog64",
-		"ProgFlag",
-		"ProgHeader",
-		"ProgType",
-		"R_386",
-		"R_386_16",
-		"R_386_32",
-		"R_386_32PLT",
-		"R_386_8",
-		"R_386_COPY",
-		"R_386_GLOB_DAT",
-		"R_386_GOT32",
-		"R_386_GOT32X",
-		"R_386_GOTOFF",
-		"R_386_GOTPC",
-		"R_386_IRELATIVE",
-		"R_386_JMP_SLOT",
-		"R_386_NONE",
-		"R_386_PC16",
-		"R_386_PC32",
-		"R_386_PC8",
-		"R_386_PLT32",
-		"R_386_RELATIVE",
-		"R_386_SIZE32",
-		"R_386_TLS_DESC",
-		"R_386_TLS_DESC_CALL",
-		"R_386_TLS_DTPMOD32",
-		"R_386_TLS_DTPOFF32",
-		"R_386_TLS_GD",
-		"R_386_TLS_GD_32",
-		"R_386_TLS_GD_CALL",
-		"R_386_TLS_GD_POP",
-		"R_386_TLS_GD_PUSH",
-		"R_386_TLS_GOTDESC",
-		"R_386_TLS_GOTIE",
-		"R_386_TLS_IE",
-		"R_386_TLS_IE_32",
-		"R_386_TLS_LDM",
-		"R_386_TLS_LDM_32",
-		"R_386_TLS_LDM_CALL",
-		"R_386_TLS_LDM_POP",
-		"R_386_TLS_LDM_PUSH",
-		"R_386_TLS_LDO_32",
-		"R_386_TLS_LE",
-		"R_386_TLS_LE_32",
-		"R_386_TLS_TPOFF",
-		"R_386_TLS_TPOFF32",
-		"R_390",
-		"R_390_12",
-		"R_390_16",
-		"R_390_20",
-		"R_390_32",
-		"R_390_64",
-		"R_390_8",
-		"R_390_COPY",
-		"R_390_GLOB_DAT",
-		"R_390_GOT12",
-		"R_390_GOT16",
-		"R_390_GOT20",
-		"R_390_GOT32",
-		"R_390_GOT64",
-		"R_390_GOTENT",
-		"R_390_GOTOFF",
-		"R_390_GOTOFF16",
-		"R_390_GOTOFF64",
-		"R_390_GOTPC",
-		"R_390_GOTPCDBL",
-		"R_390_GOTPLT12",
-		"R_390_GOTPLT16",
-		"R_390_GOTPLT20",
-		"R_390_GOTPLT32",
-		"R_390_GOTPLT64",
-		"R_390_GOTPLTENT",
-		"R_390_GOTPLTOFF16",
-		"R_390_GOTPLTOFF32",
-		"R_390_GOTPLTOFF64",
-		"R_390_JMP_SLOT",
-		"R_390_NONE",
-		"R_390_PC16",
-		"R_390_PC16DBL",
-		"R_390_PC32",
-		"R_390_PC32DBL",
-		"R_390_PC64",
-		"R_390_PLT16DBL",
-		"R_390_PLT32",
-		"R_390_PLT32DBL",
-		"R_390_PLT64",
-		"R_390_RELATIVE",
-		"R_390_TLS_DTPMOD",
-		"R_390_TLS_DTPOFF",
-		"R_390_TLS_GD32",
-		"R_390_TLS_GD64",
-		"R_390_TLS_GDCALL",
-		"R_390_TLS_GOTIE12",
-		"R_390_TLS_GOTIE20",
-		"R_390_TLS_GOTIE32",
-		"R_390_TLS_GOTIE64",
-		"R_390_TLS_IE32",
-		"R_390_TLS_IE64",
-		"R_390_TLS_IEENT",
-		"R_390_TLS_LDCALL",
-		"R_390_TLS_LDM32",
-		"R_390_TLS_LDM64",
-		"R_390_TLS_LDO32",
-		"R_390_TLS_LDO64",
-		"R_390_TLS_LE32",
-		"R_390_TLS_LE64",
-		"R_390_TLS_LOAD",
-		"R_390_TLS_TPOFF",
-		"R_AARCH64",
-		"R_AARCH64_ABS16",
-		"R_AARCH64_ABS32",
-		"R_AARCH64_ABS64",
-		"R_AARCH64_ADD_ABS_LO12_NC",
-		"R_AARCH64_ADR_GOT_PAGE",
-		"R_AARCH64_ADR_PREL_LO21",
-		"R_AARCH64_ADR_PREL_PG_HI21",
-		"R_AARCH64_ADR_PREL_PG_HI21_NC",
-		"R_AARCH64_CALL26",
-		"R_AARCH64_CONDBR19",
-		"R_AARCH64_COPY",
-		"R_AARCH64_GLOB_DAT",
-		"R_AARCH64_GOT_LD_PREL19",
-		"R_AARCH64_IRELATIVE",
-		"R_AARCH64_JUMP26",
-		"R_AARCH64_JUMP_SLOT",
-		"R_AARCH64_LD64_GOTOFF_LO15",
-		"R_AARCH64_LD64_GOTPAGE_LO15",
-		"R_AARCH64_LD64_GOT_LO12_NC",
-		"R_AARCH64_LDST128_ABS_LO12_NC",
-		"R_AARCH64_LDST16_ABS_LO12_NC",
-		"R_AARCH64_LDST32_ABS_LO12_NC",
-		"R_AARCH64_LDST64_ABS_LO12_NC",
-		"R_AARCH64_LDST8_ABS_LO12_NC",
-		"R_AARCH64_LD_PREL_LO19",
-		"R_AARCH64_MOVW_SABS_G0",
-		"R_AARCH64_MOVW_SABS_G1",
-		"R_AARCH64_MOVW_SABS_G2",
-		"R_AARCH64_MOVW_UABS_G0",
-		"R_AARCH64_MOVW_UABS_G0_NC",
-		"R_AARCH64_MOVW_UABS_G1",
-		"R_AARCH64_MOVW_UABS_G1_NC",
-		"R_AARCH64_MOVW_UABS_G2",
-		"R_AARCH64_MOVW_UABS_G2_NC",
-		"R_AARCH64_MOVW_UABS_G3",
-		"R_AARCH64_NONE",
-		"R_AARCH64_NULL",
-		"R_AARCH64_P32_ABS16",
-		"R_AARCH64_P32_ABS32",
-		"R_AARCH64_P32_ADD_ABS_LO12_NC",
-		"R_AARCH64_P32_ADR_GOT_PAGE",
-		"R_AARCH64_P32_ADR_PREL_LO21",
-		"R_AARCH64_P32_ADR_PREL_PG_HI21",
-		"R_AARCH64_P32_CALL26",
-		"R_AARCH64_P32_CONDBR19",
-		"R_AARCH64_P32_COPY",
-		"R_AARCH64_P32_GLOB_DAT",
-		"R_AARCH64_P32_GOT_LD_PREL19",
-		"R_AARCH64_P32_IRELATIVE",
-		"R_AARCH64_P32_JUMP26",
-		"R_AARCH64_P32_JUMP_SLOT",
-		"R_AARCH64_P32_LD32_GOT_LO12_NC",
-		"R_AARCH64_P32_LDST128_ABS_LO12_NC",
-		"R_AARCH64_P32_LDST16_ABS_LO12_NC",
-		"R_AARCH64_P32_LDST32_ABS_LO12_NC",
-		"R_AARCH64_P32_LDST64_ABS_LO12_NC",
-		"R_AARCH64_P32_LDST8_ABS_LO12_NC",
-		"R_AARCH64_P32_LD_PREL_LO19",
-		"R_AARCH64_P32_MOVW_SABS_G0",
-		"R_AARCH64_P32_MOVW_UABS_G0",
-		"R_AARCH64_P32_MOVW_UABS_G0_NC",
-		"R_AARCH64_P32_MOVW_UABS_G1",
-		"R_AARCH64_P32_PREL16",
-		"R_AARCH64_P32_PREL32",
-		"R_AARCH64_P32_RELATIVE",
-		"R_AARCH64_P32_TLSDESC",
-		"R_AARCH64_P32_TLSDESC_ADD_LO12_NC",
-		"R_AARCH64_P32_TLSDESC_ADR_PAGE21",
-		"R_AARCH64_P32_TLSDESC_ADR_PREL21",
-		"R_AARCH64_P32_TLSDESC_CALL",
-		"R_AARCH64_P32_TLSDESC_LD32_LO12_NC",
-		"R_AARCH64_P32_TLSDESC_LD_PREL19",
-		"R_AARCH64_P32_TLSGD_ADD_LO12_NC",
-		"R_AARCH64_P32_TLSGD_ADR_PAGE21",
-		"R_AARCH64_P32_TLSIE_ADR_GOTTPREL_PAGE21",
-		"R_AARCH64_P32_TLSIE_LD32_GOTTPREL_LO12_NC",
-		"R_AARCH64_P32_TLSIE_LD_GOTTPREL_PREL19",
-		"R_AARCH64_P32_TLSLE_ADD_TPREL_HI12",
-		"R_AARCH64_P32_TLSLE_ADD_TPREL_LO12",
-		"R_AARCH64_P32_TLSLE_ADD_TPREL_LO12_NC",
-		"R_AARCH64_P32_TLSLE_MOVW_TPREL_G0",
-		"R_AARCH64_P32_TLSLE_MOVW_TPREL_G0_NC",
-		"R_AARCH64_P32_TLSLE_MOVW_TPREL_G1",
-		"R_AARCH64_P32_TLS_DTPMOD",
-		"R_AARCH64_P32_TLS_DTPREL",
-		"R_AARCH64_P32_TLS_TPREL",
-		"R_AARCH64_P32_TSTBR14",
-		"R_AARCH64_PREL16",
-		"R_AARCH64_PREL32",
-		"R_AARCH64_PREL64",
-		"R_AARCH64_RELATIVE",
-		"R_AARCH64_TLSDESC",
-		"R_AARCH64_TLSDESC_ADD",
-		"R_AARCH64_TLSDESC_ADD_LO12_NC",
-		"R_AARCH64_TLSDESC_ADR_PAGE21",
-		"R_AARCH64_TLSDESC_ADR_PREL21",
-		"R_AARCH64_TLSDESC_CALL",
-		"R_AARCH64_TLSDESC_LD64_LO12_NC",
-		"R_AARCH64_TLSDESC_LDR",
-		"R_AARCH64_TLSDESC_LD_PREL19",
-		"R_AARCH64_TLSDESC_OFF_G0_NC",
-		"R_AARCH64_TLSDESC_OFF_G1",
-		"R_AARCH64_TLSGD_ADD_LO12_NC",
-		"R_AARCH64_TLSGD_ADR_PAGE21",
-		"R_AARCH64_TLSGD_ADR_PREL21",
-		"R_AARCH64_TLSGD_MOVW_G0_NC",
-		"R_AARCH64_TLSGD_MOVW_G1",
-		"R_AARCH64_TLSIE_ADR_GOTTPREL_PAGE21",
-		"R_AARCH64_TLSIE_LD64_GOTTPREL_LO12_NC",
-		"R_AARCH64_TLSIE_LD_GOTTPREL_PREL19",
-		"R_AARCH64_TLSIE_MOVW_GOTTPREL_G0_NC",
-		"R_AARCH64_TLSIE_MOVW_GOTTPREL_G1",
-		"R_AARCH64_TLSLD_ADR_PAGE21",
-		"R_AARCH64_TLSLD_ADR_PREL21",
-		"R_AARCH64_TLSLD_LDST128_DTPREL_LO12",
-		"R_AARCH64_TLSLD_LDST128_DTPREL_LO12_NC",
-		"R_AARCH64_TLSLE_ADD_TPREL_HI12",
-		"R_AARCH64_TLSLE_ADD_TPREL_LO12",
-		"R_AARCH64_TLSLE_ADD_TPREL_LO12_NC",
-		"R_AARCH64_TLSLE_LDST128_TPREL_LO12",
-		"R_AARCH64_TLSLE_LDST128_TPREL_LO12_NC",
-		"R_AARCH64_TLSLE_MOVW_TPREL_G0",
-		"R_AARCH64_TLSLE_MOVW_TPREL_G0_NC",
-		"R_AARCH64_TLSLE_MOVW_TPREL_G1",
-		"R_AARCH64_TLSLE_MOVW_TPREL_G1_NC",
-		"R_AARCH64_TLSLE_MOVW_TPREL_G2",
-		"R_AARCH64_TLS_DTPMOD64",
-		"R_AARCH64_TLS_DTPREL64",
-		"R_AARCH64_TLS_TPREL64",
-		"R_AARCH64_TSTBR14",
-		"R_ALPHA",
-		"R_ALPHA_BRADDR",
-		"R_ALPHA_COPY",
-		"R_ALPHA_GLOB_DAT",
-		"R_ALPHA_GPDISP",
-		"R_ALPHA_GPREL32",
-		"R_ALPHA_GPRELHIGH",
-		"R_ALPHA_GPRELLOW",
-		"R_ALPHA_GPVALUE",
-		"R_ALPHA_HINT",
-		"R_ALPHA_IMMED_BR_HI32",
-		"R_ALPHA_IMMED_GP_16",
-		"R_ALPHA_IMMED_GP_HI32",
-		"R_ALPHA_IMMED_LO32",
-		"R_ALPHA_IMMED_SCN_HI32",
-		"R_ALPHA_JMP_SLOT",
-		"R_ALPHA_LITERAL",
-		"R_ALPHA_LITUSE",
-		"R_ALPHA_NONE",
-		"R_ALPHA_OP_PRSHIFT",
-		"R_ALPHA_OP_PSUB",
-		"R_ALPHA_OP_PUSH",
-		"R_ALPHA_OP_STORE",
-		"R_ALPHA_REFLONG",
-		"R_ALPHA_REFQUAD",
-		"R_ALPHA_RELATIVE",
-		"R_ALPHA_SREL16",
-		"R_ALPHA_SREL32",
-		"R_ALPHA_SREL64",
-		"R_ARM",
-		"R_ARM_ABS12",
-		"R_ARM_ABS16",
-		"R_ARM_ABS32",
-		"R_ARM_ABS32_NOI",
-		"R_ARM_ABS8",
-		"R_ARM_ALU_PCREL_15_8",
-		"R_ARM_ALU_PCREL_23_15",
-		"R_ARM_ALU_PCREL_7_0",
-		"R_ARM_ALU_PC_G0",
-		"R_ARM_ALU_PC_G0_NC",
-		"R_ARM_ALU_PC_G1",
-		"R_ARM_ALU_PC_G1_NC",
-		"R_ARM_ALU_PC_G2",
-		"R_ARM_ALU_SBREL_19_12_NC",
-		"R_ARM_ALU_SBREL_27_20_CK",
-		"R_ARM_ALU_SB_G0",
-		"R_ARM_ALU_SB_G0_NC",
-		"R_ARM_ALU_SB_G1",
-		"R_ARM_ALU_SB_G1_NC",
-		"R_ARM_ALU_SB_G2",
-		"R_ARM_AMP_VCALL9",
-		"R_ARM_BASE_ABS",
-		"R_ARM_CALL",
-		"R_ARM_COPY",
-		"R_ARM_GLOB_DAT",
-		"R_ARM_GNU_VTENTRY",
-		"R_ARM_GNU_VTINHERIT",
-		"R_ARM_GOT32",
-		"R_ARM_GOTOFF",
-		"R_ARM_GOTOFF12",
-		"R_ARM_GOTPC",
-		"R_ARM_GOTRELAX",
-		"R_ARM_GOT_ABS",
-		"R_ARM_GOT_BREL12",
-		"R_ARM_GOT_PREL",
-		"R_ARM_IRELATIVE",
-		"R_ARM_JUMP24",
-		"R_ARM_JUMP_SLOT",
-		"R_ARM_LDC_PC_G0",
-		"R_ARM_LDC_PC_G1",
-		"R_ARM_LDC_PC_G2",
-		"R_ARM_LDC_SB_G0",
-		"R_ARM_LDC_SB_G1",
-		"R_ARM_LDC_SB_G2",
-		"R_ARM_LDRS_PC_G0",
-		"R_ARM_LDRS_PC_G1",
-		"R_ARM_LDRS_PC_G2",
-		"R_ARM_LDRS_SB_G0",
-		"R_ARM_LDRS_SB_G1",
-		"R_ARM_LDRS_SB_G2",
-		"R_ARM_LDR_PC_G1",
-		"R_ARM_LDR_PC_G2",
-		"R_ARM_LDR_SBREL_11_10_NC",
-		"R_ARM_LDR_SB_G0",
-		"R_ARM_LDR_SB_G1",
-		"R_ARM_LDR_SB_G2",
-		"R_ARM_ME_TOO",
-		"R_ARM_MOVT_ABS",
-		"R_ARM_MOVT_BREL",
-		"R_ARM_MOVT_PREL",
-		"R_ARM_MOVW_ABS_NC",
-		"R_ARM_MOVW_BREL",
-		"R_ARM_MOVW_BREL_NC",
-		"R_ARM_MOVW_PREL_NC",
-		"R_ARM_NONE",
-		"R_ARM_PC13",
-		"R_ARM_PC24",
-		"R_ARM_PLT32",
-		"R_ARM_PLT32_ABS",
-		"R_ARM_PREL31",
-		"R_ARM_PRIVATE_0",
-		"R_ARM_PRIVATE_1",
-		"R_ARM_PRIVATE_10",
-		"R_ARM_PRIVATE_11",
-		"R_ARM_PRIVATE_12",
-		"R_ARM_PRIVATE_13",
-		"R_ARM_PRIVATE_14",
-		"R_ARM_PRIVATE_15",
-		"R_ARM_PRIVATE_2",
-		"R_ARM_PRIVATE_3",
-		"R_ARM_PRIVATE_4",
-		"R_ARM_PRIVATE_5",
-		"R_ARM_PRIVATE_6",
-		"R_ARM_PRIVATE_7",
-		"R_ARM_PRIVATE_8",
-		"R_ARM_PRIVATE_9",
-		"R_ARM_RABS32",
-		"R_ARM_RBASE",
-		"R_ARM_REL32",
-		"R_ARM_REL32_NOI",
-		"R_ARM_RELATIVE",
-		"R_ARM_RPC24",
-		"R_ARM_RREL32",
-		"R_ARM_RSBREL32",
-		"R_ARM_RXPC25",
-		"R_ARM_SBREL31",
-		"R_ARM_SBREL32",
-		"R_ARM_SWI24",
-		"R_ARM_TARGET1",
-		"R_ARM_TARGET2",
-		"R_ARM_THM_ABS5",
-		"R_ARM_THM_ALU_ABS_G0_NC",
-		"R_ARM_THM_ALU_ABS_G1_NC",
-		"R_ARM_THM_ALU_ABS_G2_NC",
-		"R_ARM_THM_ALU_ABS_G3",
-		"R_ARM_THM_ALU_PREL_11_0",
-		"R_ARM_THM_GOT_BREL12",
-		"R_ARM_THM_JUMP11",
-		"R_ARM_THM_JUMP19",
-		"R_ARM_THM_JUMP24",
-		"R_ARM_THM_JUMP6",
-		"R_ARM_THM_JUMP8",
-		"R_ARM_THM_MOVT_ABS",
-		"R_ARM_THM_MOVT_BREL",
-		"R_ARM_THM_MOVT_PREL",
-		"R_ARM_THM_MOVW_ABS_NC",
-		"R_ARM_THM_MOVW_BREL",
-		"R_ARM_THM_MOVW_BREL_NC",
-		"R_ARM_THM_MOVW_PREL_NC",
-		"R_ARM_THM_PC12",
-		"R_ARM_THM_PC22",
-		"R_ARM_THM_PC8",
-		"R_ARM_THM_RPC22",
-		"R_ARM_THM_SWI8",
-		"R_ARM_THM_TLS_CALL",
-		"R_ARM_THM_TLS_DESCSEQ16",
-		"R_ARM_THM_TLS_DESCSEQ32",
-		"R_ARM_THM_XPC22",
-		"R_ARM_TLS_CALL",
-		"R_ARM_TLS_DESCSEQ",
-		"R_ARM_TLS_DTPMOD32",
-		"R_ARM_TLS_DTPOFF32",
-		"R_ARM_TLS_GD32",
-		"R_ARM_TLS_GOTDESC",
-		"R_ARM_TLS_IE12GP",
-		"R_ARM_TLS_IE32",
-		"R_ARM_TLS_LDM32",
-		"R_ARM_TLS_LDO12",
-		"R_ARM_TLS_LDO32",
-		"R_ARM_TLS_LE12",
-		"R_ARM_TLS_LE32",
-		"R_ARM_TLS_TPOFF32",
-		"R_ARM_V4BX",
-		"R_ARM_XPC25",
-		"R_INFO",
-		"R_INFO32",
-		"R_LARCH",
-		"R_LARCH_32",
-		"R_LARCH_32_PCREL",
-		"R_LARCH_64",
-		"R_LARCH_ABS64_HI12",
-		"R_LARCH_ABS64_LO20",
-		"R_LARCH_ABS_HI20",
-		"R_LARCH_ABS_LO12",
-		"R_LARCH_ADD16",
-		"R_LARCH_ADD24",
-		"R_LARCH_ADD32",
-		"R_LARCH_ADD64",
-		"R_LARCH_ADD8",
-		"R_LARCH_B16",
-		"R_LARCH_B21",
-		"R_LARCH_B26",
-		"R_LARCH_COPY",
-		"R_LARCH_GNU_VTENTRY",
-		"R_LARCH_GNU_VTINHERIT",
-		"R_LARCH_GOT64_HI12",
-		"R_LARCH_GOT64_LO20",
-		"R_LARCH_GOT64_PC_HI12",
-		"R_LARCH_GOT64_PC_LO20",
-		"R_LARCH_GOT_HI20",
-		"R_LARCH_GOT_LO12",
-		"R_LARCH_GOT_PC_HI20",
-		"R_LARCH_GOT_PC_LO12",
-		"R_LARCH_IRELATIVE",
-		"R_LARCH_JUMP_SLOT",
-		"R_LARCH_MARK_LA",
-		"R_LARCH_MARK_PCREL",
-		"R_LARCH_NONE",
-		"R_LARCH_PCALA64_HI12",
-		"R_LARCH_PCALA64_LO20",
-		"R_LARCH_PCALA_HI20",
-		"R_LARCH_PCALA_LO12",
-		"R_LARCH_RELATIVE",
-		"R_LARCH_RELAX",
-		"R_LARCH_SOP_ADD",
-		"R_LARCH_SOP_AND",
-		"R_LARCH_SOP_ASSERT",
-		"R_LARCH_SOP_IF_ELSE",
-		"R_LARCH_SOP_NOT",
-		"R_LARCH_SOP_POP_32_S_0_10_10_16_S2",
-		"R_LARCH_SOP_POP_32_S_0_5_10_16_S2",
-		"R_LARCH_SOP_POP_32_S_10_12",
-		"R_LARCH_SOP_POP_32_S_10_16",
-		"R_LARCH_SOP_POP_32_S_10_16_S2",
-		"R_LARCH_SOP_POP_32_S_10_5",
-		"R_LARCH_SOP_POP_32_S_5_20",
-		"R_LARCH_SOP_POP_32_U",
-		"R_LARCH_SOP_POP_32_U_10_12",
-		"R_LARCH_SOP_PUSH_ABSOLUTE",
-		"R_LARCH_SOP_PUSH_DUP",
-		"R_LARCH_SOP_PUSH_GPREL",
-		"R_LARCH_SOP_PUSH_PCREL",
-		"R_LARCH_SOP_PUSH_PLT_PCREL",
-		"R_LARCH_SOP_PUSH_TLS_GD",
-		"R_LARCH_SOP_PUSH_TLS_GOT",
-		"R_LARCH_SOP_PUSH_TLS_TPREL",
-		"R_LARCH_SOP_SL",
-		"R_LARCH_SOP_SR",
-		"R_LARCH_SOP_SUB",
-		"R_LARCH_SUB16",
-		"R_LARCH_SUB24",
-		"R_LARCH_SUB32",
-		"R_LARCH_SUB64",
-		"R_LARCH_SUB8",
-		"R_LARCH_TLS_DTPMOD32",
-		"R_LARCH_TLS_DTPMOD64",
-		"R_LARCH_TLS_DTPREL32",
-		"R_LARCH_TLS_DTPREL64",
-		"R_LARCH_TLS_GD_HI20",
-		"R_LARCH_TLS_GD_PC_HI20",
-		"R_LARCH_TLS_IE64_HI12",
-		"R_LARCH_TLS_IE64_LO20",
-		"R_LARCH_TLS_IE64_PC_HI12",
-		"R_LARCH_TLS_IE64_PC_LO20",
-		"R_LARCH_TLS_IE_HI20",
-		"R_LARCH_TLS_IE_LO12",
-		"R_LARCH_TLS_IE_PC_HI20",
-		"R_LARCH_TLS_IE_PC_LO12",
-		"R_LARCH_TLS_LD_HI20",
-		"R_LARCH_TLS_LD_PC_HI20",
-		"R_LARCH_TLS_LE64_HI12",
-		"R_LARCH_TLS_LE64_LO20",
-		"R_LARCH_TLS_LE_HI20",
-		"R_LARCH_TLS_LE_LO12",
-		"R_LARCH_TLS_TPREL32",
-		"R_LARCH_TLS_TPREL64",
-		"R_MIPS",
-		"R_MIPS_16",
-		"R_MIPS_26",
-		"R_MIPS_32",
-		"R_MIPS_64",
-		"R_MIPS_ADD_IMMEDIATE",
-		"R_MIPS_CALL16",
-		"R_MIPS_CALL_HI16",
-		"R_MIPS_CALL_LO16",
-		"R_MIPS_DELETE",
-		"R_MIPS_GOT16",
-		"R_MIPS_GOT_DISP",
-		"R_MIPS_GOT_HI16",
-		"R_MIPS_GOT_LO16",
-		"R_MIPS_GOT_OFST",
-		"R_MIPS_GOT_PAGE",
-		"R_MIPS_GPREL16",
-		"R_MIPS_GPREL32",
-		"R_MIPS_HI16",
-		"R_MIPS_HIGHER",
-		"R_MIPS_HIGHEST",
-		"R_MIPS_INSERT_A",
-		"R_MIPS_INSERT_B",
-		"R_MIPS_JALR",
-		"R_MIPS_LITERAL",
-		"R_MIPS_LO16",
-		"R_MIPS_NONE",
-		"R_MIPS_PC16",
-		"R_MIPS_PJUMP",
-		"R_MIPS_REL16",
-		"R_MIPS_REL32",
-		"R_MIPS_RELGOT",
-		"R_MIPS_SCN_DISP",
-		"R_MIPS_SHIFT5",
-		"R_MIPS_SHIFT6",
-		"R_MIPS_SUB",
-		"R_MIPS_TLS_DTPMOD32",
-		"R_MIPS_TLS_DTPMOD64",
-		"R_MIPS_TLS_DTPREL32",
-		"R_MIPS_TLS_DTPREL64",
-		"R_MIPS_TLS_DTPREL_HI16",
-		"R_MIPS_TLS_DTPREL_LO16",
-		"R_MIPS_TLS_GD",
-		"R_MIPS_TLS_GOTTPREL",
-		"R_MIPS_TLS_LDM",
-		"R_MIPS_TLS_TPREL32",
-		"R_MIPS_TLS_TPREL64",
-		"R_MIPS_TLS_TPREL_HI16",
-		"R_MIPS_TLS_TPREL_LO16",
-		"R_PPC",
-		"R_PPC64",
-		"R_PPC64_ADDR14",
-		"R_PPC64_ADDR14_BRNTAKEN",
-		"R_PPC64_ADDR14_BRTAKEN",
-		"R_PPC64_ADDR16",
-		"R_PPC64_ADDR16_DS",
-		"R_PPC64_ADDR16_HA",
-		"R_PPC64_ADDR16_HI",
-		"R_PPC64_ADDR16_HIGH",
-		"R_PPC64_ADDR16_HIGHA",
-		"R_PPC64_ADDR16_HIGHER",
-		"R_PPC64_ADDR16_HIGHER34",
-		"R_PPC64_ADDR16_HIGHERA",
-		"R_PPC64_ADDR16_HIGHERA34",
-		"R_PPC64_ADDR16_HIGHEST",
-		"R_PPC64_ADDR16_HIGHEST34",
-		"R_PPC64_ADDR16_HIGHESTA",
-		"R_PPC64_ADDR16_HIGHESTA34",
-		"R_PPC64_ADDR16_LO",
-		"R_PPC64_ADDR16_LO_DS",
-		"R_PPC64_ADDR24",
-		"R_PPC64_ADDR32",
-		"R_PPC64_ADDR64",
-		"R_PPC64_ADDR64_LOCAL",
-		"R_PPC64_COPY",
-		"R_PPC64_D28",
-		"R_PPC64_D34",
-		"R_PPC64_D34_HA30",
-		"R_PPC64_D34_HI30",
-		"R_PPC64_D34_LO",
-		"R_PPC64_DTPMOD64",
-		"R_PPC64_DTPREL16",
-		"R_PPC64_DTPREL16_DS",
-		"R_PPC64_DTPREL16_HA",
-		"R_PPC64_DTPREL16_HI",
-		"R_PPC64_DTPREL16_HIGH",
-		"R_PPC64_DTPREL16_HIGHA",
-		"R_PPC64_DTPREL16_HIGHER",
-		"R_PPC64_DTPREL16_HIGHERA",
-		"R_PPC64_DTPREL16_HIGHEST",
-		"R_PPC64_DTPREL16_HIGHESTA",
-		"R_PPC64_DTPREL16_LO",
-		"R_PPC64_DTPREL16_LO_DS",
-		"R_PPC64_DTPREL34",
-		"R_PPC64_DTPREL64",
-		"R_PPC64_ENTRY",
-		"R_PPC64_GLOB_DAT",
-		"R_PPC64_GNU_VTENTRY",
-		"R_PPC64_GNU_VTINHERIT",
-		"R_PPC64_GOT16",
-		"R_PPC64_GOT16_DS",
-		"R_PPC64_GOT16_HA",
-		"R_PPC64_GOT16_HI",
-		"R_PPC64_GOT16_LO",
-		"R_PPC64_GOT16_LO_DS",
-		"R_PPC64_GOT_DTPREL16_DS",
-		"R_PPC64_GOT_DTPREL16_HA",
-		"R_PPC64_GOT_DTPREL16_HI",
-		"R_PPC64_GOT_DTPREL16_LO_DS",
-		"R_PPC64_GOT_DTPREL_PCREL34",
-		"R_PPC64_GOT_PCREL34",
-		"R_PPC64_GOT_TLSGD16",
-		"R_PPC64_GOT_TLSGD16_HA",
-		"R_PPC64_GOT_TLSGD16_HI",
-		"R_PPC64_GOT_TLSGD16_LO",
-		"R_PPC64_GOT_TLSGD_PCREL34",
-		"R_PPC64_GOT_TLSLD16",
-		"R_PPC64_GOT_TLSLD16_HA",
-		"R_PPC64_GOT_TLSLD16_HI",
-		"R_PPC64_GOT_TLSLD16_LO",
-		"R_PPC64_GOT_TLSLD_PCREL34",
-		"R_PPC64_GOT_TPREL16_DS",
-		"R_PPC64_GOT_TPREL16_HA",
-		"R_PPC64_GOT_TPREL16_HI",
-		"R_PPC64_GOT_TPREL16_LO_DS",
-		"R_PPC64_GOT_TPREL_PCREL34",
-		"R_PPC64_IRELATIVE",
-		"R_PPC64_JMP_IREL",
-		"R_PPC64_JMP_SLOT",
-		"R_PPC64_NONE",
-		"R_PPC64_PCREL28",
-		"R_PPC64_PCREL34",
-		"R_PPC64_PCREL_OPT",
-		"R_PPC64_PLT16_HA",
-		"R_PPC64_PLT16_HI",
-		"R_PPC64_PLT16_LO",
-		"R_PPC64_PLT16_LO_DS",
-		"R_PPC64_PLT32",
-		"R_PPC64_PLT64",
-		"R_PPC64_PLTCALL",
-		"R_PPC64_PLTCALL_NOTOC",
-		"R_PPC64_PLTGOT16",
-		"R_PPC64_PLTGOT16_DS",
-		"R_PPC64_PLTGOT16_HA",
-		"R_PPC64_PLTGOT16_HI",
-		"R_PPC64_PLTGOT16_LO",
-		"R_PPC64_PLTGOT_LO_DS",
-		"R_PPC64_PLTREL32",
-		"R_PPC64_PLTREL64",
-		"R_PPC64_PLTSEQ",
-		"R_PPC64_PLTSEQ_NOTOC",
-		"R_PPC64_PLT_PCREL34",
-		"R_PPC64_PLT_PCREL34_NOTOC",
-		"R_PPC64_REL14",
-		"R_PPC64_REL14_BRNTAKEN",
-		"R_PPC64_REL14_BRTAKEN",
-		"R_PPC64_REL16",
-		"R_PPC64_REL16DX_HA",
-		"R_PPC64_REL16_HA",
-		"R_PPC64_REL16_HI",
-		"R_PPC64_REL16_HIGH",
-		"R_PPC64_REL16_HIGHA",
-		"R_PPC64_REL16_HIGHER",
-		"R_PPC64_REL16_HIGHER34",
-		"R_PPC64_REL16_HIGHERA",
-		"R_PPC64_REL16_HIGHERA34",
-		"R_PPC64_REL16_HIGHEST",
-		"R_PPC64_REL16_HIGHEST34",
-		"R_PPC64_REL16_HIGHESTA",
-		"R_PPC64_REL16_HIGHESTA34",
-		"R_PPC64_REL16_LO",
-		"R_PPC64_REL24",
-		"R_PPC64_REL24_NOTOC",
-		"R_PPC64_REL30",
-		"R_PPC64_REL32",
-		"R_PPC64_REL64",
-		"R_PPC64_RELATIVE",
-		"R_PPC64_SECTOFF",
-		"R_PPC64_SECTOFF_DS",
-		"R_PPC64_SECTOFF_HA",
-		"R_PPC64_SECTOFF_HI",
-		"R_PPC64_SECTOFF_LO",
-		"R_PPC64_SECTOFF_LO_DS",
-		"R_PPC64_TLS",
-		"R_PPC64_TLSGD",
-		"R_PPC64_TLSLD",
-		"R_PPC64_TOC",
-		"R_PPC64_TOC16",
-		"R_PPC64_TOC16_DS",
-		"R_PPC64_TOC16_HA",
-		"R_PPC64_TOC16_HI",
-		"R_PPC64_TOC16_LO",
-		"R_PPC64_TOC16_LO_DS",
-		"R_PPC64_TOCSAVE",
-		"R_PPC64_TPREL16",
-		"R_PPC64_TPREL16_DS",
-		"R_PPC64_TPREL16_HA",
-		"R_PPC64_TPREL16_HI",
-		"R_PPC64_TPREL16_HIGH",
-		"R_PPC64_TPREL16_HIGHA",
-		"R_PPC64_TPREL16_HIGHER",
-		"R_PPC64_TPREL16_HIGHERA",
-		"R_PPC64_TPREL16_HIGHEST",
-		"R_PPC64_TPREL16_HIGHESTA",
-		"R_PPC64_TPREL16_LO",
-		"R_PPC64_TPREL16_LO_DS",
-		"R_PPC64_TPREL34",
-		"R_PPC64_TPREL64",
-		"R_PPC64_UADDR16",
-		"R_PPC64_UADDR32",
-		"R_PPC64_UADDR64",
-		"R_PPC_ADDR14",
-		"R_PPC_ADDR14_BRNTAKEN",
-		"R_PPC_ADDR14_BRTAKEN",
-		"R_PPC_ADDR16",
-		"R_PPC_ADDR16_HA",
-		"R_PPC_ADDR16_HI",
-		"R_PPC_ADDR16_LO",
-		"R_PPC_ADDR24",
-		"R_PPC_ADDR32",
-		"R_PPC_COPY",
-		"R_PPC_DTPMOD32",
-		"R_PPC_DTPREL16",
-		"R_PPC_DTPREL16_HA",
-		"R_PPC_DTPREL16_HI",
-		"R_PPC_DTPREL16_LO",
-		"R_PPC_DTPREL32",
-		"R_PPC_EMB_BIT_FLD",
-		"R_PPC_EMB_MRKREF",
-		"R_PPC_EMB_NADDR16",
-		"R_PPC_EMB_NADDR16_HA",
-		"R_PPC_EMB_NADDR16_HI",
-		"R_PPC_EMB_NADDR16_LO",
-		"R_PPC_EMB_NADDR32",
-		"R_PPC_EMB_RELSDA",
-		"R_PPC_EMB_RELSEC16",
-		"R_PPC_EMB_RELST_HA",
-		"R_PPC_EMB_RELST_HI",
-		"R_PPC_EMB_RELST_LO",
-		"R_PPC_EMB_SDA21",
-		"R_PPC_EMB_SDA2I16",
-		"R_PPC_EMB_SDA2REL",
-		"R_PPC_EMB_SDAI16",
-		"R_PPC_GLOB_DAT",
-		"R_PPC_GOT16",
-		"R_PPC_GOT16_HA",
-		"R_PPC_GOT16_HI",
-		"R_PPC_GOT16_LO",
-		"R_PPC_GOT_TLSGD16",
-		"R_PPC_GOT_TLSGD16_HA",
-		"R_PPC_GOT_TLSGD16_HI",
-		"R_PPC_GOT_TLSGD16_LO",
-		"R_PPC_GOT_TLSLD16",
-		"R_PPC_GOT_TLSLD16_HA",
-		"R_PPC_GOT_TLSLD16_HI",
-		"R_PPC_GOT_TLSLD16_LO",
-		"R_PPC_GOT_TPREL16",
-		"R_PPC_GOT_TPREL16_HA",
-		"R_PPC_GOT_TPREL16_HI",
-		"R_PPC_GOT_TPREL16_LO",
-		"R_PPC_JMP_SLOT",
-		"R_PPC_LOCAL24PC",
-		"R_PPC_NONE",
-		"R_PPC_PLT16_HA",
-		"R_PPC_PLT16_HI",
-		"R_PPC_PLT16_LO",
-		"R_PPC_PLT32",
-		"R_PPC_PLTREL24",
-		"R_PPC_PLTREL32",
-		"R_PPC_REL14",
-		"R_PPC_REL14_BRNTAKEN",
-		"R_PPC_REL14_BRTAKEN",
-		"R_PPC_REL24",
-		"R_PPC_REL32",
-		"R_PPC_RELATIVE",
-		"R_PPC_SDAREL16",
-		"R_PPC_SECTOFF",
-		"R_PPC_SECTOFF_HA",
-		"R_PPC_SECTOFF_HI",
-		"R_PPC_SECTOFF_LO",
-		"R_PPC_TLS",
-		"R_PPC_TPREL16",
-		"R_PPC_TPREL16_HA",
-		"R_PPC_TPREL16_HI",
-		"R_PPC_TPREL16_LO",
-		"R_PPC_TPREL32",
-		"R_PPC_UADDR16",
-		"R_PPC_UADDR32",
-		"R_RISCV",
-		"R_RISCV_32",
-		"R_RISCV_32_PCREL",
-		"R_RISCV_64",
-		"R_RISCV_ADD16",
-		"R_RISCV_ADD32",
-		"R_RISCV_ADD64",
-		"R_RISCV_ADD8",
-		"R_RISCV_ALIGN",
-		"R_RISCV_BRANCH",
-		"R_RISCV_CALL",
-		"R_RISCV_CALL_PLT",
-		"R_RISCV_COPY",
-		"R_RISCV_GNU_VTENTRY",
-		"R_RISCV_GNU_VTINHERIT",
-		"R_RISCV_GOT_HI20",
-		"R_RISCV_GPREL_I",
-		"R_RISCV_GPREL_S",
-		"R_RISCV_HI20",
-		"R_RISCV_JAL",
-		"R_RISCV_JUMP_SLOT",
-		"R_RISCV_LO12_I",
-		"R_RISCV_LO12_S",
-		"R_RISCV_NONE",
-		"R_RISCV_PCREL_HI20",
-		"R_RISCV_PCREL_LO12_I",
-		"R_RISCV_PCREL_LO12_S",
-		"R_RISCV_RELATIVE",
-		"R_RISCV_RELAX",
-		"R_RISCV_RVC_BRANCH",
-		"R_RISCV_RVC_JUMP",
-		"R_RISCV_RVC_LUI",
-		"R_RISCV_SET16",
-		"R_RISCV_SET32",
-		"R_RISCV_SET6",
-		"R_RISCV_SET8",
-		"R_RISCV_SUB16",
-		"R_RISCV_SUB32",
-		"R_RISCV_SUB6",
-		"R_RISCV_SUB64",
-		"R_RISCV_SUB8",
-		"R_RISCV_TLS_DTPMOD32",
-		"R_RISCV_TLS_DTPMOD64",
-		"R_RISCV_TLS_DTPREL32",
-		"R_RISCV_TLS_DTPREL64",
-		"R_RISCV_TLS_GD_HI20",
-		"R_RISCV_TLS_GOT_HI20",
-		"R_RISCV_TLS_TPREL32",
-		"R_RISCV_TLS_TPREL64",
-		"R_RISCV_TPREL_ADD",
-		"R_RISCV_TPREL_HI20",
-		"R_RISCV_TPREL_I",
-		"R_RISCV_TPREL_LO12_I",
-		"R_RISCV_TPREL_LO12_S",
-		"R_RISCV_TPREL_S",
-		"R_SPARC",
-		"R_SPARC_10",
-		"R_SPARC_11",
-		"R_SPARC_13",
-		"R_SPARC_16",
-		"R_SPARC_22",
-		"R_SPARC_32",
-		"R_SPARC_5",
-		"R_SPARC_6",
-		"R_SPARC_64",
-		"R_SPARC_7",
-		"R_SPARC_8",
-		"R_SPARC_COPY",
-		"R_SPARC_DISP16",
-		"R_SPARC_DISP32",
-		"R_SPARC_DISP64",
-		"R_SPARC_DISP8",
-		"R_SPARC_GLOB_DAT",
-		"R_SPARC_GLOB_JMP",
-		"R_SPARC_GOT10",
-		"R_SPARC_GOT13",
-		"R_SPARC_GOT22",
-		"R_SPARC_H44",
-		"R_SPARC_HH22",
-		"R_SPARC_HI22",
-		"R_SPARC_HIPLT22",
-		"R_SPARC_HIX22",
-		"R_SPARC_HM10",
-		"R_SPARC_JMP_SLOT",
-		"R_SPARC_L44",
-		"R_SPARC_LM22",
-		"R_SPARC_LO10",
-		"R_SPARC_LOPLT10",
-		"R_SPARC_LOX10",
-		"R_SPARC_M44",
-		"R_SPARC_NONE",
-		"R_SPARC_OLO10",
-		"R_SPARC_PC10",
-		"R_SPARC_PC22",
-		"R_SPARC_PCPLT10",
-		"R_SPARC_PCPLT22",
-		"R_SPARC_PCPLT32",
-		"R_SPARC_PC_HH22",
-		"R_SPARC_PC_HM10",
-		"R_SPARC_PC_LM22",
-		"R_SPARC_PLT32",
-		"R_SPARC_PLT64",
-		"R_SPARC_REGISTER",
-		"R_SPARC_RELATIVE",
-		"R_SPARC_UA16",
-		"R_SPARC_UA32",
-		"R_SPARC_UA64",
-		"R_SPARC_WDISP16",
-		"R_SPARC_WDISP19",
-		"R_SPARC_WDISP22",
-		"R_SPARC_WDISP30",
-		"R_SPARC_WPLT30",
-		"R_SYM32",
-		"R_SYM64",
-		"R_TYPE32",
-		"R_TYPE64",
-		"R_X86_64",
-		"R_X86_64_16",
-		"R_X86_64_32",
-		"R_X86_64_32S",
-		"R_X86_64_64",
-		"R_X86_64_8",
-		"R_X86_64_COPY",
-		"R_X86_64_DTPMOD64",
-		"R_X86_64_DTPOFF32",
-		"R_X86_64_DTPOFF64",
-		"R_X86_64_GLOB_DAT",
-		"R_X86_64_GOT32",
-		"R_X86_64_GOT64",
-		"R_X86_64_GOTOFF64",
-		"R_X86_64_GOTPC32",
-		"R_X86_64_GOTPC32_TLSDESC",
-		"R_X86_64_GOTPC64",
-		"R_X86_64_GOTPCREL",
-		"R_X86_64_GOTPCREL64",
-		"R_X86_64_GOTPCRELX",
-		"R_X86_64_GOTPLT64",
-		"R_X86_64_GOTTPOFF",
-		"R_X86_64_IRELATIVE",
-		"R_X86_64_JMP_SLOT",
-		"R_X86_64_NONE",
-		"R_X86_64_PC16",
-		"R_X86_64_PC32",
-		"R_X86_64_PC32_BND",
-		"R_X86_64_PC64",
-		"R_X86_64_PC8",
-		"R_X86_64_PLT32",
-		"R_X86_64_PLT32_BND",
-		"R_X86_64_PLTOFF64",
-		"R_X86_64_RELATIVE",
-		"R_X86_64_RELATIVE64",
-		"R_X86_64_REX_GOTPCRELX",
-		"R_X86_64_SIZE32",
-		"R_X86_64_SIZE64",
-		"R_X86_64_TLSDESC",
-		"R_X86_64_TLSDESC_CALL",
-		"R_X86_64_TLSGD",
-		"R_X86_64_TLSLD",
-		"R_X86_64_TPOFF32",
-		"R_X86_64_TPOFF64",
-		"Rel32",
-		"Rel64",
-		"Rela32",
-		"Rela64",
-		"SHF_ALLOC",
-		"SHF_COMPRESSED",
-		"SHF_EXECINSTR",
-		"SHF_GROUP",
-		"SHF_INFO_LINK",
-		"SHF_LINK_ORDER",
-		"SHF_MASKOS",
-		"SHF_MASKPROC",
-		"SHF_MERGE",
-		"SHF_OS_NONCONFORMING",
-		"SHF_STRINGS",
-		"SHF_TLS",
-		"SHF_WRITE",
-		"SHN_ABS",
-		"SHN_COMMON",
-		"SHN_HIOS",
-		"SHN_HIPROC",
-		"SHN_HIRESERVE",
-		"SHN_LOOS",
-		"SHN_LOPROC",
-		"SHN_LORESERVE",
-		"SHN_UNDEF",
-		"SHN_XINDEX",
-		"SHT_DYNAMIC",
-		"SHT_DYNSYM",
-		"SHT_FINI_ARRAY",
-		"SHT_GNU_ATTRIBUTES",
-		"SHT_GNU_HASH",
-		"SHT_GNU_LIBLIST",
-		"SHT_GNU_VERDEF",
-		"SHT_GNU_VERNEED",
-		"SHT_GNU_VERSYM",
-		"SHT_GROUP",
-		"SHT_HASH",
-		"SHT_HIOS",
-		"SHT_HIPROC",
-		"SHT_HIUSER",
-		"SHT_INIT_ARRAY",
-		"SHT_LOOS",
-		"SHT_LOPROC",
-		"SHT_LOUSER",
-		"SHT_MIPS_ABIFLAGS",
-		"SHT_NOBITS",
-		"SHT_NOTE",
-		"SHT_NULL",
-		"SHT_PREINIT_ARRAY",
-		"SHT_PROGBITS",
-		"SHT_REL",
-		"SHT_RELA",
-		"SHT_SHLIB",
-		"SHT_STRTAB",
-		"SHT_SYMTAB",
-		"SHT_SYMTAB_SHNDX",
-		"STB_GLOBAL",
-		"STB_HIOS",
-		"STB_HIPROC",
-		"STB_LOCAL",
-		"STB_LOOS",
-		"STB_LOPROC",
-		"STB_WEAK",
-		"STT_COMMON",
-		"STT_FILE",
-		"STT_FUNC",
-		"STT_HIOS",
-		"STT_HIPROC",
-		"STT_LOOS",
-		"STT_LOPROC",
-		"STT_NOTYPE",
-		"STT_OBJECT",
-		"STT_SECTION",
-		"STT_TLS",
-		"STV_DEFAULT",
-		"STV_HIDDEN",
-		"STV_INTERNAL",
-		"STV_PROTECTED",
-		"ST_BIND",
-		"ST_INFO",
-		"ST_TYPE",
-		"ST_VISIBILITY",
-		"Section",
-		"Section32",
-		"Section64",
-		"SectionFlag",
-		"SectionHeader",
-		"SectionIndex",
-		"SectionType",
-		"Sym32",
-		"Sym32Size",
-		"Sym64",
-		"Sym64Size",
-		"SymBind",
-		"SymType",
-		"SymVis",
-		"Symbol",
-		"Type",
-		"Version",
-	},
-	"debug/gosym": {
-		"DecodingError",
-		"Func",
-		"LineTable",
-		"NewLineTable",
-		"NewTable",
-		"Obj",
-		"Sym",
-		"Table",
-		"UnknownFileError",
-		"UnknownLineError",
-	},
-	"debug/macho": {
-		"ARM64_RELOC_ADDEND",
-		"ARM64_RELOC_BRANCH26",
-		"ARM64_RELOC_GOT_LOAD_PAGE21",
-		"ARM64_RELOC_GOT_LOAD_PAGEOFF12",
-		"ARM64_RELOC_PAGE21",
-		"ARM64_RELOC_PAGEOFF12",
-		"ARM64_RELOC_POINTER_TO_GOT",
-		"ARM64_RELOC_SUBTRACTOR",
-		"ARM64_RELOC_TLVP_LOAD_PAGE21",
-		"ARM64_RELOC_TLVP_LOAD_PAGEOFF12",
-		"ARM64_RELOC_UNSIGNED",
-		"ARM_RELOC_BR24",
-		"ARM_RELOC_HALF",
-		"ARM_RELOC_HALF_SECTDIFF",
-		"ARM_RELOC_LOCAL_SECTDIFF",
-		"ARM_RELOC_PAIR",
-		"ARM_RELOC_PB_LA_PTR",
-		"ARM_RELOC_SECTDIFF",
-		"ARM_RELOC_VANILLA",
-		"ARM_THUMB_32BIT_BRANCH",
-		"ARM_THUMB_RELOC_BR22",
-		"Cpu",
-		"Cpu386",
-		"CpuAmd64",
-		"CpuArm",
-		"CpuArm64",
-		"CpuPpc",
-		"CpuPpc64",
-		"Dylib",
-		"DylibCmd",
-		"Dysymtab",
-		"DysymtabCmd",
-		"ErrNotFat",
-		"FatArch",
-		"FatArchHeader",
-		"FatFile",
-		"File",
-		"FileHeader",
-		"FlagAllModsBound",
-		"FlagAllowStackExecution",
-		"FlagAppExtensionSafe",
-		"FlagBindAtLoad",
-		"FlagBindsToWeak",
-		"FlagCanonical",
-		"FlagDeadStrippableDylib",
-		"FlagDyldLink",
-		"FlagForceFlat",
-		"FlagHasTLVDescriptors",
-		"FlagIncrLink",
-		"FlagLazyInit",
-		"FlagNoFixPrebinding",
-		"FlagNoHeapExecution",
-		"FlagNoMultiDefs",
-		"FlagNoReexportedDylibs",
-		"FlagNoUndefs",
-		"FlagPIE",
-		"FlagPrebindable",
-		"FlagPrebound",
-		"FlagRootSafe",
-		"FlagSetuidSafe",
-		"FlagSplitSegs",
-		"FlagSubsectionsViaSymbols",
-		"FlagTwoLevel",
-		"FlagWeakDefines",
-		"FormatError",
-		"GENERIC_RELOC_LOCAL_SECTDIFF",
-		"GENERIC_RELOC_PAIR",
-		"GENERIC_RELOC_PB_LA_PTR",
-		"GENERIC_RELOC_SECTDIFF",
-		"GENERIC_RELOC_TLV",
-		"GENERIC_RELOC_VANILLA",
-		"Load",
-		"LoadBytes",
-		"LoadCmd",
-		"LoadCmdDylib",
-		"LoadCmdDylinker",
-		"LoadCmdDysymtab",
-		"LoadCmdRpath",
-		"LoadCmdSegment",
-		"LoadCmdSegment64",
-		"LoadCmdSymtab",
-		"LoadCmdThread",
-		"LoadCmdUnixThread",
-		"Magic32",
-		"Magic64",
-		"MagicFat",
-		"NewFatFile",
-		"NewFile",
-		"Nlist32",
-		"Nlist64",
-		"Open",
-		"OpenFat",
-		"Regs386",
-		"RegsAMD64",
-		"Reloc",
-		"RelocTypeARM",
-		"RelocTypeARM64",
-		"RelocTypeGeneric",
-		"RelocTypeX86_64",
-		"Rpath",
-		"RpathCmd",
-		"Section",
-		"Section32",
-		"Section64",
-		"SectionHeader",
-		"Segment",
-		"Segment32",
-		"Segment64",
-		"SegmentHeader",
-		"Symbol",
-		"Symtab",
-		"SymtabCmd",
-		"Thread",
-		"Type",
-		"TypeBundle",
-		"TypeDylib",
-		"TypeExec",
-		"TypeObj",
-		"X86_64_RELOC_BRANCH",
-		"X86_64_RELOC_GOT",
-		"X86_64_RELOC_GOT_LOAD",
-		"X86_64_RELOC_SIGNED",
-		"X86_64_RELOC_SIGNED_1",
-		"X86_64_RELOC_SIGNED_2",
-		"X86_64_RELOC_SIGNED_4",
-		"X86_64_RELOC_SUBTRACTOR",
-		"X86_64_RELOC_TLV",
-		"X86_64_RELOC_UNSIGNED",
-	},
-	"debug/pe": {
-		"COFFSymbol",
-		"COFFSymbolAuxFormat5",
-		"COFFSymbolSize",
-		"DataDirectory",
-		"File",
-		"FileHeader",
-		"FormatError",
-		"IMAGE_COMDAT_SELECT_ANY",
-		"IMAGE_COMDAT_SELECT_ASSOCIATIVE",
-		"IMAGE_COMDAT_SELECT_EXACT_MATCH",
-		"IMAGE_COMDAT_SELECT_LARGEST",
-		"IMAGE_COMDAT_SELECT_NODUPLICATES",
-		"IMAGE_COMDAT_SELECT_SAME_SIZE",
-		"IMAGE_DIRECTORY_ENTRY_ARCHITECTURE",
-		"IMAGE_DIRECTORY_ENTRY_BASERELOC",
-		"IMAGE_DIRECTORY_ENTRY_BOUND_IMPORT",
-		"IMAGE_DIRECTORY_ENTRY_COM_DESCRIPTOR",
-		"IMAGE_DIRECTORY_ENTRY_DEBUG",
-		"IMAGE_DIRECTORY_ENTRY_DELAY_IMPORT",
-		"IMAGE_DIRECTORY_ENTRY_EXCEPTION",
-		"IMAGE_DIRECTORY_ENTRY_EXPORT",
-		"IMAGE_DIRECTORY_ENTRY_GLOBALPTR",
-		"IMAGE_DIRECTORY_ENTRY_IAT",
-		"IMAGE_DIRECTORY_ENTRY_IMPORT",
-		"IMAGE_DIRECTORY_ENTRY_LOAD_CONFIG",
-		"IMAGE_DIRECTORY_ENTRY_RESOURCE",
-		"IMAGE_DIRECTORY_ENTRY_SECURITY",
-		"IMAGE_DIRECTORY_ENTRY_TLS",
-		"IMAGE_DLLCHARACTERISTICS_APPCONTAINER",
-		"IMAGE_DLLCHARACTERISTICS_DYNAMIC_BASE",
-		"IMAGE_DLLCHARACTERISTICS_FORCE_INTEGRITY",
-		"IMAGE_DLLCHARACTERISTICS_GUARD_CF",
-		"IMAGE_DLLCHARACTERISTICS_HIGH_ENTROPY_VA",
-		"IMAGE_DLLCHARACTERISTICS_NO_BIND",
-		"IMAGE_DLLCHARACTERISTICS_NO_ISOLATION",
-		"IMAGE_DLLCHARACTERISTICS_NO_SEH",
-		"IMAGE_DLLCHARACTERISTICS_NX_COMPAT",
-		"IMAGE_DLLCHARACTERISTICS_TERMINAL_SERVER_AWARE",
-		"IMAGE_DLLCHARACTERISTICS_WDM_DRIVER",
-		"IMAGE_FILE_32BIT_MACHINE",
-		"IMAGE_FILE_AGGRESIVE_WS_TRIM",
-		"IMAGE_FILE_BYTES_REVERSED_HI",
-		"IMAGE_FILE_BYTES_REVERSED_LO",
-		"IMAGE_FILE_DEBUG_STRIPPED",
-		"IMAGE_FILE_DLL",
-		"IMAGE_FILE_EXECUTABLE_IMAGE",
-		"IMAGE_FILE_LARGE_ADDRESS_AWARE",
-		"IMAGE_FILE_LINE_NUMS_STRIPPED",
-		"IMAGE_FILE_LOCAL_SYMS_STRIPPED",
-		"IMAGE_FILE_MACHINE_AM33",
-		"IMAGE_FILE_MACHINE_AMD64",
-		"IMAGE_FILE_MACHINE_ARM",
-		"IMAGE_FILE_MACHINE_ARM64",
-		"IMAGE_FILE_MACHINE_ARMNT",
-		"IMAGE_FILE_MACHINE_EBC",
-		"IMAGE_FILE_MACHINE_I386",
-		"IMAGE_FILE_MACHINE_IA64",
-		"IMAGE_FILE_MACHINE_LOONGARCH32",
-		"IMAGE_FILE_MACHINE_LOONGARCH64",
-		"IMAGE_FILE_MACHINE_M32R",
-		"IMAGE_FILE_MACHINE_MIPS16",
-		"IMAGE_FILE_MACHINE_MIPSFPU",
-		"IMAGE_FILE_MACHINE_MIPSFPU16",
-		"IMAGE_FILE_MACHINE_POWERPC",
-		"IMAGE_FILE_MACHINE_POWERPCFP",
-		"IMAGE_FILE_MACHINE_R4000",
-		"IMAGE_FILE_MACHINE_RISCV128",
-		"IMAGE_FILE_MACHINE_RISCV32",
-		"IMAGE_FILE_MACHINE_RISCV64",
-		"IMAGE_FILE_MACHINE_SH3",
-		"IMAGE_FILE_MACHINE_SH3DSP",
-		"IMAGE_FILE_MACHINE_SH4",
-		"IMAGE_FILE_MACHINE_SH5",
-		"IMAGE_FILE_MACHINE_THUMB",
-		"IMAGE_FILE_MACHINE_UNKNOWN",
-		"IMAGE_FILE_MACHINE_WCEMIPSV2",
-		"IMAGE_FILE_NET_RUN_FROM_SWAP",
-		"IMAGE_FILE_RELOCS_STRIPPED",
-		"IMAGE_FILE_REMOVABLE_RUN_FROM_SWAP",
-		"IMAGE_FILE_SYSTEM",
-		"IMAGE_FILE_UP_SYSTEM_ONLY",
-		"IMAGE_SCN_CNT_CODE",
-		"IMAGE_SCN_CNT_INITIALIZED_DATA",
-		"IMAGE_SCN_CNT_UNINITIALIZED_DATA",
-		"IMAGE_SCN_LNK_COMDAT",
-		"IMAGE_SCN_MEM_DISCARDABLE",
-		"IMAGE_SCN_MEM_EXECUTE",
-		"IMAGE_SCN_MEM_READ",
-		"IMAGE_SCN_MEM_WRITE",
-		"IMAGE_SUBSYSTEM_EFI_APPLICATION",
-		"IMAGE_SUBSYSTEM_EFI_BOOT_SERVICE_DRIVER",
-		"IMAGE_SUBSYSTEM_EFI_ROM",
-		"IMAGE_SUBSYSTEM_EFI_RUNTIME_DRIVER",
-		"IMAGE_SUBSYSTEM_NATIVE",
-		"IMAGE_SUBSYSTEM_NATIVE_WINDOWS",
-		"IMAGE_SUBSYSTEM_OS2_CUI",
-		"IMAGE_SUBSYSTEM_POSIX_CUI",
-		"IMAGE_SUBSYSTEM_UNKNOWN",
-		"IMAGE_SUBSYSTEM_WINDOWS_BOOT_APPLICATION",
-		"IMAGE_SUBSYSTEM_WINDOWS_CE_GUI",
-		"IMAGE_SUBSYSTEM_WINDOWS_CUI",
-		"IMAGE_SUBSYSTEM_WINDOWS_GUI",
-		"IMAGE_SUBSYSTEM_XBOX",
-		"ImportDirectory",
-		"NewFile",
-		"Open",
-		"OptionalHeader32",
-		"OptionalHeader64",
-		"Reloc",
-		"Section",
-		"SectionHeader",
-		"SectionHeader32",
-		"StringTable",
-		"Symbol",
-	},
-	"debug/plan9obj": {
-		"ErrNoSymbols",
-		"File",
-		"FileHeader",
-		"Magic386",
-		"Magic64",
-		"MagicAMD64",
-		"MagicARM",
-		"NewFile",
-		"Open",
-		"Section",
-		"SectionHeader",
-		"Sym",
-	},
-	"embed": {
-		"FS",
-	},
-	"encoding": {
-		"BinaryMarshaler",
-		"BinaryUnmarshaler",
-		"TextMarshaler",
-		"TextUnmarshaler",
-	},
-	"encoding/ascii85": {
-		"CorruptInputError",
-		"Decode",
-		"Encode",
-		"MaxEncodedLen",
-		"NewDecoder",
-		"NewEncoder",
-	},
-	"encoding/asn1": {
-		"BitString",
-		"ClassApplication",
-		"ClassContextSpecific",
-		"ClassPrivate",
-		"ClassUniversal",
-		"Enumerated",
-		"Flag",
-		"Marshal",
-		"MarshalWithParams",
-		"NullBytes",
-		"NullRawValue",
-		"ObjectIdentifier",
-		"RawContent",
-		"RawValue",
-		"StructuralError",
-		"SyntaxError",
-		"TagBMPString",
-		"TagBitString",
-		"TagBoolean",
-		"TagEnum",
-		"TagGeneralString",
-		"TagGeneralizedTime",
-		"TagIA5String",
-		"TagInteger",
-		"TagNull",
-		"TagNumericString",
-		"TagOID",
-		"TagOctetString",
-		"TagPrintableString",
-		"TagSequence",
-		"TagSet",
-		"TagT61String",
-		"TagUTCTime",
-		"TagUTF8String",
-		"Unmarshal",
-		"UnmarshalWithParams",
-	},
-	"encoding/base32": {
-		"CorruptInputError",
-		"Encoding",
-		"HexEncoding",
-		"NewDecoder",
-		"NewEncoder",
-		"NewEncoding",
-		"NoPadding",
-		"StdEncoding",
-		"StdPadding",
-	},
-	"encoding/base64": {
-		"CorruptInputError",
-		"Encoding",
-		"NewDecoder",
-		"NewEncoder",
-		"NewEncoding",
-		"NoPadding",
-		"RawStdEncoding",
-		"RawURLEncoding",
-		"StdEncoding",
-		"StdPadding",
-		"URLEncoding",
-	},
-	"encoding/binary": {
-		"AppendByteOrder",
-		"AppendUvarint",
-		"AppendVarint",
-		"BigEndian",
-		"ByteOrder",
-		"LittleEndian",
-		"MaxVarintLen16",
-		"MaxVarintLen32",
-		"MaxVarintLen64",
-		"PutUvarint",
-		"PutVarint",
-		"Read",
-		"ReadUvarint",
-		"ReadVarint",
-		"Size",
-		"Uvarint",
-		"Varint",
-		"Write",
-	},
-	"encoding/csv": {
-		"ErrBareQuote",
-		"ErrFieldCount",
-		"ErrQuote",
-		"ErrTrailingComma",
-		"NewReader",
-		"NewWriter",
-		"ParseError",
-		"Reader",
-		"Writer",
-	},
-	"encoding/gob": {
-		"CommonType",
-		"Decoder",
-		"Encoder",
-		"GobDecoder",
-		"GobEncoder",
-		"NewDecoder",
-		"NewEncoder",
-		"Register",
-		"RegisterName",
-	},
-	"encoding/hex": {
-		"Decode",
-		"DecodeString",
-		"DecodedLen",
-		"Dump",
-		"Dumper",
-		"Encode",
-		"EncodeToString",
-		"EncodedLen",
-		"ErrLength",
-		"InvalidByteError",
-		"NewDecoder",
-		"NewEncoder",
-	},
-	"encoding/json": {
-		"Compact",
-		"Decoder",
-		"Delim",
-		"Encoder",
-		"HTMLEscape",
-		"Indent",
-		"InvalidUTF8Error",
-		"InvalidUnmarshalError",
-		"Marshal",
-		"MarshalIndent",
-		"Marshaler",
-		"MarshalerError",
-		"NewDecoder",
-		"NewEncoder",
-		"Number",
-		"RawMessage",
-		"SyntaxError",
-		"Token",
-		"Unmarshal",
-		"UnmarshalFieldError",
-		"UnmarshalTypeError",
-		"Unmarshaler",
-		"UnsupportedTypeError",
-		"UnsupportedValueError",
-		"Valid",
-	},
-	"encoding/pem": {
-		"Block",
-		"Decode",
-		"Encode",
-		"EncodeToMemory",
-	},
-	"encoding/xml": {
-		"Attr",
-		"CharData",
-		"Comment",
-		"CopyToken",
-		"Decoder",
-		"Directive",
-		"Encoder",
-		"EndElement",
-		"Escape",
-		"EscapeText",
-		"HTMLAutoClose",
-		"HTMLEntity",
-		"Header",
-		"Marshal",
-		"MarshalIndent",
-		"Marshaler",
-		"MarshalerAttr",
-		"Name",
-		"NewDecoder",
-		"NewEncoder",
-		"NewTokenDecoder",
-		"ProcInst",
-		"StartElement",
-		"SyntaxError",
-		"TagPathError",
-		"Token",
-		"TokenReader",
-		"Unmarshal",
-		"UnmarshalError",
-		"Unmarshaler",
-		"UnmarshalerAttr",
-		"UnsupportedTypeError",
-	},
-	"errors": {
-		"As",
-		"Is",
-		"Join",
-		"New",
-		"Unwrap",
-	},
-	"expvar": {
-		"Do",
-		"Float",
-		"Func",
-		"Get",
-		"Handler",
-		"Int",
-		"KeyValue",
-		"Map",
-		"NewFloat",
-		"NewInt",
-		"NewMap",
-		"NewString",
-		"Publish",
-		"String",
-		"Var",
-	},
-	"flag": {
-		"Arg",
-		"Args",
-		"Bool",
-		"BoolVar",
-		"CommandLine",
-		"ContinueOnError",
-		"Duration",
-		"DurationVar",
-		"ErrHelp",
-		"ErrorHandling",
-		"ExitOnError",
-		"Flag",
-		"FlagSet",
-		"Float64",
-		"Float64Var",
-		"Func",
-		"Getter",
-		"Int",
-		"Int64",
-		"Int64Var",
-		"IntVar",
-		"Lookup",
-		"NArg",
-		"NFlag",
-		"NewFlagSet",
-		"PanicOnError",
-		"Parse",
-		"Parsed",
-		"PrintDefaults",
-		"Set",
-		"String",
-		"StringVar",
-		"TextVar",
-		"Uint",
-		"Uint64",
-		"Uint64Var",
-		"UintVar",
-		"UnquoteUsage",
-		"Usage",
-		"Value",
-		"Var",
-		"Visit",
-		"VisitAll",
-	},
-	"fmt": {
-		"Append",
-		"Appendf",
-		"Appendln",
-		"Errorf",
-		"FormatString",
-		"Formatter",
-		"Fprint",
-		"Fprintf",
-		"Fprintln",
-		"Fscan",
-		"Fscanf",
-		"Fscanln",
-		"GoStringer",
-		"Print",
-		"Printf",
-		"Println",
-		"Scan",
-		"ScanState",
-		"Scanf",
-		"Scanln",
-		"Scanner",
-		"Sprint",
-		"Sprintf",
-		"Sprintln",
-		"Sscan",
-		"Sscanf",
-		"Sscanln",
-		"State",
-		"Stringer",
-	},
-	"go/ast": {
-		"ArrayType",
-		"AssignStmt",
-		"Bad",
-		"BadDecl",
-		"BadExpr",
-		"BadStmt",
-		"BasicLit",
-		"BinaryExpr",
-		"BlockStmt",
-		"BranchStmt",
-		"CallExpr",
-		"CaseClause",
-		"ChanDir",
-		"ChanType",
-		"CommClause",
-		"Comment",
-		"CommentGroup",
-		"CommentMap",
-		"CompositeLit",
-		"Con",
-		"Decl",
-		"DeclStmt",
-		"DeferStmt",
-		"Ellipsis",
-		"EmptyStmt",
-		"Expr",
-		"ExprStmt",
-		"Field",
-		"FieldFilter",
-		"FieldList",
-		"File",
-		"FileExports",
-		"Filter",
-		"FilterDecl",
-		"FilterFile",
-		"FilterFuncDuplicates",
-		"FilterImportDuplicates",
-		"FilterPackage",
-		"FilterUnassociatedComments",
-		"ForStmt",
-		"Fprint",
-		"Fun",
-		"FuncDecl",
-		"FuncLit",
-		"FuncType",
-		"GenDecl",
-		"GoStmt",
-		"Ident",
-		"IfStmt",
-		"ImportSpec",
-		"Importer",
-		"IncDecStmt",
-		"IndexExpr",
-		"IndexListExpr",
-		"Inspect",
-		"InterfaceType",
-		"IsExported",
-		"KeyValueExpr",
-		"LabeledStmt",
-		"Lbl",
-		"MapType",
-		"MergeMode",
-		"MergePackageFiles",
-		"NewCommentMap",
-		"NewIdent",
-		"NewObj",
-		"NewPackage",
-		"NewScope",
-		"Node",
-		"NotNilFilter",
-		"ObjKind",
-		"Object",
-		"Package",
-		"PackageExports",
-		"ParenExpr",
-		"Pkg",
-		"Print",
-		"RECV",
-		"RangeStmt",
-		"ReturnStmt",
-		"SEND",
-		"Scope",
-		"SelectStmt",
-		"SelectorExpr",
-		"SendStmt",
-		"SliceExpr",
-		"SortImports",
-		"Spec",
-		"StarExpr",
-		"Stmt",
-		"StructType",
-		"SwitchStmt",
-		"Typ",
-		"TypeAssertExpr",
-		"TypeSpec",
-		"TypeSwitchStmt",
-		"UnaryExpr",
-		"ValueSpec",
-		"Var",
-		"Visitor",
-		"Walk",
-	},
-	"go/build": {
-		"AllowBinary",
-		"ArchChar",
-		"Context",
-		"Default",
-		"FindOnly",
-		"IgnoreVendor",
-		"Import",
-		"ImportComment",
-		"ImportDir",
-		"ImportMode",
-		"IsLocalImport",
-		"MultiplePackageError",
-		"NoGoError",
-		"Package",
-		"ToolDir",
-	},
-	"go/build/constraint": {
-		"AndExpr",
-		"Expr",
-		"IsGoBuild",
-		"IsPlusBuild",
-		"NotExpr",
-		"OrExpr",
-		"Parse",
-		"PlusBuildLines",
-		"SyntaxError",
-		"TagExpr",
-	},
-	"go/constant": {
-		"BinaryOp",
-		"BitLen",
-		"Bool",
-		"BoolVal",
-		"Bytes",
-		"Compare",
-		"Complex",
-		"Denom",
-		"Float",
-		"Float32Val",
-		"Float64Val",
-		"Imag",
-		"Int",
-		"Int64Val",
-		"Kind",
-		"Make",
-		"MakeBool",
-		"MakeFloat64",
-		"MakeFromBytes",
-		"MakeFromLiteral",
-		"MakeImag",
-		"MakeInt64",
-		"MakeString",
-		"MakeUint64",
-		"MakeUnknown",
-		"Num",
-		"Real",
-		"Shift",
-		"Sign",
-		"String",
-		"StringVal",
-		"ToComplex",
-		"ToFloat",
-		"ToInt",
-		"Uint64Val",
-		"UnaryOp",
-		"Unknown",
-		"Val",
-		"Value",
-	},
-	"go/doc": {
-		"AllDecls",
-		"AllMethods",
-		"Example",
-		"Examples",
-		"Filter",
-		"Func",
-		"IllegalPrefixes",
-		"IsPredeclared",
-		"Mode",
-		"New",
-		"NewFromFiles",
-		"Note",
-		"Package",
-		"PreserveAST",
-		"Synopsis",
-		"ToHTML",
-		"ToText",
-		"Type",
-		"Value",
-	},
-	"go/doc/comment": {
-		"Block",
-		"Code",
-		"DefaultLookupPackage",
-		"Doc",
-		"DocLink",
-		"Heading",
-		"Italic",
-		"Link",
-		"LinkDef",
-		"List",
-		"ListItem",
-		"Paragraph",
-		"Parser",
-		"Plain",
-		"Printer",
-		"Text",
-	},
-	"go/format": {
-		"Node",
-		"Source",
-	},
-	"go/importer": {
-		"Default",
-		"For",
-		"ForCompiler",
-		"Lookup",
-	},
-	"go/parser": {
-		"AllErrors",
-		"DeclarationErrors",
-		"ImportsOnly",
-		"Mode",
-		"PackageClauseOnly",
-		"ParseComments",
-		"ParseDir",
-		"ParseExpr",
-		"ParseExprFrom",
-		"ParseFile",
-		"SkipObjectResolution",
-		"SpuriousErrors",
-		"Trace",
-	},
-	"go/printer": {
-		"CommentedNode",
-		"Config",
-		"Fprint",
-		"Mode",
-		"RawFormat",
-		"SourcePos",
-		"TabIndent",
-		"UseSpaces",
-	},
-	"go/scanner": {
-		"Error",
-		"ErrorHandler",
-		"ErrorList",
-		"Mode",
-		"PrintError",
-		"ScanComments",
-		"Scanner",
-	},
-	"go/token": {
-		"ADD",
-		"ADD_ASSIGN",
-		"AND",
-		"AND_ASSIGN",
-		"AND_NOT",
-		"AND_NOT_ASSIGN",
-		"ARROW",
-		"ASSIGN",
-		"BREAK",
-		"CASE",
-		"CHAN",
-		"CHAR",
-		"COLON",
-		"COMMA",
-		"COMMENT",
-		"CONST",
-		"CONTINUE",
-		"DEC",
-		"DEFAULT",
-		"DEFER",
-		"DEFINE",
-		"ELLIPSIS",
-		"ELSE",
-		"EOF",
-		"EQL",
-		"FALLTHROUGH",
-		"FLOAT",
-		"FOR",
-		"FUNC",
-		"File",
-		"FileSet",
-		"GEQ",
-		"GO",
-		"GOTO",
-		"GTR",
-		"HighestPrec",
-		"IDENT",
-		"IF",
-		"ILLEGAL",
-		"IMAG",
-		"IMPORT",
-		"INC",
-		"INT",
-		"INTERFACE",
-		"IsExported",
-		"IsIdentifier",
-		"IsKeyword",
-		"LAND",
-		"LBRACE",
-		"LBRACK",
-		"LEQ",
-		"LOR",
-		"LPAREN",
-		"LSS",
-		"Lookup",
-		"LowestPrec",
-		"MAP",
-		"MUL",
-		"MUL_ASSIGN",
-		"NEQ",
-		"NOT",
-		"NewFileSet",
-		"NoPos",
-		"OR",
-		"OR_ASSIGN",
-		"PACKAGE",
-		"PERIOD",
-		"Pos",
-		"Position",
-		"QUO",
-		"QUO_ASSIGN",
-		"RANGE",
-		"RBRACE",
-		"RBRACK",
-		"REM",
-		"REM_ASSIGN",
-		"RETURN",
-		"RPAREN",
-		"SELECT",
-		"SEMICOLON",
-		"SHL",
-		"SHL_ASSIGN",
-		"SHR",
-		"SHR_ASSIGN",
-		"STRING",
-		"STRUCT",
-		"SUB",
-		"SUB_ASSIGN",
-		"SWITCH",
-		"TILDE",
-		"TYPE",
-		"Token",
-		"UnaryPrec",
-		"VAR",
-		"XOR",
-		"XOR_ASSIGN",
-	},
-	"go/types": {
-		"ArgumentError",
-		"Array",
-		"AssertableTo",
-		"AssignableTo",
-		"Basic",
-		"BasicInfo",
-		"BasicKind",
-		"Bool",
-		"Builtin",
-		"Byte",
-		"Chan",
-		"ChanDir",
-		"CheckExpr",
-		"Checker",
-		"Comparable",
-		"Complex128",
-		"Complex64",
-		"Config",
-		"Const",
-		"Context",
-		"ConvertibleTo",
-		"DefPredeclaredTestFuncs",
-		"Default",
-		"Error",
-		"Eval",
-		"ExprString",
-		"FieldVal",
-		"Float32",
-		"Float64",
-		"Func",
-		"Id",
-		"Identical",
-		"IdenticalIgnoreTags",
-		"Implements",
-		"ImportMode",
-		"Importer",
-		"ImporterFrom",
-		"Info",
-		"Initializer",
-		"Instance",
-		"Instantiate",
-		"Int",
-		"Int16",
-		"Int32",
-		"Int64",
-		"Int8",
-		"Interface",
-		"Invalid",
-		"IsBoolean",
-		"IsComplex",
-		"IsConstType",
-		"IsFloat",
-		"IsInteger",
-		"IsInterface",
-		"IsNumeric",
-		"IsOrdered",
-		"IsString",
-		"IsUnsigned",
-		"IsUntyped",
-		"Label",
-		"LookupFieldOrMethod",
-		"Map",
-		"MethodExpr",
-		"MethodSet",
-		"MethodVal",
-		"MissingMethod",
-		"Named",
-		"NewArray",
-		"NewChan",
-		"NewChecker",
-		"NewConst",
-		"NewContext",
-		"NewField",
-		"NewFunc",
-		"NewInterface",
-		"NewInterfaceType",
-		"NewLabel",
-		"NewMap",
-		"NewMethodSet",
-		"NewNamed",
-		"NewPackage",
-		"NewParam",
-		"NewPkgName",
-		"NewPointer",
-		"NewScope",
-		"NewSignature",
-		"NewSignatureType",
-		"NewSlice",
-		"NewStruct",
-		"NewTerm",
-		"NewTuple",
-		"NewTypeName",
-		"NewTypeParam",
-		"NewUnion",
-		"NewVar",
-		"Nil",
-		"Object",
-		"ObjectString",
-		"Package",
-		"PkgName",
-		"Pointer",
-		"Qualifier",
-		"RecvOnly",
-		"RelativeTo",
-		"Rune",
-		"Satisfies",
-		"Scope",
-		"Selection",
-		"SelectionKind",
-		"SelectionString",
-		"SendOnly",
-		"SendRecv",
-		"Signature",
-		"Sizes",
-		"SizesFor",
-		"Slice",
-		"StdSizes",
-		"String",
-		"Struct",
-		"Term",
-		"Tuple",
-		"Typ",
-		"Type",
-		"TypeAndValue",
-		"TypeList",
-		"TypeName",
-		"TypeParam",
-		"TypeParamList",
-		"TypeString",
-		"Uint",
-		"Uint16",
-		"Uint32",
-		"Uint64",
-		"Uint8",
-		"Uintptr",
-		"Union",
-		"Universe",
-		"Unsafe",
-		"UnsafePointer",
-		"UntypedBool",
-		"UntypedComplex",
-		"UntypedFloat",
-		"UntypedInt",
-		"UntypedNil",
-		"UntypedRune",
-		"UntypedString",
-		"Var",
-		"WriteExpr",
-		"WriteSignature",
-		"WriteType",
-	},
-	"hash": {
-		"Hash",
-		"Hash32",
-		"Hash64",
-	},
-	"hash/adler32": {
-		"Checksum",
-		"New",
-		"Size",
-	},
-	"hash/crc32": {
-		"Castagnoli",
-		"Checksum",
-		"ChecksumIEEE",
-		"IEEE",
-		"IEEETable",
-		"Koopman",
-		"MakeTable",
-		"New",
-		"NewIEEE",
-		"Size",
-		"Table",
-		"Update",
-	},
-	"hash/crc64": {
-		"Checksum",
-		"ECMA",
-		"ISO",
-		"MakeTable",
-		"New",
-		"Size",
-		"Table",
-		"Update",
-	},
-	"hash/fnv": {
-		"New128",
-		"New128a",
-		"New32",
-		"New32a",
-		"New64",
-		"New64a",
-	},
-	"hash/maphash": {
-		"Bytes",
-		"Hash",
-		"MakeSeed",
-		"Seed",
-		"String",
-	},
-	"html": {
-		"EscapeString",
-		"UnescapeString",
-	},
-	"html/template": {
-		"CSS",
-		"ErrAmbigContext",
-		"ErrBadHTML",
-		"ErrBranchEnd",
-		"ErrEndContext",
-		"ErrNoSuchTemplate",
-		"ErrOutputContext",
-		"ErrPartialCharset",
-		"ErrPartialEscape",
-		"ErrPredefinedEscaper",
-		"ErrRangeLoopReentry",
-		"ErrSlashAmbig",
-		"Error",
-		"ErrorCode",
-		"FuncMap",
-		"HTML",
-		"HTMLAttr",
-		"HTMLEscape",
-		"HTMLEscapeString",
-		"HTMLEscaper",
-		"IsTrue",
-		"JS",
-		"JSEscape",
-		"JSEscapeString",
-		"JSEscaper",
-		"JSStr",
-		"Must",
-		"New",
-		"OK",
-		"ParseFS",
-		"ParseFiles",
-		"ParseGlob",
-		"Srcset",
-		"Template",
-		"URL",
-		"URLQueryEscaper",
-	},
-	"image": {
-		"Alpha",
-		"Alpha16",
-		"Black",
-		"CMYK",
-		"Config",
-		"Decode",
-		"DecodeConfig",
-		"ErrFormat",
-		"Gray",
-		"Gray16",
-		"Image",
-		"NRGBA",
-		"NRGBA64",
-		"NYCbCrA",
-		"NewAlpha",
-		"NewAlpha16",
-		"NewCMYK",
-		"NewGray",
-		"NewGray16",
-		"NewNRGBA",
-		"NewNRGBA64",
-		"NewNYCbCrA",
-		"NewPaletted",
-		"NewRGBA",
-		"NewRGBA64",
-		"NewUniform",
-		"NewYCbCr",
-		"Opaque",
-		"Paletted",
-		"PalettedImage",
-		"Point",
-		"Pt",
-		"RGBA",
-		"RGBA64",
-		"RGBA64Image",
-		"Rect",
-		"Rectangle",
-		"RegisterFormat",
-		"Transparent",
-		"Uniform",
-		"White",
-		"YCbCr",
-		"YCbCrSubsampleRatio",
-		"YCbCrSubsampleRatio410",
-		"YCbCrSubsampleRatio411",
-		"YCbCrSubsampleRatio420",
-		"YCbCrSubsampleRatio422",
-		"YCbCrSubsampleRatio440",
-		"YCbCrSubsampleRatio444",
-		"ZP",
-		"ZR",
-	},
-	"image/color": {
-		"Alpha",
-		"Alpha16",
-		"Alpha16Model",
-		"AlphaModel",
-		"Black",
-		"CMYK",
-		"CMYKModel",
-		"CMYKToRGB",
-		"Color",
-		"Gray",
-		"Gray16",
-		"Gray16Model",
-		"GrayModel",
-		"Model",
-		"ModelFunc",
-		"NRGBA",
-		"NRGBA64",
-		"NRGBA64Model",
-		"NRGBAModel",
-		"NYCbCrA",
-		"NYCbCrAModel",
-		"Opaque",
-		"Palette",
-		"RGBA",
-		"RGBA64",
-		"RGBA64Model",
-		"RGBAModel",
-		"RGBToCMYK",
-		"RGBToYCbCr",
-		"Transparent",
-		"White",
-		"YCbCr",
-		"YCbCrModel",
-		"YCbCrToRGB",
-	},
-	"image/color/palette": {
-		"Plan9",
-		"WebSafe",
-	},
-	"image/draw": {
-		"Draw",
-		"DrawMask",
-		"Drawer",
-		"FloydSteinberg",
-		"Image",
-		"Op",
-		"Over",
-		"Quantizer",
-		"RGBA64Image",
-		"Src",
-	},
-	"image/gif": {
-		"Decode",
-		"DecodeAll",
-		"DecodeConfig",
-		"DisposalBackground",
-		"DisposalNone",
-		"DisposalPrevious",
-		"Encode",
-		"EncodeAll",
-		"GIF",
-		"Options",
-	},
-	"image/jpeg": {
-		"Decode",
-		"DecodeConfig",
-		"DefaultQuality",
-		"Encode",
-		"FormatError",
-		"Options",
-		"Reader",
-		"UnsupportedError",
-	},
-	"image/png": {
-		"BestCompression",
-		"BestSpeed",
-		"CompressionLevel",
-		"Decode",
-		"DecodeConfig",
-		"DefaultCompression",
-		"Encode",
-		"Encoder",
-		"EncoderBuffer",
-		"EncoderBufferPool",
-		"FormatError",
-		"NoCompression",
-		"UnsupportedError",
-	},
-	"index/suffixarray": {
-		"Index",
-		"New",
-	},
-	"io": {
-		"ByteReader",
-		"ByteScanner",
-		"ByteWriter",
-		"Closer",
-		"Copy",
-		"CopyBuffer",
-		"CopyN",
-		"Discard",
-		"EOF",
-		"ErrClosedPipe",
-		"ErrNoProgress",
-		"ErrShortBuffer",
-		"ErrShortWrite",
-		"ErrUnexpectedEOF",
-		"LimitReader",
-		"LimitedReader",
-		"MultiReader",
-		"MultiWriter",
-		"NewOffsetWriter",
-		"NewSectionReader",
-		"NopCloser",
-		"OffsetWriter",
-		"Pipe",
-		"PipeReader",
-		"PipeWriter",
-		"ReadAll",
-		"ReadAtLeast",
-		"ReadCloser",
-		"ReadFull",
-		"ReadSeekCloser",
-		"ReadSeeker",
-		"ReadWriteCloser",
-		"ReadWriteSeeker",
-		"ReadWriter",
-		"Reader",
-		"ReaderAt",
-		"ReaderFrom",
-		"RuneReader",
-		"RuneScanner",
-		"SectionReader",
-		"SeekCurrent",
-		"SeekEnd",
-		"SeekStart",
-		"Seeker",
-		"StringWriter",
-		"TeeReader",
-		"WriteCloser",
-		"WriteSeeker",
-		"WriteString",
-		"Writer",
-		"WriterAt",
-		"WriterTo",
-	},
-	"io/fs": {
-		"DirEntry",
-		"ErrClosed",
-		"ErrExist",
-		"ErrInvalid",
-		"ErrNotExist",
-		"ErrPermission",
-		"FS",
-		"File",
-		"FileInfo",
-		"FileInfoToDirEntry",
-		"FileMode",
-		"Glob",
-		"GlobFS",
-		"ModeAppend",
-		"ModeCharDevice",
-		"ModeDevice",
-		"ModeDir",
-		"ModeExclusive",
-		"ModeIrregular",
-		"ModeNamedPipe",
-		"ModePerm",
-		"ModeSetgid",
-		"ModeSetuid",
-		"ModeSocket",
-		"ModeSticky",
-		"ModeSymlink",
-		"ModeTemporary",
-		"ModeType",
-		"PathError",
-		"ReadDir",
-		"ReadDirFS",
-		"ReadDirFile",
-		"ReadFile",
-		"ReadFileFS",
-		"SkipAll",
-		"SkipDir",
-		"Stat",
-		"StatFS",
-		"Sub",
-		"SubFS",
-		"ValidPath",
-		"WalkDir",
-		"WalkDirFunc",
-	},
-	"io/ioutil": {
-		"Discard",
-		"NopCloser",
-		"ReadAll",
-		"ReadDir",
-		"ReadFile",
-		"TempDir",
-		"TempFile",
-		"WriteFile",
-	},
-	"log": {
-		"Default",
-		"Fatal",
-		"Fatalf",
-		"Fatalln",
-		"Flags",
-		"LUTC",
-		"Ldate",
-		"Llongfile",
-		"Lmicroseconds",
-		"Lmsgprefix",
-		"Logger",
-		"Lshortfile",
-		"LstdFlags",
-		"Ltime",
-		"New",
-		"Output",
-		"Panic",
-		"Panicf",
-		"Panicln",
-		"Prefix",
-		"Print",
-		"Printf",
-		"Println",
-		"SetFlags",
-		"SetOutput",
-		"SetPrefix",
-		"Writer",
-	},
-	"log/syslog": {
-		"Dial",
-		"LOG_ALERT",
-		"LOG_AUTH",
-		"LOG_AUTHPRIV",
-		"LOG_CRIT",
-		"LOG_CRON",
-		"LOG_DAEMON",
-		"LOG_DEBUG",
-		"LOG_EMERG",
-		"LOG_ERR",
-		"LOG_FTP",
-		"LOG_INFO",
-		"LOG_KERN",
-		"LOG_LOCAL0",
-		"LOG_LOCAL1",
-		"LOG_LOCAL2",
-		"LOG_LOCAL3",
-		"LOG_LOCAL4",
-		"LOG_LOCAL5",
-		"LOG_LOCAL6",
-		"LOG_LOCAL7",
-		"LOG_LPR",
-		"LOG_MAIL",
-		"LOG_NEWS",
-		"LOG_NOTICE",
-		"LOG_SYSLOG",
-		"LOG_USER",
-		"LOG_UUCP",
-		"LOG_WARNING",
-		"New",
-		"NewLogger",
-		"Priority",
-		"Writer",
-	},
-	"math": {
-		"Abs",
-		"Acos",
-		"Acosh",
-		"Asin",
-		"Asinh",
-		"Atan",
-		"Atan2",
-		"Atanh",
-		"Cbrt",
-		"Ceil",
-		"Copysign",
-		"Cos",
-		"Cosh",
-		"Dim",
-		"E",
-		"Erf",
-		"Erfc",
-		"Erfcinv",
-		"Erfinv",
-		"Exp",
-		"Exp2",
-		"Expm1",
-		"FMA",
-		"Float32bits",
-		"Float32frombits",
-		"Float64bits",
-		"Float64frombits",
-		"Floor",
-		"Frexp",
-		"Gamma",
-		"Hypot",
-		"Ilogb",
-		"Inf",
-		"IsInf",
-		"IsNaN",
-		"J0",
-		"J1",
-		"Jn",
-		"Ldexp",
-		"Lgamma",
-		"Ln10",
-		"Ln2",
-		"Log",
-		"Log10",
-		"Log10E",
-		"Log1p",
-		"Log2",
-		"Log2E",
-		"Logb",
-		"Max",
-		"MaxFloat32",
-		"MaxFloat64",
-		"MaxInt",
-		"MaxInt16",
-		"MaxInt32",
-		"MaxInt64",
-		"MaxInt8",
-		"MaxUint",
-		"MaxUint16",
-		"MaxUint32",
-		"MaxUint64",
-		"MaxUint8",
-		"Min",
-		"MinInt",
-		"MinInt16",
-		"MinInt32",
-		"MinInt64",
-		"MinInt8",
-		"Mod",
-		"Modf",
-		"NaN",
-		"Nextafter",
-		"Nextafter32",
-		"Phi",
-		"Pi",
-		"Pow",
-		"Pow10",
-		"Remainder",
-		"Round",
-		"RoundToEven",
-		"Signbit",
-		"Sin",
-		"Sincos",
-		"Sinh",
-		"SmallestNonzeroFloat32",
-		"SmallestNonzeroFloat64",
-		"Sqrt",
-		"Sqrt2",
-		"SqrtE",
-		"SqrtPhi",
-		"SqrtPi",
-		"Tan",
-		"Tanh",
-		"Trunc",
-		"Y0",
-		"Y1",
-		"Yn",
-	},
-	"math/big": {
-		"Above",
-		"Accuracy",
-		"AwayFromZero",
-		"Below",
-		"ErrNaN",
-		"Exact",
-		"Float",
-		"Int",
-		"Jacobi",
-		"MaxBase",
-		"MaxExp",
-		"MaxPrec",
-		"MinExp",
-		"NewFloat",
-		"NewInt",
-		"NewRat",
-		"ParseFloat",
-		"Rat",
-		"RoundingMode",
-		"ToNearestAway",
-		"ToNearestEven",
-		"ToNegativeInf",
-		"ToPositiveInf",
-		"ToZero",
-		"Word",
-	},
-	"math/bits": {
-		"Add",
-		"Add32",
-		"Add64",
-		"Div",
-		"Div32",
-		"Div64",
-		"LeadingZeros",
-		"LeadingZeros16",
-		"LeadingZeros32",
-		"LeadingZeros64",
-		"LeadingZeros8",
-		"Len",
-		"Len16",
-		"Len32",
-		"Len64",
-		"Len8",
-		"Mul",
-		"Mul32",
-		"Mul64",
-		"OnesCount",
-		"OnesCount16",
-		"OnesCount32",
-		"OnesCount64",
-		"OnesCount8",
-		"Rem",
-		"Rem32",
-		"Rem64",
-		"Reverse",
-		"Reverse16",
-		"Reverse32",
-		"Reverse64",
-		"Reverse8",
-		"ReverseBytes",
-		"ReverseBytes16",
-		"ReverseBytes32",
-		"ReverseBytes64",
-		"RotateLeft",
-		"RotateLeft16",
-		"RotateLeft32",
-		"RotateLeft64",
-		"RotateLeft8",
-		"Sub",
-		"Sub32",
-		"Sub64",
-		"TrailingZeros",
-		"TrailingZeros16",
-		"TrailingZeros32",
-		"TrailingZeros64",
-		"TrailingZeros8",
-		"UintSize",
-	},
-	"math/cmplx": {
-		"Abs",
-		"Acos",
-		"Acosh",
-		"Asin",
-		"Asinh",
-		"Atan",
-		"Atanh",
-		"Conj",
-		"Cos",
-		"Cosh",
-		"Cot",
-		"Exp",
-		"Inf",
-		"IsInf",
-		"IsNaN",
-		"Log",
-		"Log10",
-		"NaN",
-		"Phase",
-		"Polar",
-		"Pow",
-		"Rect",
-		"Sin",
-		"Sinh",
-		"Sqrt",
-		"Tan",
-		"Tanh",
-	},
-	"math/rand": {
-		"ExpFloat64",
-		"Float32",
-		"Float64",
-		"Int",
-		"Int31",
-		"Int31n",
-		"Int63",
-		"Int63n",
-		"Intn",
-		"New",
-		"NewSource",
-		"NewZipf",
-		"NormFloat64",
-		"Perm",
-		"Rand",
-		"Read",
-		"Seed",
-		"Shuffle",
-		"Source",
-		"Source64",
-		"Uint32",
-		"Uint64",
-		"Zipf",
-	},
-	"mime": {
-		"AddExtensionType",
-		"BEncoding",
-		"ErrInvalidMediaParameter",
-		"ExtensionsByType",
-		"FormatMediaType",
-		"ParseMediaType",
-		"QEncoding",
-		"TypeByExtension",
-		"WordDecoder",
-		"WordEncoder",
-	},
-	"mime/multipart": {
-		"ErrMessageTooLarge",
-		"File",
-		"FileHeader",
-		"Form",
-		"NewReader",
-		"NewWriter",
-		"Part",
-		"Reader",
-		"Writer",
-	},
-	"mime/quotedprintable": {
-		"NewReader",
-		"NewWriter",
-		"Reader",
-		"Writer",
-	},
-	"net": {
-		"Addr",
-		"AddrError",
-		"Buffers",
-		"CIDRMask",
-		"Conn",
-		"DNSConfigError",
-		"DNSError",
-		"DefaultResolver",
-		"Dial",
-		"DialIP",
-		"DialTCP",
-		"DialTimeout",
-		"DialUDP",
-		"DialUnix",
-		"Dialer",
-		"ErrClosed",
-		"ErrWriteToConnected",
-		"Error",
-		"FileConn",
-		"FileListener",
-		"FilePacketConn",
-		"FlagBroadcast",
-		"FlagLoopback",
-		"FlagMulticast",
-		"FlagPointToPoint",
-		"FlagRunning",
-		"FlagUp",
-		"Flags",
-		"HardwareAddr",
-		"IP",
-		"IPAddr",
-		"IPConn",
-		"IPMask",
-		"IPNet",
-		"IPv4",
-		"IPv4Mask",
-		"IPv4allrouter",
-		"IPv4allsys",
-		"IPv4bcast",
-		"IPv4len",
-		"IPv4zero",
-		"IPv6interfacelocalallnodes",
-		"IPv6len",
-		"IPv6linklocalallnodes",
-		"IPv6linklocalallrouters",
-		"IPv6loopback",
-		"IPv6unspecified",
-		"IPv6zero",
-		"Interface",
-		"InterfaceAddrs",
-		"InterfaceByIndex",
-		"InterfaceByName",
-		"Interfaces",
-		"InvalidAddrError",
-		"JoinHostPort",
-		"Listen",
-		"ListenConfig",
-		"ListenIP",
-		"ListenMulticastUDP",
-		"ListenPacket",
-		"ListenTCP",
-		"ListenUDP",
-		"ListenUnix",
-		"ListenUnixgram",
-		"Listener",
-		"LookupAddr",
-		"LookupCNAME",
-		"LookupHost",
-		"LookupIP",
-		"LookupMX",
-		"LookupNS",
-		"LookupPort",
-		"LookupSRV",
-		"LookupTXT",
-		"MX",
-		"NS",
-		"OpError",
-		"PacketConn",
-		"ParseCIDR",
-		"ParseError",
-		"ParseIP",
-		"ParseMAC",
-		"Pipe",
-		"ResolveIPAddr",
-		"ResolveTCPAddr",
-		"ResolveUDPAddr",
-		"ResolveUnixAddr",
-		"Resolver",
-		"SRV",
-		"SplitHostPort",
-		"TCPAddr",
-		"TCPAddrFromAddrPort",
-		"TCPConn",
-		"TCPListener",
-		"UDPAddr",
-		"UDPAddrFromAddrPort",
-		"UDPConn",
-		"UnixAddr",
-		"UnixConn",
-		"UnixListener",
-		"UnknownNetworkError",
-	},
-	"net/http": {
-		"AllowQuerySemicolons",
-		"CanonicalHeaderKey",
-		"Client",
-		"CloseNotifier",
-		"ConnState",
-		"Cookie",
-		"CookieJar",
-		"DefaultClient",
-		"DefaultMaxHeaderBytes",
-		"DefaultMaxIdleConnsPerHost",
-		"DefaultServeMux",
-		"DefaultTransport",
-		"DetectContentType",
-		"Dir",
-		"ErrAbortHandler",
-		"ErrBodyNotAllowed",
-		"ErrBodyReadAfterClose",
-		"ErrContentLength",
-		"ErrHandlerTimeout",
-		"ErrHeaderTooLong",
-		"ErrHijacked",
-		"ErrLineTooLong",
-		"ErrMissingBoundary",
-		"ErrMissingContentLength",
-		"ErrMissingFile",
-		"ErrNoCookie",
-		"ErrNoLocation",
-		"ErrNotMultipart",
-		"ErrNotSupported",
-		"ErrServerClosed",
-		"ErrShortBody",
-		"ErrSkipAltProtocol",
-		"ErrUnexpectedTrailer",
-		"ErrUseLastResponse",
-		"ErrWriteAfterFlush",
-		"Error",
-		"FS",
-		"File",
-		"FileServer",
-		"FileSystem",
-		"Flusher",
-		"Get",
-		"Handle",
-		"HandleFunc",
-		"Handler",
-		"HandlerFunc",
-		"Head",
-		"Header",
-		"Hijacker",
-		"ListenAndServe",
-		"ListenAndServeTLS",
-		"LocalAddrContextKey",
-		"MaxBytesError",
-		"MaxBytesHandler",
-		"MaxBytesReader",
-		"MethodConnect",
-		"MethodDelete",
-		"MethodGet",
-		"MethodHead",
-		"MethodOptions",
-		"MethodPatch",
-		"MethodPost",
-		"MethodPut",
-		"MethodTrace",
-		"NewFileTransport",
-		"NewRequest",
-		"NewRequestWithContext",
-		"NewResponseController",
-		"NewServeMux",
-		"NoBody",
-		"NotFound",
-		"NotFoundHandler",
-		"ParseHTTPVersion",
-		"ParseTime",
-		"Post",
-		"PostForm",
-		"ProtocolError",
-		"ProxyFromEnvironment",
-		"ProxyURL",
-		"PushOptions",
-		"Pusher",
-		"ReadRequest",
-		"ReadResponse",
-		"Redirect",
-		"RedirectHandler",
-		"Request",
-		"Response",
-		"ResponseController",
-		"ResponseWriter",
-		"RoundTripper",
-		"SameSite",
-		"SameSiteDefaultMode",
-		"SameSiteLaxMode",
-		"SameSiteNoneMode",
-		"SameSiteStrictMode",
-		"Serve",
-		"ServeContent",
-		"ServeFile",
-		"ServeMux",
-		"ServeTLS",
-		"Server",
-		"ServerContextKey",
-		"SetCookie",
-		"StateActive",
-		"StateClosed",
-		"StateHijacked",
-		"StateIdle",
-		"StateNew",
-		"StatusAccepted",
-		"StatusAlreadyReported",
-		"StatusBadGateway",
-		"StatusBadRequest",
-		"StatusConflict",
-		"StatusContinue",
-		"StatusCreated",
-		"StatusEarlyHints",
-		"StatusExpectationFailed",
-		"StatusFailedDependency",
-		"StatusForbidden",
-		"StatusFound",
-		"StatusGatewayTimeout",
-		"StatusGone",
-		"StatusHTTPVersionNotSupported",
-		"StatusIMUsed",
-		"StatusInsufficientStorage",
-		"StatusInternalServerError",
-		"StatusLengthRequired",
-		"StatusLocked",
-		"StatusLoopDetected",
-		"StatusMethodNotAllowed",
-		"StatusMisdirectedRequest",
-		"StatusMovedPermanently",
-		"StatusMultiStatus",
-		"StatusMultipleChoices",
-		"StatusNetworkAuthenticationRequired",
-		"StatusNoContent",
-		"StatusNonAuthoritativeInfo",
-		"StatusNotAcceptable",
-		"StatusNotExtended",
-		"StatusNotFound",
-		"StatusNotImplemented",
-		"StatusNotModified",
-		"StatusOK",
-		"StatusPartialContent",
-		"StatusPaymentRequired",
-		"StatusPermanentRedirect",
-		"StatusPreconditionFailed",
-		"StatusPreconditionRequired",
-		"StatusProcessing",
-		"StatusProxyAuthRequired",
-		"StatusRequestEntityTooLarge",
-		"StatusRequestHeaderFieldsTooLarge",
-		"StatusRequestTimeout",
-		"StatusRequestURITooLong",
-		"StatusRequestedRangeNotSatisfiable",
-		"StatusResetContent",
-		"StatusSeeOther",
-		"StatusServiceUnavailable",
-		"StatusSwitchingProtocols",
-		"StatusTeapot",
-		"StatusTemporaryRedirect",
-		"StatusText",
-		"StatusTooEarly",
-		"StatusTooManyRequests",
-		"StatusUnauthorized",
-		"StatusUnavailableForLegalReasons",
-		"StatusUnprocessableEntity",
-		"StatusUnsupportedMediaType",
-		"StatusUpgradeRequired",
-		"StatusUseProxy",
-		"StatusVariantAlsoNegotiates",
-		"StripPrefix",
-		"TimeFormat",
-		"TimeoutHandler",
-		"TrailerPrefix",
-		"Transport",
-	},
-	"net/http/cgi": {
-		"Handler",
-		"Request",
-		"RequestFromMap",
-		"Serve",
-	},
-	"net/http/cookiejar": {
-		"Jar",
-		"New",
-		"Options",
-		"PublicSuffixList",
-	},
-	"net/http/fcgi": {
-		"ErrConnClosed",
-		"ErrRequestAborted",
-		"ProcessEnv",
-		"Serve",
-	},
-	"net/http/httptest": {
-		"DefaultRemoteAddr",
-		"NewRecorder",
-		"NewRequest",
-		"NewServer",
-		"NewTLSServer",
-		"NewUnstartedServer",
-		"ResponseRecorder",
-		"Server",
-	},
-	"net/http/httptrace": {
-		"ClientTrace",
-		"ContextClientTrace",
-		"DNSDoneInfo",
-		"DNSStartInfo",
-		"GotConnInfo",
-		"WithClientTrace",
-		"WroteRequestInfo",
-	},
-	"net/http/httputil": {
-		"BufferPool",
-		"ClientConn",
-		"DumpRequest",
-		"DumpRequestOut",
-		"DumpResponse",
-		"ErrClosed",
-		"ErrLineTooLong",
-		"ErrPersistEOF",
-		"ErrPipeline",
-		"NewChunkedReader",
-		"NewChunkedWriter",
-		"NewClientConn",
-		"NewProxyClientConn",
-		"NewServerConn",
-		"NewSingleHostReverseProxy",
-		"ProxyRequest",
-		"ReverseProxy",
-		"ServerConn",
-	},
-	"net/http/pprof": {
-		"Cmdline",
-		"Handler",
-		"Index",
-		"Profile",
-		"Symbol",
-		"Trace",
-	},
-	"net/mail": {
-		"Address",
-		"AddressParser",
-		"ErrHeaderNotPresent",
-		"Header",
-		"Message",
-		"ParseAddress",
-		"ParseAddressList",
-		"ParseDate",
-		"ReadMessage",
-	},
-	"net/netip": {
-		"Addr",
-		"AddrFrom16",
-		"AddrFrom4",
-		"AddrFromSlice",
-		"AddrPort",
-		"AddrPortFrom",
-		"IPv4Unspecified",
-		"IPv6LinkLocalAllNodes",
-		"IPv6LinkLocalAllRouters",
-		"IPv6Loopback",
-		"IPv6Unspecified",
-		"MustParseAddr",
-		"MustParseAddrPort",
-		"MustParsePrefix",
-		"ParseAddr",
-		"ParseAddrPort",
-		"ParsePrefix",
-		"Prefix",
-		"PrefixFrom",
-	},
-	"net/rpc": {
-		"Accept",
-		"Call",
-		"Client",
-		"ClientCodec",
-		"DefaultDebugPath",
-		"DefaultRPCPath",
-		"DefaultServer",
-		"Dial",
-		"DialHTTP",
-		"DialHTTPPath",
-		"ErrShutdown",
-		"HandleHTTP",
-		"NewClient",
-		"NewClientWithCodec",
-		"NewServer",
-		"Register",
-		"RegisterName",
-		"Request",
-		"Response",
-		"ServeCodec",
-		"ServeConn",
-		"ServeRequest",
-		"Server",
-		"ServerCodec",
-		"ServerError",
-	},
-	"net/rpc/jsonrpc": {
-		"Dial",
-		"NewClient",
-		"NewClientCodec",
-		"NewServerCodec",
-		"ServeConn",
-	},
-	"net/smtp": {
-		"Auth",
-		"CRAMMD5Auth",
-		"Client",
-		"Dial",
-		"NewClient",
-		"PlainAuth",
-		"SendMail",
-		"ServerInfo",
-	},
-	"net/textproto": {
-		"CanonicalMIMEHeaderKey",
-		"Conn",
-		"Dial",
-		"Error",
-		"MIMEHeader",
-		"NewConn",
-		"NewReader",
-		"NewWriter",
-		"Pipeline",
-		"ProtocolError",
-		"Reader",
-		"TrimBytes",
-		"TrimString",
-		"Writer",
-	},
-	"net/url": {
-		"Error",
-		"EscapeError",
-		"InvalidHostError",
-		"JoinPath",
-		"Parse",
-		"ParseQuery",
-		"ParseRequestURI",
-		"PathEscape",
-		"PathUnescape",
-		"QueryEscape",
-		"QueryUnescape",
-		"URL",
-		"User",
-		"UserPassword",
-		"Userinfo",
-		"Values",
-	},
-	"os": {
-		"Args",
-		"Chdir",
-		"Chmod",
-		"Chown",
-		"Chtimes",
-		"Clearenv",
-		"Create",
-		"CreateTemp",
-		"DevNull",
-		"DirEntry",
-		"DirFS",
-		"Environ",
-		"ErrClosed",
-		"ErrDeadlineExceeded",
-		"ErrExist",
-		"ErrInvalid",
-		"ErrNoDeadline",
-		"ErrNotExist",
-		"ErrPermission",
-		"ErrProcessDone",
-		"Executable",
-		"Exit",
-		"Expand",
-		"ExpandEnv",
-		"File",
-		"FileInfo",
-		"FileMode",
-		"FindProcess",
-		"Getegid",
-		"Getenv",
-		"Geteuid",
-		"Getgid",
-		"Getgroups",
-		"Getpagesize",
-		"Getpid",
-		"Getppid",
-		"Getuid",
-		"Getwd",
-		"Hostname",
-		"Interrupt",
-		"IsExist",
-		"IsNotExist",
-		"IsPathSeparator",
-		"IsPermission",
-		"IsTimeout",
-		"Kill",
-		"Lchown",
-		"Link",
-		"LinkError",
-		"LookupEnv",
-		"Lstat",
-		"Mkdir",
-		"MkdirAll",
-		"MkdirTemp",
-		"ModeAppend",
-		"ModeCharDevice",
-		"ModeDevice",
-		"ModeDir",
-		"ModeExclusive",
-		"ModeIrregular",
-		"ModeNamedPipe",
-		"ModePerm",
-		"ModeSetgid",
-		"ModeSetuid",
-		"ModeSocket",
-		"ModeSticky",
-		"ModeSymlink",
-		"ModeTemporary",
-		"ModeType",
-		"NewFile",
-		"NewSyscallError",
-		"O_APPEND",
-		"O_CREATE",
-		"O_EXCL",
-		"O_RDONLY",
-		"O_RDWR",
-		"O_SYNC",
-		"O_TRUNC",
-		"O_WRONLY",
-		"Open",
-		"OpenFile",
-		"PathError",
-		"PathListSeparator",
-		"PathSeparator",
-		"Pipe",
-		"ProcAttr",
-		"Process",
-		"ProcessState",
-		"ReadDir",
-		"ReadFile",
-		"Readlink",
-		"Remove",
-		"RemoveAll",
-		"Rename",
-		"SEEK_CUR",
-		"SEEK_END",
-		"SEEK_SET",
-		"SameFile",
-		"Setenv",
-		"Signal",
-		"StartProcess",
-		"Stat",
-		"Stderr",
-		"Stdin",
-		"Stdout",
-		"Symlink",
-		"SyscallError",
-		"TempDir",
-		"Truncate",
-		"Unsetenv",
-		"UserCacheDir",
-		"UserConfigDir",
-		"UserHomeDir",
-		"WriteFile",
-	},
-	"os/exec": {
-		"Cmd",
-		"Command",
-		"CommandContext",
-		"ErrDot",
-		"ErrNotFound",
-		"ErrWaitDelay",
-		"Error",
-		"ExitError",
-		"LookPath",
-	},
-	"os/signal": {
-		"Ignore",
-		"Ignored",
-		"Notify",
-		"NotifyContext",
-		"Reset",
-		"Stop",
-	},
-	"os/user": {
-		"Current",
-		"Group",
-		"Lookup",
-		"LookupGroup",
-		"LookupGroupId",
-		"LookupId",
-		"UnknownGroupError",
-		"UnknownGroupIdError",
-		"UnknownUserError",
-		"UnknownUserIdError",
-		"User",
-	},
-	"path": {
-		"Base",
-		"Clean",
-		"Dir",
-		"ErrBadPattern",
-		"Ext",
-		"IsAbs",
-		"Join",
-		"Match",
-		"Split",
-	},
-	"path/filepath": {
-		"Abs",
-		"Base",
-		"Clean",
-		"Dir",
-		"ErrBadPattern",
-		"EvalSymlinks",
-		"Ext",
-		"FromSlash",
-		"Glob",
-		"HasPrefix",
-		"IsAbs",
-		"IsLocal",
-		"Join",
-		"ListSeparator",
-		"Match",
-		"Rel",
-		"Separator",
-		"SkipAll",
-		"SkipDir",
-		"Split",
-		"SplitList",
-		"ToSlash",
-		"VolumeName",
-		"Walk",
-		"WalkDir",
-		"WalkFunc",
-	},
-	"plugin": {
-		"Open",
-		"Plugin",
-		"Symbol",
-	},
-	"reflect": {
-		"Append",
-		"AppendSlice",
-		"Array",
-		"ArrayOf",
-		"Bool",
-		"BothDir",
-		"Chan",
-		"ChanDir",
-		"ChanOf",
-		"Complex128",
-		"Complex64",
-		"Copy",
-		"DeepEqual",
-		"Float32",
-		"Float64",
-		"Func",
-		"FuncOf",
-		"Indirect",
-		"Int",
-		"Int16",
-		"Int32",
-		"Int64",
-		"Int8",
-		"Interface",
-		"Invalid",
-		"Kind",
-		"MakeChan",
-		"MakeFunc",
-		"MakeMap",
-		"MakeMapWithSize",
-		"MakeSlice",
-		"Map",
-		"MapIter",
-		"MapOf",
-		"Method",
-		"New",
-		"NewAt",
-		"Pointer",
-		"PointerTo",
-		"Ptr",
-		"PtrTo",
-		"RecvDir",
-		"Select",
-		"SelectCase",
-		"SelectDefault",
-		"SelectDir",
-		"SelectRecv",
-		"SelectSend",
-		"SendDir",
-		"Slice",
-		"SliceHeader",
-		"SliceOf",
-		"String",
-		"StringHeader",
-		"Struct",
-		"StructField",
-		"StructOf",
-		"StructTag",
-		"Swapper",
-		"Type",
-		"TypeOf",
-		"Uint",
-		"Uint16",
-		"Uint32",
-		"Uint64",
-		"Uint8",
-		"Uintptr",
-		"UnsafePointer",
-		"Value",
-		"ValueError",
-		"ValueOf",
-		"VisibleFields",
-		"Zero",
-	},
-	"regexp": {
-		"Compile",
-		"CompilePOSIX",
-		"Match",
-		"MatchReader",
-		"MatchString",
-		"MustCompile",
-		"MustCompilePOSIX",
-		"QuoteMeta",
-		"Regexp",
-	},
-	"regexp/syntax": {
-		"ClassNL",
-		"Compile",
-		"DotNL",
-		"EmptyBeginLine",
-		"EmptyBeginText",
-		"EmptyEndLine",
-		"EmptyEndText",
-		"EmptyNoWordBoundary",
-		"EmptyOp",
-		"EmptyOpContext",
-		"EmptyWordBoundary",
-		"ErrInternalError",
-		"ErrInvalidCharClass",
-		"ErrInvalidCharRange",
-		"ErrInvalidEscape",
-		"ErrInvalidNamedCapture",
-		"ErrInvalidPerlOp",
-		"ErrInvalidRepeatOp",
-		"ErrInvalidRepeatSize",
-		"ErrInvalidUTF8",
-		"ErrLarge",
-		"ErrMissingBracket",
-		"ErrMissingParen",
-		"ErrMissingRepeatArgument",
-		"ErrNestingDepth",
-		"ErrTrailingBackslash",
-		"ErrUnexpectedParen",
-		"Error",
-		"ErrorCode",
-		"Flags",
-		"FoldCase",
-		"Inst",
-		"InstAlt",
-		"InstAltMatch",
-		"InstCapture",
-		"InstEmptyWidth",
-		"InstFail",
-		"InstMatch",
-		"InstNop",
-		"InstOp",
-		"InstRune",
-		"InstRune1",
-		"InstRuneAny",
-		"InstRuneAnyNotNL",
-		"IsWordChar",
-		"Literal",
-		"MatchNL",
-		"NonGreedy",
-		"OneLine",
-		"Op",
-		"OpAlternate",
-		"OpAnyChar",
-		"OpAnyCharNotNL",
-		"OpBeginLine",
-		"OpBeginText",
-		"OpCapture",
-		"OpCharClass",
-		"OpConcat",
-		"OpEmptyMatch",
-		"OpEndLine",
-		"OpEndText",
-		"OpLiteral",
-		"OpNoMatch",
-		"OpNoWordBoundary",
-		"OpPlus",
-		"OpQuest",
-		"OpRepeat",
-		"OpStar",
-		"OpWordBoundary",
-		"POSIX",
-		"Parse",
-		"Perl",
-		"PerlX",
-		"Prog",
-		"Regexp",
-		"Simple",
-		"UnicodeGroups",
-		"WasDollar",
-	},
-	"runtime": {
-		"BlockProfile",
-		"BlockProfileRecord",
-		"Breakpoint",
-		"CPUProfile",
-		"Caller",
-		"Callers",
-		"CallersFrames",
-		"Compiler",
-		"Error",
-		"Frame",
-		"Frames",
-		"Func",
-		"FuncForPC",
-		"GC",
-		"GOARCH",
-		"GOMAXPROCS",
-		"GOOS",
-		"GOROOT",
-		"Goexit",
-		"GoroutineProfile",
-		"Gosched",
-		"KeepAlive",
-		"LockOSThread",
-		"MemProfile",
-		"MemProfileRate",
-		"MemProfileRecord",
-		"MemStats",
-		"MutexProfile",
-		"NumCPU",
-		"NumCgoCall",
-		"NumGoroutine",
-		"ReadMemStats",
-		"ReadTrace",
-		"SetBlockProfileRate",
-		"SetCPUProfileRate",
-		"SetCgoTraceback",
-		"SetFinalizer",
-		"SetMutexProfileFraction",
-		"Stack",
-		"StackRecord",
-		"StartTrace",
-		"StopTrace",
-		"ThreadCreateProfile",
-		"TypeAssertionError",
-		"UnlockOSThread",
-		"Version",
-	},
-	"runtime/cgo": {
-		"Handle",
-		"Incomplete",
-		"NewHandle",
-	},
-	"runtime/coverage": {
-		"ClearCounters",
-		"WriteCounters",
-		"WriteCountersDir",
-		"WriteMeta",
-		"WriteMetaDir",
-	},
-	"runtime/debug": {
-		"BuildInfo",
-		"BuildSetting",
-		"FreeOSMemory",
-		"GCStats",
-		"Module",
-		"ParseBuildInfo",
-		"PrintStack",
-		"ReadBuildInfo",
-		"ReadGCStats",
-		"SetGCPercent",
-		"SetMaxStack",
-		"SetMaxThreads",
-		"SetMemoryLimit",
-		"SetPanicOnFault",
-		"SetTraceback",
-		"Stack",
-		"WriteHeapDump",
-	},
-	"runtime/metrics": {
-		"All",
-		"Description",
-		"Float64Histogram",
-		"KindBad",
-		"KindFloat64",
-		"KindFloat64Histogram",
-		"KindUint64",
-		"Read",
-		"Sample",
-		"Value",
-		"ValueKind",
-	},
-	"runtime/pprof": {
-		"Do",
-		"ForLabels",
-		"Label",
-		"LabelSet",
-		"Labels",
-		"Lookup",
-		"NewProfile",
-		"Profile",
-		"Profiles",
-		"SetGoroutineLabels",
-		"StartCPUProfile",
-		"StopCPUProfile",
-		"WithLabels",
-		"WriteHeapProfile",
-	},
-	"runtime/trace": {
-		"IsEnabled",
-		"Log",
-		"Logf",
-		"NewTask",
-		"Region",
-		"Start",
-		"StartRegion",
-		"Stop",
-		"Task",
-		"WithRegion",
-	},
-	"sort": {
-		"Find",
-		"Float64Slice",
-		"Float64s",
-		"Float64sAreSorted",
-		"IntSlice",
-		"Interface",
-		"Ints",
-		"IntsAreSorted",
-		"IsSorted",
-		"Reverse",
-		"Search",
-		"SearchFloat64s",
-		"SearchInts",
-		"SearchStrings",
-		"Slice",
-		"SliceIsSorted",
-		"SliceStable",
-		"Sort",
-		"Stable",
-		"StringSlice",
-		"Strings",
-		"StringsAreSorted",
-	},
-	"strconv": {
-		"AppendBool",
-		"AppendFloat",
-		"AppendInt",
-		"AppendQuote",
-		"AppendQuoteRune",
-		"AppendQuoteRuneToASCII",
-		"AppendQuoteRuneToGraphic",
-		"AppendQuoteToASCII",
-		"AppendQuoteToGraphic",
-		"AppendUint",
-		"Atoi",
-		"CanBackquote",
-		"ErrRange",
-		"ErrSyntax",
-		"FormatBool",
-		"FormatComplex",
-		"FormatFloat",
-		"FormatInt",
-		"FormatUint",
-		"IntSize",
-		"IsGraphic",
-		"IsPrint",
-		"Itoa",
-		"NumError",
-		"ParseBool",
-		"ParseComplex",
-		"ParseFloat",
-		"ParseInt",
-		"ParseUint",
-		"Quote",
-		"QuoteRune",
-		"QuoteRuneToASCII",
-		"QuoteRuneToGraphic",
-		"QuoteToASCII",
-		"QuoteToGraphic",
-		"QuotedPrefix",
-		"Unquote",
-		"UnquoteChar",
-	},
-	"strings": {
-		"Builder",
-		"Clone",
-		"Compare",
-		"Contains",
-		"ContainsAny",
-		"ContainsRune",
-		"Count",
-		"Cut",
-		"CutPrefix",
-		"CutSuffix",
-		"EqualFold",
-		"Fields",
-		"FieldsFunc",
-		"HasPrefix",
-		"HasSuffix",
-		"Index",
-		"IndexAny",
-		"IndexByte",
-		"IndexFunc",
-		"IndexRune",
-		"Join",
-		"LastIndex",
-		"LastIndexAny",
-		"LastIndexByte",
-		"LastIndexFunc",
-		"Map",
-		"NewReader",
-		"NewReplacer",
-		"Reader",
-		"Repeat",
-		"Replace",
-		"ReplaceAll",
-		"Replacer",
-		"Split",
-		"SplitAfter",
-		"SplitAfterN",
-		"SplitN",
-		"Title",
-		"ToLower",
-		"ToLowerSpecial",
-		"ToTitle",
-		"ToTitleSpecial",
-		"ToUpper",
-		"ToUpperSpecial",
-		"ToValidUTF8",
-		"Trim",
-		"TrimFunc",
-		"TrimLeft",
-		"TrimLeftFunc",
-		"TrimPrefix",
-		"TrimRight",
-		"TrimRightFunc",
-		"TrimSpace",
-		"TrimSuffix",
-	},
-	"sync": {
-		"Cond",
-		"Locker",
-		"Map",
-		"Mutex",
-		"NewCond",
-		"Once",
-		"Pool",
-		"RWMutex",
-		"WaitGroup",
-	},
-	"sync/atomic": {
-		"AddInt32",
-		"AddInt64",
-		"AddUint32",
-		"AddUint64",
-		"AddUintptr",
-		"Bool",
-		"CompareAndSwapInt32",
-		"CompareAndSwapInt64",
-		"CompareAndSwapPointer",
-		"CompareAndSwapUint32",
-		"CompareAndSwapUint64",
-		"CompareAndSwapUintptr",
-		"Int32",
-		"Int64",
-		"LoadInt32",
-		"LoadInt64",
-		"LoadPointer",
-		"LoadUint32",
-		"LoadUint64",
-		"LoadUintptr",
-		"Pointer",
-		"StoreInt32",
-		"StoreInt64",
-		"StorePointer",
-		"StoreUint32",
-		"StoreUint64",
-		"StoreUintptr",
-		"SwapInt32",
-		"SwapInt64",
-		"SwapPointer",
-		"SwapUint32",
-		"SwapUint64",
-		"SwapUintptr",
-		"Uint32",
-		"Uint64",
-		"Uintptr",
-		"Value",
-	},
-	"syscall": {
-		"AF_ALG",
-		"AF_APPLETALK",
-		"AF_ARP",
-		"AF_ASH",
-		"AF_ATM",
-		"AF_ATMPVC",
-		"AF_ATMSVC",
-		"AF_AX25",
-		"AF_BLUETOOTH",
-		"AF_BRIDGE",
-		"AF_CAIF",
-		"AF_CAN",
-		"AF_CCITT",
-		"AF_CHAOS",
-		"AF_CNT",
-		"AF_COIP",
-		"AF_DATAKIT",
-		"AF_DECnet",
-		"AF_DLI",
-		"AF_E164",
-		"AF_ECMA",
-		"AF_ECONET",
-		"AF_ENCAP",
-		"AF_FILE",
-		"AF_HYLINK",
-		"AF_IEEE80211",
-		"AF_IEEE802154",
-		"AF_IMPLINK",
-		"AF_INET",
-		"AF_INET6",
-		"AF_INET6_SDP",
-		"AF_INET_SDP",
-		"AF_IPX",
-		"AF_IRDA",
-		"AF_ISDN",
-		"AF_ISO",
-		"AF_IUCV",
-		"AF_KEY",
-		"AF_LAT",
-		"AF_LINK",
-		"AF_LLC",
-		"AF_LOCAL",
-		"AF_MAX",
-		"AF_MPLS",
-		"AF_NATM",
-		"AF_NDRV",
-		"AF_NETBEUI",
-		"AF_NETBIOS",
-		"AF_NETGRAPH",
-		"AF_NETLINK",
-		"AF_NETROM",
-		"AF_NS",
-		"AF_OROUTE",
-		"AF_OSI",
-		"AF_PACKET",
-		"AF_PHONET",
-		"AF_PPP",
-		"AF_PPPOX",
-		"AF_PUP",
-		"AF_RDS",
-		"AF_RESERVED_36",
-		"AF_ROSE",
-		"AF_ROUTE",
-		"AF_RXRPC",
-		"AF_SCLUSTER",
-		"AF_SECURITY",
-		"AF_SIP",
-		"AF_SLOW",
-		"AF_SNA",
-		"AF_SYSTEM",
-		"AF_TIPC",
-		"AF_UNIX",
-		"AF_UNSPEC",
-		"AF_UTUN",
-		"AF_VENDOR00",
-		"AF_VENDOR01",
-		"AF_VENDOR02",
-		"AF_VENDOR03",
-		"AF_VENDOR04",
-		"AF_VENDOR05",
-		"AF_VENDOR06",
-		"AF_VENDOR07",
-		"AF_VENDOR08",
-		"AF_VENDOR09",
-		"AF_VENDOR10",
-		"AF_VENDOR11",
-		"AF_VENDOR12",
-		"AF_VENDOR13",
-		"AF_VENDOR14",
-		"AF_VENDOR15",
-		"AF_VENDOR16",
-		"AF_VENDOR17",
-		"AF_VENDOR18",
-		"AF_VENDOR19",
-		"AF_VENDOR20",
-		"AF_VENDOR21",
-		"AF_VENDOR22",
-		"AF_VENDOR23",
-		"AF_VENDOR24",
-		"AF_VENDOR25",
-		"AF_VENDOR26",
-		"AF_VENDOR27",
-		"AF_VENDOR28",
-		"AF_VENDOR29",
-		"AF_VENDOR30",
-		"AF_VENDOR31",
-		"AF_VENDOR32",
-		"AF_VENDOR33",
-		"AF_VENDOR34",
-		"AF_VENDOR35",
-		"AF_VENDOR36",
-		"AF_VENDOR37",
-		"AF_VENDOR38",
-		"AF_VENDOR39",
-		"AF_VENDOR40",
-		"AF_VENDOR41",
-		"AF_VENDOR42",
-		"AF_VENDOR43",
-		"AF_VENDOR44",
-		"AF_VENDOR45",
-		"AF_VENDOR46",
-		"AF_VENDOR47",
-		"AF_WANPIPE",
-		"AF_X25",
-		"AI_CANONNAME",
-		"AI_NUMERICHOST",
-		"AI_PASSIVE",
-		"APPLICATION_ERROR",
-		"ARPHRD_ADAPT",
-		"ARPHRD_APPLETLK",
-		"ARPHRD_ARCNET",
-		"ARPHRD_ASH",
-		"ARPHRD_ATM",
-		"ARPHRD_AX25",
-		"ARPHRD_BIF",
-		"ARPHRD_CHAOS",
-		"ARPHRD_CISCO",
-		"ARPHRD_CSLIP",
-		"ARPHRD_CSLIP6",
-		"ARPHRD_DDCMP",
-		"ARPHRD_DLCI",
-		"ARPHRD_ECONET",
-		"ARPHRD_EETHER",
-		"ARPHRD_ETHER",
-		"ARPHRD_EUI64",
-		"ARPHRD_FCAL",
-		"ARPHRD_FCFABRIC",
-		"ARPHRD_FCPL",
-		"ARPHRD_FCPP",
-		"ARPHRD_FDDI",
-		"ARPHRD_FRAD",
-		"ARPHRD_FRELAY",
-		"ARPHRD_HDLC",
-		"ARPHRD_HIPPI",
-		"ARPHRD_HWX25",
-		"ARPHRD_IEEE1394",
-		"ARPHRD_IEEE802",
-		"ARPHRD_IEEE80211",
-		"ARPHRD_IEEE80211_PRISM",
-		"ARPHRD_IEEE80211_RADIOTAP",
-		"ARPHRD_IEEE802154",
-		"ARPHRD_IEEE802154_PHY",
-		"ARPHRD_IEEE802_TR",
-		"ARPHRD_INFINIBAND",
-		"ARPHRD_IPDDP",
-		"ARPHRD_IPGRE",
-		"ARPHRD_IRDA",
-		"ARPHRD_LAPB",
-		"ARPHRD_LOCALTLK",
-		"ARPHRD_LOOPBACK",
-		"ARPHRD_METRICOM",
-		"ARPHRD_NETROM",
-		"ARPHRD_NONE",
-		"ARPHRD_PIMREG",
-		"ARPHRD_PPP",
-		"ARPHRD_PRONET",
-		"ARPHRD_RAWHDLC",
-		"ARPHRD_ROSE",
-		"ARPHRD_RSRVD",
-		"ARPHRD_SIT",
-		"ARPHRD_SKIP",
-		"ARPHRD_SLIP",
-		"ARPHRD_SLIP6",
-		"ARPHRD_STRIP",
-		"ARPHRD_TUNNEL",
-		"ARPHRD_TUNNEL6",
-		"ARPHRD_VOID",
-		"ARPHRD_X25",
-		"AUTHTYPE_CLIENT",
-		"AUTHTYPE_SERVER",
-		"Accept",
-		"Accept4",
-		"AcceptEx",
-		"Access",
-		"Acct",
-		"AddrinfoW",
-		"Adjtime",
-		"Adjtimex",
-		"AllThreadsSyscall",
-		"AllThreadsSyscall6",
-		"AttachLsf",
-		"B0",
-		"B1000000",
-		"B110",
-		"B115200",
-		"B1152000",
-		"B1200",
-		"B134",
-		"B14400",
-		"B150",
-		"B1500000",
-		"B1800",
-		"B19200",
-		"B200",
-		"B2000000",
-		"B230400",
-		"B2400",
-		"B2500000",
-		"B28800",
-		"B300",
-		"B3000000",
-		"B3500000",
-		"B38400",
-		"B4000000",
-		"B460800",
-		"B4800",
-		"B50",
-		"B500000",
-		"B57600",
-		"B576000",
-		"B600",
-		"B7200",
-		"B75",
-		"B76800",
-		"B921600",
-		"B9600",
-		"BASE_PROTOCOL",
-		"BIOCFEEDBACK",
-		"BIOCFLUSH",
-		"BIOCGBLEN",
-		"BIOCGDIRECTION",
-		"BIOCGDIRFILT",
-		"BIOCGDLT",
-		"BIOCGDLTLIST",
-		"BIOCGETBUFMODE",
-		"BIOCGETIF",
-		"BIOCGETZMAX",
-		"BIOCGFEEDBACK",
-		"BIOCGFILDROP",
-		"BIOCGHDRCMPLT",
-		"BIOCGRSIG",
-		"BIOCGRTIMEOUT",
-		"BIOCGSEESENT",
-		"BIOCGSTATS",
-		"BIOCGSTATSOLD",
-		"BIOCGTSTAMP",
-		"BIOCIMMEDIATE",
-		"BIOCLOCK",
-		"BIOCPROMISC",
-		"BIOCROTZBUF",
-		"BIOCSBLEN",
-		"BIOCSDIRECTION",
-		"BIOCSDIRFILT",
-		"BIOCSDLT",
-		"BIOCSETBUFMODE",
-		"BIOCSETF",
-		"BIOCSETFNR",
-		"BIOCSETIF",
-		"BIOCSETWF",
-		"BIOCSETZBUF",
-		"BIOCSFEEDBACK",
-		"BIOCSFILDROP",
-		"BIOCSHDRCMPLT",
-		"BIOCSRSIG",
-		"BIOCSRTIMEOUT",
-		"BIOCSSEESENT",
-		"BIOCSTCPF",
-		"BIOCSTSTAMP",
-		"BIOCSUDPF",
-		"BIOCVERSION",
-		"BPF_A",
-		"BPF_ABS",
-		"BPF_ADD",
-		"BPF_ALIGNMENT",
-		"BPF_ALIGNMENT32",
-		"BPF_ALU",
-		"BPF_AND",
-		"BPF_B",
-		"BPF_BUFMODE_BUFFER",
-		"BPF_BUFMODE_ZBUF",
-		"BPF_DFLTBUFSIZE",
-		"BPF_DIRECTION_IN",
-		"BPF_DIRECTION_OUT",
-		"BPF_DIV",
-		"BPF_H",
-		"BPF_IMM",
-		"BPF_IND",
-		"BPF_JA",
-		"BPF_JEQ",
-		"BPF_JGE",
-		"BPF_JGT",
-		"BPF_JMP",
-		"BPF_JSET",
-		"BPF_K",
-		"BPF_LD",
-		"BPF_LDX",
-		"BPF_LEN",
-		"BPF_LSH",
-		"BPF_MAJOR_VERSION",
-		"BPF_MAXBUFSIZE",
-		"BPF_MAXINSNS",
-		"BPF_MEM",
-		"BPF_MEMWORDS",
-		"BPF_MINBUFSIZE",
-		"BPF_MINOR_VERSION",
-		"BPF_MISC",
-		"BPF_MSH",
-		"BPF_MUL",
-		"BPF_NEG",
-		"BPF_OR",
-		"BPF_RELEASE",
-		"BPF_RET",
-		"BPF_RSH",
-		"BPF_ST",
-		"BPF_STX",
-		"BPF_SUB",
-		"BPF_TAX",
-		"BPF_TXA",
-		"BPF_T_BINTIME",
-		"BPF_T_BINTIME_FAST",
-		"BPF_T_BINTIME_MONOTONIC",
-		"BPF_T_BINTIME_MONOTONIC_FAST",
-		"BPF_T_FAST",
-		"BPF_T_FLAG_MASK",
-		"BPF_T_FORMAT_MASK",
-		"BPF_T_MICROTIME",
-		"BPF_T_MICROTIME_FAST",
-		"BPF_T_MICROTIME_MONOTONIC",
-		"BPF_T_MICROTIME_MONOTONIC_FAST",
-		"BPF_T_MONOTONIC",
-		"BPF_T_MONOTONIC_FAST",
-		"BPF_T_NANOTIME",
-		"BPF_T_NANOTIME_FAST",
-		"BPF_T_NANOTIME_MONOTONIC",
-		"BPF_T_NANOTIME_MONOTONIC_FAST",
-		"BPF_T_NONE",
-		"BPF_T_NORMAL",
-		"BPF_W",
-		"BPF_X",
-		"BRKINT",
-		"Bind",
-		"BindToDevice",
-		"BpfBuflen",
-		"BpfDatalink",
-		"BpfHdr",
-		"BpfHeadercmpl",
-		"BpfInsn",
-		"BpfInterface",
-		"BpfJump",
-		"BpfProgram",
-		"BpfStat",
-		"BpfStats",
-		"BpfStmt",
-		"BpfTimeout",
-		"BpfTimeval",
-		"BpfVersion",
-		"BpfZbuf",
-		"BpfZbufHeader",
-		"ByHandleFileInformation",
-		"BytePtrFromString",
-		"ByteSliceFromString",
-		"CCR0_FLUSH",
-		"CERT_CHAIN_POLICY_AUTHENTICODE",
-		"CERT_CHAIN_POLICY_AUTHENTICODE_TS",
-		"CERT_CHAIN_POLICY_BASE",
-		"CERT_CHAIN_POLICY_BASIC_CONSTRAINTS",
-		"CERT_CHAIN_POLICY_EV",
-		"CERT_CHAIN_POLICY_MICROSOFT_ROOT",
-		"CERT_CHAIN_POLICY_NT_AUTH",
-		"CERT_CHAIN_POLICY_SSL",
-		"CERT_E_CN_NO_MATCH",
-		"CERT_E_EXPIRED",
-		"CERT_E_PURPOSE",
-		"CERT_E_ROLE",
-		"CERT_E_UNTRUSTEDROOT",
-		"CERT_STORE_ADD_ALWAYS",
-		"CERT_STORE_DEFER_CLOSE_UNTIL_LAST_FREE_FLAG",
-		"CERT_STORE_PROV_MEMORY",
-		"CERT_TRUST_HAS_EXCLUDED_NAME_CONSTRAINT",
-		"CERT_TRUST_HAS_NOT_DEFINED_NAME_CONSTRAINT",
-		"CERT_TRUST_HAS_NOT_PERMITTED_NAME_CONSTRAINT",
-		"CERT_TRUST_HAS_NOT_SUPPORTED_CRITICAL_EXT",
-		"CERT_TRUST_HAS_NOT_SUPPORTED_NAME_CONSTRAINT",
-		"CERT_TRUST_INVALID_BASIC_CONSTRAINTS",
-		"CERT_TRUST_INVALID_EXTENSION",
-		"CERT_TRUST_INVALID_NAME_CONSTRAINTS",
-		"CERT_TRUST_INVALID_POLICY_CONSTRAINTS",
-		"CERT_TRUST_IS_CYCLIC",
-		"CERT_TRUST_IS_EXPLICIT_DISTRUST",
-		"CERT_TRUST_IS_NOT_SIGNATURE_VALID",
-		"CERT_TRUST_IS_NOT_TIME_VALID",
-		"CERT_TRUST_IS_NOT_VALID_FOR_USAGE",
-		"CERT_TRUST_IS_OFFLINE_REVOCATION",
-		"CERT_TRUST_IS_REVOKED",
-		"CERT_TRUST_IS_UNTRUSTED_ROOT",
-		"CERT_TRUST_NO_ERROR",
-		"CERT_TRUST_NO_ISSUANCE_CHAIN_POLICY",
-		"CERT_TRUST_REVOCATION_STATUS_UNKNOWN",
-		"CFLUSH",
-		"CLOCAL",
-		"CLONE_CHILD_CLEARTID",
-		"CLONE_CHILD_SETTID",
-		"CLONE_CLEAR_SIGHAND",
-		"CLONE_CSIGNAL",
-		"CLONE_DETACHED",
-		"CLONE_FILES",
-		"CLONE_FS",
-		"CLONE_INTO_CGROUP",
-		"CLONE_IO",
-		"CLONE_NEWCGROUP",
-		"CLONE_NEWIPC",
-		"CLONE_NEWNET",
-		"CLONE_NEWNS",
-		"CLONE_NEWPID",
-		"CLONE_NEWTIME",
-		"CLONE_NEWUSER",
-		"CLONE_NEWUTS",
-		"CLONE_PARENT",
-		"CLONE_PARENT_SETTID",
-		"CLONE_PID",
-		"CLONE_PIDFD",
-		"CLONE_PTRACE",
-		"CLONE_SETTLS",
-		"CLONE_SIGHAND",
-		"CLONE_SYSVSEM",
-		"CLONE_THREAD",
-		"CLONE_UNTRACED",
-		"CLONE_VFORK",
-		"CLONE_VM",
-		"CPUID_CFLUSH",
-		"CREAD",
-		"CREATE_ALWAYS",
-		"CREATE_NEW",
-		"CREATE_NEW_PROCESS_GROUP",
-		"CREATE_UNICODE_ENVIRONMENT",
-		"CRYPT_DEFAULT_CONTAINER_OPTIONAL",
-		"CRYPT_DELETEKEYSET",
-		"CRYPT_MACHINE_KEYSET",
-		"CRYPT_NEWKEYSET",
-		"CRYPT_SILENT",
-		"CRYPT_VERIFYCONTEXT",
-		"CS5",
-		"CS6",
-		"CS7",
-		"CS8",
-		"CSIZE",
-		"CSTART",
-		"CSTATUS",
-		"CSTOP",
-		"CSTOPB",
-		"CSUSP",
-		"CTL_MAXNAME",
-		"CTL_NET",
-		"CTL_QUERY",
-		"CTRL_BREAK_EVENT",
-		"CTRL_CLOSE_EVENT",
-		"CTRL_C_EVENT",
-		"CTRL_LOGOFF_EVENT",
-		"CTRL_SHUTDOWN_EVENT",
-		"CancelIo",
-		"CancelIoEx",
-		"CertAddCertificateContextToStore",
-		"CertChainContext",
-		"CertChainElement",
-		"CertChainPara",
-		"CertChainPolicyPara",
-		"CertChainPolicyStatus",
-		"CertCloseStore",
-		"CertContext",
-		"CertCreateCertificateContext",
-		"CertEnhKeyUsage",
-		"CertEnumCertificatesInStore",
-		"CertFreeCertificateChain",
-		"CertFreeCertificateContext",
-		"CertGetCertificateChain",
-		"CertInfo",
-		"CertOpenStore",
-		"CertOpenSystemStore",
-		"CertRevocationCrlInfo",
-		"CertRevocationInfo",
-		"CertSimpleChain",
-		"CertTrustListInfo",
-		"CertTrustStatus",
-		"CertUsageMatch",
-		"CertVerifyCertificateChainPolicy",
-		"Chdir",
-		"CheckBpfVersion",
-		"Chflags",
-		"Chmod",
-		"Chown",
-		"Chroot",
-		"Clearenv",
-		"Close",
-		"CloseHandle",
-		"CloseOnExec",
-		"Closesocket",
-		"CmsgLen",
-		"CmsgSpace",
-		"Cmsghdr",
-		"CommandLineToArgv",
-		"ComputerName",
-		"Conn",
-		"Connect",
-		"ConnectEx",
-		"ConvertSidToStringSid",
-		"ConvertStringSidToSid",
-		"CopySid",
-		"Creat",
-		"CreateDirectory",
-		"CreateFile",
-		"CreateFileMapping",
-		"CreateHardLink",
-		"CreateIoCompletionPort",
-		"CreatePipe",
-		"CreateProcess",
-		"CreateProcessAsUser",
-		"CreateSymbolicLink",
-		"CreateToolhelp32Snapshot",
-		"Credential",
-		"CryptAcquireContext",
-		"CryptGenRandom",
-		"CryptReleaseContext",
-		"DIOCBSFLUSH",
-		"DIOCOSFPFLUSH",
-		"DLL",
-		"DLLError",
-		"DLT_A429",
-		"DLT_A653_ICM",
-		"DLT_AIRONET_HEADER",
-		"DLT_AOS",
-		"DLT_APPLE_IP_OVER_IEEE1394",
-		"DLT_ARCNET",
-		"DLT_ARCNET_LINUX",
-		"DLT_ATM_CLIP",
-		"DLT_ATM_RFC1483",
-		"DLT_AURORA",
-		"DLT_AX25",
-		"DLT_AX25_KISS",
-		"DLT_BACNET_MS_TP",
-		"DLT_BLUETOOTH_HCI_H4",
-		"DLT_BLUETOOTH_HCI_H4_WITH_PHDR",
-		"DLT_CAN20B",
-		"DLT_CAN_SOCKETCAN",
-		"DLT_CHAOS",
-		"DLT_CHDLC",
-		"DLT_CISCO_IOS",
-		"DLT_C_HDLC",
-		"DLT_C_HDLC_WITH_DIR",
-		"DLT_DBUS",
-		"DLT_DECT",
-		"DLT_DOCSIS",
-		"DLT_DVB_CI",
-		"DLT_ECONET",
-		"DLT_EN10MB",
-		"DLT_EN3MB",
-		"DLT_ENC",
-		"DLT_ERF",
-		"DLT_ERF_ETH",
-		"DLT_ERF_POS",
-		"DLT_FC_2",
-		"DLT_FC_2_WITH_FRAME_DELIMS",
-		"DLT_FDDI",
-		"DLT_FLEXRAY",
-		"DLT_FRELAY",
-		"DLT_FRELAY_WITH_DIR",
-		"DLT_GCOM_SERIAL",
-		"DLT_GCOM_T1E1",
-		"DLT_GPF_F",
-		"DLT_GPF_T",
-		"DLT_GPRS_LLC",
-		"DLT_GSMTAP_ABIS",
-		"DLT_GSMTAP_UM",
-		"DLT_HDLC",
-		"DLT_HHDLC",
-		"DLT_HIPPI",
-		"DLT_IBM_SN",
-		"DLT_IBM_SP",
-		"DLT_IEEE802",
-		"DLT_IEEE802_11",
-		"DLT_IEEE802_11_RADIO",
-		"DLT_IEEE802_11_RADIO_AVS",
-		"DLT_IEEE802_15_4",
-		"DLT_IEEE802_15_4_LINUX",
-		"DLT_IEEE802_15_4_NOFCS",
-		"DLT_IEEE802_15_4_NONASK_PHY",
-		"DLT_IEEE802_16_MAC_CPS",
-		"DLT_IEEE802_16_MAC_CPS_RADIO",
-		"DLT_IPFILTER",
-		"DLT_IPMB",
-		"DLT_IPMB_LINUX",
-		"DLT_IPNET",
-		"DLT_IPOIB",
-		"DLT_IPV4",
-		"DLT_IPV6",
-		"DLT_IP_OVER_FC",
-		"DLT_JUNIPER_ATM1",
-		"DLT_JUNIPER_ATM2",
-		"DLT_JUNIPER_ATM_CEMIC",
-		"DLT_JUNIPER_CHDLC",
-		"DLT_JUNIPER_ES",
-		"DLT_JUNIPER_ETHER",
-		"DLT_JUNIPER_FIBRECHANNEL",
-		"DLT_JUNIPER_FRELAY",
-		"DLT_JUNIPER_GGSN",
-		"DLT_JUNIPER_ISM",
-		"DLT_JUNIPER_MFR",
-		"DLT_JUNIPER_MLFR",
-		"DLT_JUNIPER_MLPPP",
-		"DLT_JUNIPER_MONITOR",
-		"DLT_JUNIPER_PIC_PEER",
-		"DLT_JUNIPER_PPP",
-		"DLT_JUNIPER_PPPOE",
-		"DLT_JUNIPER_PPPOE_ATM",
-		"DLT_JUNIPER_SERVICES",
-		"DLT_JUNIPER_SRX_E2E",
-		"DLT_JUNIPER_ST",
-		"DLT_JUNIPER_VP",
-		"DLT_JUNIPER_VS",
-		"DLT_LAPB_WITH_DIR",
-		"DLT_LAPD",
-		"DLT_LIN",
-		"DLT_LINUX_EVDEV",
-		"DLT_LINUX_IRDA",
-		"DLT_LINUX_LAPD",
-		"DLT_LINUX_PPP_WITHDIRECTION",
-		"DLT_LINUX_SLL",
-		"DLT_LOOP",
-		"DLT_LTALK",
-		"DLT_MATCHING_MAX",
-		"DLT_MATCHING_MIN",
-		"DLT_MFR",
-		"DLT_MOST",
-		"DLT_MPEG_2_TS",
-		"DLT_MPLS",
-		"DLT_MTP2",
-		"DLT_MTP2_WITH_PHDR",
-		"DLT_MTP3",
-		"DLT_MUX27010",
-		"DLT_NETANALYZER",
-		"DLT_NETANALYZER_TRANSPARENT",
-		"DLT_NFC_LLCP",
-		"DLT_NFLOG",
-		"DLT_NG40",
-		"DLT_NULL",
-		"DLT_PCI_EXP",
-		"DLT_PFLOG",
-		"DLT_PFSYNC",
-		"DLT_PPI",
-		"DLT_PPP",
-		"DLT_PPP_BSDOS",
-		"DLT_PPP_ETHER",
-		"DLT_PPP_PPPD",
-		"DLT_PPP_SERIAL",
-		"DLT_PPP_WITH_DIR",
-		"DLT_PPP_WITH_DIRECTION",
-		"DLT_PRISM_HEADER",
-		"DLT_PRONET",
-		"DLT_RAIF1",
-		"DLT_RAW",
-		"DLT_RAWAF_MASK",
-		"DLT_RIO",
-		"DLT_SCCP",
-		"DLT_SITA",
-		"DLT_SLIP",
-		"DLT_SLIP_BSDOS",
-		"DLT_STANAG_5066_D_PDU",
-		"DLT_SUNATM",
-		"DLT_SYMANTEC_FIREWALL",
-		"DLT_TZSP",
-		"DLT_USB",
-		"DLT_USB_LINUX",
-		"DLT_USB_LINUX_MMAPPED",
-		"DLT_USER0",
-		"DLT_USER1",
-		"DLT_USER10",
-		"DLT_USER11",
-		"DLT_USER12",
-		"DLT_USER13",
-		"DLT_USER14",
-		"DLT_USER15",
-		"DLT_USER2",
-		"DLT_USER3",
-		"DLT_USER4",
-		"DLT_USER5",
-		"DLT_USER6",
-		"DLT_USER7",
-		"DLT_USER8",
-		"DLT_USER9",
-		"DLT_WIHART",
-		"DLT_X2E_SERIAL",
-		"DLT_X2E_XORAYA",
-		"DNSMXData",
-		"DNSPTRData",
-		"DNSRecord",
-		"DNSSRVData",
-		"DNSTXTData",
-		"DNS_INFO_NO_RECORDS",
-		"DNS_TYPE_A",
-		"DNS_TYPE_A6",
-		"DNS_TYPE_AAAA",
-		"DNS_TYPE_ADDRS",
-		"DNS_TYPE_AFSDB",
-		"DNS_TYPE_ALL",
-		"DNS_TYPE_ANY",
-		"DNS_TYPE_ATMA",
-		"DNS_TYPE_AXFR",
-		"DNS_TYPE_CERT",
-		"DNS_TYPE_CNAME",
-		"DNS_TYPE_DHCID",
-		"DNS_TYPE_DNAME",
-		"DNS_TYPE_DNSKEY",
-		"DNS_TYPE_DS",
-		"DNS_TYPE_EID",
-		"DNS_TYPE_GID",
-		"DNS_TYPE_GPOS",
-		"DNS_TYPE_HINFO",
-		"DNS_TYPE_ISDN",
-		"DNS_TYPE_IXFR",
-		"DNS_TYPE_KEY",
-		"DNS_TYPE_KX",
-		"DNS_TYPE_LOC",
-		"DNS_TYPE_MAILA",
-		"DNS_TYPE_MAILB",
-		"DNS_TYPE_MB",
-		"DNS_TYPE_MD",
-		"DNS_TYPE_MF",
-		"DNS_TYPE_MG",
-		"DNS_TYPE_MINFO",
-		"DNS_TYPE_MR",
-		"DNS_TYPE_MX",
-		"DNS_TYPE_NAPTR",
-		"DNS_TYPE_NBSTAT",
-		"DNS_TYPE_NIMLOC",
-		"DNS_TYPE_NS",
-		"DNS_TYPE_NSAP",
-		"DNS_TYPE_NSAPPTR",
-		"DNS_TYPE_NSEC",
-		"DNS_TYPE_NULL",
-		"DNS_TYPE_NXT",
-		"DNS_TYPE_OPT",
-		"DNS_TYPE_PTR",
-		"DNS_TYPE_PX",
-		"DNS_TYPE_RP",
-		"DNS_TYPE_RRSIG",
-		"DNS_TYPE_RT",
-		"DNS_TYPE_SIG",
-		"DNS_TYPE_SINK",
-		"DNS_TYPE_SOA",
-		"DNS_TYPE_SRV",
-		"DNS_TYPE_TEXT",
-		"DNS_TYPE_TKEY",
-		"DNS_TYPE_TSIG",
-		"DNS_TYPE_UID",
-		"DNS_TYPE_UINFO",
-		"DNS_TYPE_UNSPEC",
-		"DNS_TYPE_WINS",
-		"DNS_TYPE_WINSR",
-		"DNS_TYPE_WKS",
-		"DNS_TYPE_X25",
-		"DT_BLK",
-		"DT_CHR",
-		"DT_DIR",
-		"DT_FIFO",
-		"DT_LNK",
-		"DT_REG",
-		"DT_SOCK",
-		"DT_UNKNOWN",
-		"DT_WHT",
-		"DUPLICATE_CLOSE_SOURCE",
-		"DUPLICATE_SAME_ACCESS",
-		"DeleteFile",
-		"DetachLsf",
-		"DeviceIoControl",
-		"Dirent",
-		"DnsNameCompare",
-		"DnsQuery",
-		"DnsRecordListFree",
-		"DnsSectionAdditional",
-		"DnsSectionAnswer",
-		"DnsSectionAuthority",
-		"DnsSectionQuestion",
-		"Dup",
-		"Dup2",
-		"Dup3",
-		"DuplicateHandle",
-		"E2BIG",
-		"EACCES",
-		"EADDRINUSE",
-		"EADDRNOTAVAIL",
-		"EADV",
-		"EAFNOSUPPORT",
-		"EAGAIN",
-		"EALREADY",
-		"EAUTH",
-		"EBADARCH",
-		"EBADE",
-		"EBADEXEC",
-		"EBADF",
-		"EBADFD",
-		"EBADMACHO",
-		"EBADMSG",
-		"EBADR",
-		"EBADRPC",
-		"EBADRQC",
-		"EBADSLT",
-		"EBFONT",
-		"EBUSY",
-		"ECANCELED",
-		"ECAPMODE",
-		"ECHILD",
-		"ECHO",
-		"ECHOCTL",
-		"ECHOE",
-		"ECHOK",
-		"ECHOKE",
-		"ECHONL",
-		"ECHOPRT",
-		"ECHRNG",
-		"ECOMM",
-		"ECONNABORTED",
-		"ECONNREFUSED",
-		"ECONNRESET",
-		"EDEADLK",
-		"EDEADLOCK",
-		"EDESTADDRREQ",
-		"EDEVERR",
-		"EDOM",
-		"EDOOFUS",
-		"EDOTDOT",
-		"EDQUOT",
-		"EEXIST",
-		"EFAULT",
-		"EFBIG",
-		"EFER_LMA",
-		"EFER_LME",
-		"EFER_NXE",
-		"EFER_SCE",
-		"EFTYPE",
-		"EHOSTDOWN",
-		"EHOSTUNREACH",
-		"EHWPOISON",
-		"EIDRM",
-		"EILSEQ",
-		"EINPROGRESS",
-		"EINTR",
-		"EINVAL",
-		"EIO",
-		"EIPSEC",
-		"EISCONN",
-		"EISDIR",
-		"EISNAM",
-		"EKEYEXPIRED",
-		"EKEYREJECTED",
-		"EKEYREVOKED",
-		"EL2HLT",
-		"EL2NSYNC",
-		"EL3HLT",
-		"EL3RST",
-		"ELAST",
-		"ELF_NGREG",
-		"ELF_PRARGSZ",
-		"ELIBACC",
-		"ELIBBAD",
-		"ELIBEXEC",
-		"ELIBMAX",
-		"ELIBSCN",
-		"ELNRNG",
-		"ELOOP",
-		"EMEDIUMTYPE",
-		"EMFILE",
-		"EMLINK",
-		"EMSGSIZE",
-		"EMT_TAGOVF",
-		"EMULTIHOP",
-		"EMUL_ENABLED",
-		"EMUL_LINUX",
-		"EMUL_LINUX32",
-		"EMUL_MAXID",
-		"EMUL_NATIVE",
-		"ENAMETOOLONG",
-		"ENAVAIL",
-		"ENDRUNDISC",
-		"ENEEDAUTH",
-		"ENETDOWN",
-		"ENETRESET",
-		"ENETUNREACH",
-		"ENFILE",
-		"ENOANO",
-		"ENOATTR",
-		"ENOBUFS",
-		"ENOCSI",
-		"ENODATA",
-		"ENODEV",
-		"ENOENT",
-		"ENOEXEC",
-		"ENOKEY",
-		"ENOLCK",
-		"ENOLINK",
-		"ENOMEDIUM",
-		"ENOMEM",
-		"ENOMSG",
-		"ENONET",
-		"ENOPKG",
-		"ENOPOLICY",
-		"ENOPROTOOPT",
-		"ENOSPC",
-		"ENOSR",
-		"ENOSTR",
-		"ENOSYS",
-		"ENOTBLK",
-		"ENOTCAPABLE",
-		"ENOTCONN",
-		"ENOTDIR",
-		"ENOTEMPTY",
-		"ENOTNAM",
-		"ENOTRECOVERABLE",
-		"ENOTSOCK",
-		"ENOTSUP",
-		"ENOTTY",
-		"ENOTUNIQ",
-		"ENXIO",
-		"EN_SW_CTL_INF",
-		"EN_SW_CTL_PREC",
-		"EN_SW_CTL_ROUND",
-		"EN_SW_DATACHAIN",
-		"EN_SW_DENORM",
-		"EN_SW_INVOP",
-		"EN_SW_OVERFLOW",
-		"EN_SW_PRECLOSS",
-		"EN_SW_UNDERFLOW",
-		"EN_SW_ZERODIV",
-		"EOPNOTSUPP",
-		"EOVERFLOW",
-		"EOWNERDEAD",
-		"EPERM",
-		"EPFNOSUPPORT",
-		"EPIPE",
-		"EPOLLERR",
-		"EPOLLET",
-		"EPOLLHUP",
-		"EPOLLIN",
-		"EPOLLMSG",
-		"EPOLLONESHOT",
-		"EPOLLOUT",
-		"EPOLLPRI",
-		"EPOLLRDBAND",
-		"EPOLLRDHUP",
-		"EPOLLRDNORM",
-		"EPOLLWRBAND",
-		"EPOLLWRNORM",
-		"EPOLL_CLOEXEC",
-		"EPOLL_CTL_ADD",
-		"EPOLL_CTL_DEL",
-		"EPOLL_CTL_MOD",
-		"EPOLL_NONBLOCK",
-		"EPROCLIM",
-		"EPROCUNAVAIL",
-		"EPROGMISMATCH",
-		"EPROGUNAVAIL",
-		"EPROTO",
-		"EPROTONOSUPPORT",
-		"EPROTOTYPE",
-		"EPWROFF",
-		"EQFULL",
-		"ERANGE",
-		"EREMCHG",
-		"EREMOTE",
-		"EREMOTEIO",
-		"ERESTART",
-		"ERFKILL",
-		"EROFS",
-		"ERPCMISMATCH",
-		"ERROR_ACCESS_DENIED",
-		"ERROR_ALREADY_EXISTS",
-		"ERROR_BROKEN_PIPE",
-		"ERROR_BUFFER_OVERFLOW",
-		"ERROR_DIR_NOT_EMPTY",
-		"ERROR_ENVVAR_NOT_FOUND",
-		"ERROR_FILE_EXISTS",
-		"ERROR_FILE_NOT_FOUND",
-		"ERROR_HANDLE_EOF",
-		"ERROR_INSUFFICIENT_BUFFER",
-		"ERROR_IO_PENDING",
-		"ERROR_MOD_NOT_FOUND",
-		"ERROR_MORE_DATA",
-		"ERROR_NETNAME_DELETED",
-		"ERROR_NOT_FOUND",
-		"ERROR_NO_MORE_FILES",
-		"ERROR_OPERATION_ABORTED",
-		"ERROR_PATH_NOT_FOUND",
-		"ERROR_PRIVILEGE_NOT_HELD",
-		"ERROR_PROC_NOT_FOUND",
-		"ESHLIBVERS",
-		"ESHUTDOWN",
-		"ESOCKTNOSUPPORT",
-		"ESPIPE",
-		"ESRCH",
-		"ESRMNT",
-		"ESTALE",
-		"ESTRPIPE",
-		"ETHERCAP_JUMBO_MTU",
-		"ETHERCAP_VLAN_HWTAGGING",
-		"ETHERCAP_VLAN_MTU",
-		"ETHERMIN",
-		"ETHERMTU",
-		"ETHERMTU_JUMBO",
-		"ETHERTYPE_8023",
-		"ETHERTYPE_AARP",
-		"ETHERTYPE_ACCTON",
-		"ETHERTYPE_AEONIC",
-		"ETHERTYPE_ALPHA",
-		"ETHERTYPE_AMBER",
-		"ETHERTYPE_AMOEBA",
-		"ETHERTYPE_AOE",
-		"ETHERTYPE_APOLLO",
-		"ETHERTYPE_APOLLODOMAIN",
-		"ETHERTYPE_APPLETALK",
-		"ETHERTYPE_APPLITEK",
-		"ETHERTYPE_ARGONAUT",
-		"ETHERTYPE_ARP",
-		"ETHERTYPE_AT",
-		"ETHERTYPE_ATALK",
-		"ETHERTYPE_ATOMIC",
-		"ETHERTYPE_ATT",
-		"ETHERTYPE_ATTSTANFORD",
-		"ETHERTYPE_AUTOPHON",
-		"ETHERTYPE_AXIS",
-		"ETHERTYPE_BCLOOP",
-		"ETHERTYPE_BOFL",
-		"ETHERTYPE_CABLETRON",
-		"ETHERTYPE_CHAOS",
-		"ETHERTYPE_COMDESIGN",
-		"ETHERTYPE_COMPUGRAPHIC",
-		"ETHERTYPE_COUNTERPOINT",
-		"ETHERTYPE_CRONUS",
-		"ETHERTYPE_CRONUSVLN",
-		"ETHERTYPE_DCA",
-		"ETHERTYPE_DDE",
-		"ETHERTYPE_DEBNI",
-		"ETHERTYPE_DECAM",
-		"ETHERTYPE_DECCUST",
-		"ETHERTYPE_DECDIAG",
-		"ETHERTYPE_DECDNS",
-		"ETHERTYPE_DECDTS",
-		"ETHERTYPE_DECEXPER",
-		"ETHERTYPE_DECLAST",
-		"ETHERTYPE_DECLTM",
-		"ETHERTYPE_DECMUMPS",
-		"ETHERTYPE_DECNETBIOS",
-		"ETHERTYPE_DELTACON",
-		"ETHERTYPE_DIDDLE",
-		"ETHERTYPE_DLOG1",
-		"ETHERTYPE_DLOG2",
-		"ETHERTYPE_DN",
-		"ETHERTYPE_DOGFIGHT",
-		"ETHERTYPE_DSMD",
-		"ETHERTYPE_ECMA",
-		"ETHERTYPE_ENCRYPT",
-		"ETHERTYPE_ES",
-		"ETHERTYPE_EXCELAN",
-		"ETHERTYPE_EXPERDATA",
-		"ETHERTYPE_FLIP",
-		"ETHERTYPE_FLOWCONTROL",
-		"ETHERTYPE_FRARP",
-		"ETHERTYPE_GENDYN",
-		"ETHERTYPE_HAYES",
-		"ETHERTYPE_HIPPI_FP",
-		"ETHERTYPE_HITACHI",
-		"ETHERTYPE_HP",
-		"ETHERTYPE_IEEEPUP",
-		"ETHERTYPE_IEEEPUPAT",
-		"ETHERTYPE_IMLBL",
-		"ETHERTYPE_IMLBLDIAG",
-		"ETHERTYPE_IP",
-		"ETHERTYPE_IPAS",
-		"ETHERTYPE_IPV6",
-		"ETHERTYPE_IPX",
-		"ETHERTYPE_IPXNEW",
-		"ETHERTYPE_KALPANA",
-		"ETHERTYPE_LANBRIDGE",
-		"ETHERTYPE_LANPROBE",
-		"ETHERTYPE_LAT",
-		"ETHERTYPE_LBACK",
-		"ETHERTYPE_LITTLE",
-		"ETHERTYPE_LLDP",
-		"ETHERTYPE_LOGICRAFT",
-		"ETHERTYPE_LOOPBACK",
-		"ETHERTYPE_MATRA",
-		"ETHERTYPE_MAX",
-		"ETHERTYPE_MERIT",
-		"ETHERTYPE_MICP",
-		"ETHERTYPE_MOPDL",
-		"ETHERTYPE_MOPRC",
-		"ETHERTYPE_MOTOROLA",
-		"ETHERTYPE_MPLS",
-		"ETHERTYPE_MPLS_MCAST",
-		"ETHERTYPE_MUMPS",
-		"ETHERTYPE_NBPCC",
-		"ETHERTYPE_NBPCLAIM",
-		"ETHERTYPE_NBPCLREQ",
-		"ETHERTYPE_NBPCLRSP",
-		"ETHERTYPE_NBPCREQ",
-		"ETHERTYPE_NBPCRSP",
-		"ETHERTYPE_NBPDG",
-		"ETHERTYPE_NBPDGB",
-		"ETHERTYPE_NBPDLTE",
-		"ETHERTYPE_NBPRAR",
-		"ETHERTYPE_NBPRAS",
-		"ETHERTYPE_NBPRST",
-		"ETHERTYPE_NBPSCD",
-		"ETHERTYPE_NBPVCD",
-		"ETHERTYPE_NBS",
-		"ETHERTYPE_NCD",
-		"ETHERTYPE_NESTAR",
-		"ETHERTYPE_NETBEUI",
-		"ETHERTYPE_NOVELL",
-		"ETHERTYPE_NS",
-		"ETHERTYPE_NSAT",
-		"ETHERTYPE_NSCOMPAT",
-		"ETHERTYPE_NTRAILER",
-		"ETHERTYPE_OS9",
-		"ETHERTYPE_OS9NET",
-		"ETHERTYPE_PACER",
-		"ETHERTYPE_PAE",
-		"ETHERTYPE_PCS",
-		"ETHERTYPE_PLANNING",
-		"ETHERTYPE_PPP",
-		"ETHERTYPE_PPPOE",
-		"ETHERTYPE_PPPOEDISC",
-		"ETHERTYPE_PRIMENTS",
-		"ETHERTYPE_PUP",
-		"ETHERTYPE_PUPAT",
-		"ETHERTYPE_QINQ",
-		"ETHERTYPE_RACAL",
-		"ETHERTYPE_RATIONAL",
-		"ETHERTYPE_RAWFR",
-		"ETHERTYPE_RCL",
-		"ETHERTYPE_RDP",
-		"ETHERTYPE_RETIX",
-		"ETHERTYPE_REVARP",
-		"ETHERTYPE_SCA",
-		"ETHERTYPE_SECTRA",
-		"ETHERTYPE_SECUREDATA",
-		"ETHERTYPE_SGITW",
-		"ETHERTYPE_SG_BOUNCE",
-		"ETHERTYPE_SG_DIAG",
-		"ETHERTYPE_SG_NETGAMES",
-		"ETHERTYPE_SG_RESV",
-		"ETHERTYPE_SIMNET",
-		"ETHERTYPE_SLOW",
-		"ETHERTYPE_SLOWPROTOCOLS",
-		"ETHERTYPE_SNA",
-		"ETHERTYPE_SNMP",
-		"ETHERTYPE_SONIX",
-		"ETHERTYPE_SPIDER",
-		"ETHERTYPE_SPRITE",
-		"ETHERTYPE_STP",
-		"ETHERTYPE_TALARIS",
-		"ETHERTYPE_TALARISMC",
-		"ETHERTYPE_TCPCOMP",
-		"ETHERTYPE_TCPSM",
-		"ETHERTYPE_TEC",
-		"ETHERTYPE_TIGAN",
-		"ETHERTYPE_TRAIL",
-		"ETHERTYPE_TRANSETHER",
-		"ETHERTYPE_TYMSHARE",
-		"ETHERTYPE_UBBST",
-		"ETHERTYPE_UBDEBUG",
-		"ETHERTYPE_UBDIAGLOOP",
-		"ETHERTYPE_UBDL",
-		"ETHERTYPE_UBNIU",
-		"ETHERTYPE_UBNMC",
-		"ETHERTYPE_VALID",
-		"ETHERTYPE_VARIAN",
-		"ETHERTYPE_VAXELN",
-		"ETHERTYPE_VEECO",
-		"ETHERTYPE_VEXP",
-		"ETHERTYPE_VGLAB",
-		"ETHERTYPE_VINES",
-		"ETHERTYPE_VINESECHO",
-		"ETHERTYPE_VINESLOOP",
-		"ETHERTYPE_VITAL",
-		"ETHERTYPE_VLAN",
-		"ETHERTYPE_VLTLMAN",
-		"ETHERTYPE_VPROD",
-		"ETHERTYPE_VURESERVED",
-		"ETHERTYPE_WATERLOO",
-		"ETHERTYPE_WELLFLEET",
-		"ETHERTYPE_X25",
-		"ETHERTYPE_X75",
-		"ETHERTYPE_XNSSM",
-		"ETHERTYPE_XTP",
-		"ETHER_ADDR_LEN",
-		"ETHER_ALIGN",
-		"ETHER_CRC_LEN",
-		"ETHER_CRC_POLY_BE",
-		"ETHER_CRC_POLY_LE",
-		"ETHER_HDR_LEN",
-		"ETHER_MAX_DIX_LEN",
-		"ETHER_MAX_LEN",
-		"ETHER_MAX_LEN_JUMBO",
-		"ETHER_MIN_LEN",
-		"ETHER_PPPOE_ENCAP_LEN",
-		"ETHER_TYPE_LEN",
-		"ETHER_VLAN_ENCAP_LEN",
-		"ETH_P_1588",
-		"ETH_P_8021Q",
-		"ETH_P_802_2",
-		"ETH_P_802_3",
-		"ETH_P_AARP",
-		"ETH_P_ALL",
-		"ETH_P_AOE",
-		"ETH_P_ARCNET",
-		"ETH_P_ARP",
-		"ETH_P_ATALK",
-		"ETH_P_ATMFATE",
-		"ETH_P_ATMMPOA",
-		"ETH_P_AX25",
-		"ETH_P_BPQ",
-		"ETH_P_CAIF",
-		"ETH_P_CAN",
-		"ETH_P_CONTROL",
-		"ETH_P_CUST",
-		"ETH_P_DDCMP",
-		"ETH_P_DEC",
-		"ETH_P_DIAG",
-		"ETH_P_DNA_DL",
-		"ETH_P_DNA_RC",
-		"ETH_P_DNA_RT",
-		"ETH_P_DSA",
-		"ETH_P_ECONET",
-		"ETH_P_EDSA",
-		"ETH_P_FCOE",
-		"ETH_P_FIP",
-		"ETH_P_HDLC",
-		"ETH_P_IEEE802154",
-		"ETH_P_IEEEPUP",
-		"ETH_P_IEEEPUPAT",
-		"ETH_P_IP",
-		"ETH_P_IPV6",
-		"ETH_P_IPX",
-		"ETH_P_IRDA",
-		"ETH_P_LAT",
-		"ETH_P_LINK_CTL",
-		"ETH_P_LOCALTALK",
-		"ETH_P_LOOP",
-		"ETH_P_MOBITEX",
-		"ETH_P_MPLS_MC",
-		"ETH_P_MPLS_UC",
-		"ETH_P_PAE",
-		"ETH_P_PAUSE",
-		"ETH_P_PHONET",
-		"ETH_P_PPPTALK",
-		"ETH_P_PPP_DISC",
-		"ETH_P_PPP_MP",
-		"ETH_P_PPP_SES",
-		"ETH_P_PUP",
-		"ETH_P_PUPAT",
-		"ETH_P_RARP",
-		"ETH_P_SCA",
-		"ETH_P_SLOW",
-		"ETH_P_SNAP",
-		"ETH_P_TEB",
-		"ETH_P_TIPC",
-		"ETH_P_TRAILER",
-		"ETH_P_TR_802_2",
-		"ETH_P_WAN_PPP",
-		"ETH_P_WCCP",
-		"ETH_P_X25",
-		"ETIME",
-		"ETIMEDOUT",
-		"ETOOMANYREFS",
-		"ETXTBSY",
-		"EUCLEAN",
-		"EUNATCH",
-		"EUSERS",
-		"EVFILT_AIO",
-		"EVFILT_FS",
-		"EVFILT_LIO",
-		"EVFILT_MACHPORT",
-		"EVFILT_PROC",
-		"EVFILT_READ",
-		"EVFILT_SIGNAL",
-		"EVFILT_SYSCOUNT",
-		"EVFILT_THREADMARKER",
-		"EVFILT_TIMER",
-		"EVFILT_USER",
-		"EVFILT_VM",
-		"EVFILT_VNODE",
-		"EVFILT_WRITE",
-		"EV_ADD",
-		"EV_CLEAR",
-		"EV_DELETE",
-		"EV_DISABLE",
-		"EV_DISPATCH",
-		"EV_DROP",
-		"EV_ENABLE",
-		"EV_EOF",
-		"EV_ERROR",
-		"EV_FLAG0",
-		"EV_FLAG1",
-		"EV_ONESHOT",
-		"EV_OOBAND",
-		"EV_POLL",
-		"EV_RECEIPT",
-		"EV_SYSFLAGS",
-		"EWINDOWS",
-		"EWOULDBLOCK",
-		"EXDEV",
-		"EXFULL",
-		"EXTA",
-		"EXTB",
-		"EXTPROC",
-		"Environ",
-		"EpollCreate",
-		"EpollCreate1",
-		"EpollCtl",
-		"EpollEvent",
-		"EpollWait",
-		"Errno",
-		"EscapeArg",
-		"Exchangedata",
-		"Exec",
-		"Exit",
-		"ExitProcess",
-		"FD_CLOEXEC",
-		"FD_SETSIZE",
-		"FILE_ACTION_ADDED",
-		"FILE_ACTION_MODIFIED",
-		"FILE_ACTION_REMOVED",
-		"FILE_ACTION_RENAMED_NEW_NAME",
-		"FILE_ACTION_RENAMED_OLD_NAME",
-		"FILE_APPEND_DATA",
-		"FILE_ATTRIBUTE_ARCHIVE",
-		"FILE_ATTRIBUTE_DIRECTORY",
-		"FILE_ATTRIBUTE_HIDDEN",
-		"FILE_ATTRIBUTE_NORMAL",
-		"FILE_ATTRIBUTE_READONLY",
-		"FILE_ATTRIBUTE_REPARSE_POINT",
-		"FILE_ATTRIBUTE_SYSTEM",
-		"FILE_BEGIN",
-		"FILE_CURRENT",
-		"FILE_END",
-		"FILE_FLAG_BACKUP_SEMANTICS",
-		"FILE_FLAG_OPEN_REPARSE_POINT",
-		"FILE_FLAG_OVERLAPPED",
-		"FILE_LIST_DIRECTORY",
-		"FILE_MAP_COPY",
-		"FILE_MAP_EXECUTE",
-		"FILE_MAP_READ",
-		"FILE_MAP_WRITE",
-		"FILE_NOTIFY_CHANGE_ATTRIBUTES",
-		"FILE_NOTIFY_CHANGE_CREATION",
-		"FILE_NOTIFY_CHANGE_DIR_NAME",
-		"FILE_NOTIFY_CHANGE_FILE_NAME",
-		"FILE_NOTIFY_CHANGE_LAST_ACCESS",
-		"FILE_NOTIFY_CHANGE_LAST_WRITE",
-		"FILE_NOTIFY_CHANGE_SIZE",
-		"FILE_SHARE_DELETE",
-		"FILE_SHARE_READ",
-		"FILE_SHARE_WRITE",
-		"FILE_SKIP_COMPLETION_PORT_ON_SUCCESS",
-		"FILE_SKIP_SET_EVENT_ON_HANDLE",
-		"FILE_TYPE_CHAR",
-		"FILE_TYPE_DISK",
-		"FILE_TYPE_PIPE",
-		"FILE_TYPE_REMOTE",
-		"FILE_TYPE_UNKNOWN",
-		"FILE_WRITE_ATTRIBUTES",
-		"FLUSHO",
-		"FORMAT_MESSAGE_ALLOCATE_BUFFER",
-		"FORMAT_MESSAGE_ARGUMENT_ARRAY",
-		"FORMAT_MESSAGE_FROM_HMODULE",
-		"FORMAT_MESSAGE_FROM_STRING",
-		"FORMAT_MESSAGE_FROM_SYSTEM",
-		"FORMAT_MESSAGE_IGNORE_INSERTS",
-		"FORMAT_MESSAGE_MAX_WIDTH_MASK",
-		"FSCTL_GET_REPARSE_POINT",
-		"F_ADDFILESIGS",
-		"F_ADDSIGS",
-		"F_ALLOCATEALL",
-		"F_ALLOCATECONTIG",
-		"F_CANCEL",
-		"F_CHKCLEAN",
-		"F_CLOSEM",
-		"F_DUP2FD",
-		"F_DUP2FD_CLOEXEC",
-		"F_DUPFD",
-		"F_DUPFD_CLOEXEC",
-		"F_EXLCK",
-		"F_FINDSIGS",
-		"F_FLUSH_DATA",
-		"F_FREEZE_FS",
-		"F_FSCTL",
-		"F_FSDIRMASK",
-		"F_FSIN",
-		"F_FSINOUT",
-		"F_FSOUT",
-		"F_FSPRIV",
-		"F_FSVOID",
-		"F_FULLFSYNC",
-		"F_GETCODEDIR",
-		"F_GETFD",
-		"F_GETFL",
-		"F_GETLEASE",
-		"F_GETLK",
-		"F_GETLK64",
-		"F_GETLKPID",
-		"F_GETNOSIGPIPE",
-		"F_GETOWN",
-		"F_GETOWN_EX",
-		"F_GETPATH",
-		"F_GETPATH_MTMINFO",
-		"F_GETPIPE_SZ",
-		"F_GETPROTECTIONCLASS",
-		"F_GETPROTECTIONLEVEL",
-		"F_GETSIG",
-		"F_GLOBAL_NOCACHE",
-		"F_LOCK",
-		"F_LOG2PHYS",
-		"F_LOG2PHYS_EXT",
-		"F_MARKDEPENDENCY",
-		"F_MAXFD",
-		"F_NOCACHE",
-		"F_NODIRECT",
-		"F_NOTIFY",
-		"F_OGETLK",
-		"F_OK",
-		"F_OSETLK",
-		"F_OSETLKW",
-		"F_PARAM_MASK",
-		"F_PARAM_MAX",
-		"F_PATHPKG_CHECK",
-		"F_PEOFPOSMODE",
-		"F_PREALLOCATE",
-		"F_RDADVISE",
-		"F_RDAHEAD",
-		"F_RDLCK",
-		"F_READAHEAD",
-		"F_READBOOTSTRAP",
-		"F_SETBACKINGSTORE",
-		"F_SETFD",
-		"F_SETFL",
-		"F_SETLEASE",
-		"F_SETLK",
-		"F_SETLK64",
-		"F_SETLKW",
-		"F_SETLKW64",
-		"F_SETLKWTIMEOUT",
-		"F_SETLK_REMOTE",
-		"F_SETNOSIGPIPE",
-		"F_SETOWN",
-		"F_SETOWN_EX",
-		"F_SETPIPE_SZ",
-		"F_SETPROTECTIONCLASS",
-		"F_SETSIG",
-		"F_SETSIZE",
-		"F_SHLCK",
-		"F_SINGLE_WRITER",
-		"F_TEST",
-		"F_THAW_FS",
-		"F_TLOCK",
-		"F_TRANSCODEKEY",
-		"F_ULOCK",
-		"F_UNLCK",
-		"F_UNLCKSYS",
-		"F_VOLPOSMODE",
-		"F_WRITEBOOTSTRAP",
-		"F_WRLCK",
-		"Faccessat",
-		"Fallocate",
-		"Fbootstraptransfer_t",
-		"Fchdir",
-		"Fchflags",
-		"Fchmod",
-		"Fchmodat",
-		"Fchown",
-		"Fchownat",
-		"FcntlFlock",
-		"FdSet",
-		"Fdatasync",
-		"FileNotifyInformation",
-		"Filetime",
-		"FindClose",
-		"FindFirstFile",
-		"FindNextFile",
-		"Flock",
-		"Flock_t",
-		"FlushBpf",
-		"FlushFileBuffers",
-		"FlushViewOfFile",
-		"ForkExec",
-		"ForkLock",
-		"FormatMessage",
-		"Fpathconf",
-		"FreeAddrInfoW",
-		"FreeEnvironmentStrings",
-		"FreeLibrary",
-		"Fsid",
-		"Fstat",
-		"Fstatat",
-		"Fstatfs",
-		"Fstore_t",
-		"Fsync",
-		"Ftruncate",
-		"FullPath",
-		"Futimes",
-		"Futimesat",
-		"GENERIC_ALL",
-		"GENERIC_EXECUTE",
-		"GENERIC_READ",
-		"GENERIC_WRITE",
-		"GUID",
-		"GetAcceptExSockaddrs",
-		"GetAdaptersInfo",
-		"GetAddrInfoW",
-		"GetCommandLine",
-		"GetComputerName",
-		"GetConsoleMode",
-		"GetCurrentDirectory",
-		"GetCurrentProcess",
-		"GetEnvironmentStrings",
-		"GetEnvironmentVariable",
-		"GetExitCodeProcess",
-		"GetFileAttributes",
-		"GetFileAttributesEx",
-		"GetFileExInfoStandard",
-		"GetFileExMaxInfoLevel",
-		"GetFileInformationByHandle",
-		"GetFileType",
-		"GetFullPathName",
-		"GetHostByName",
-		"GetIfEntry",
-		"GetLastError",
-		"GetLengthSid",
-		"GetLongPathName",
-		"GetProcAddress",
-		"GetProcessTimes",
-		"GetProtoByName",
-		"GetQueuedCompletionStatus",
-		"GetServByName",
-		"GetShortPathName",
-		"GetStartupInfo",
-		"GetStdHandle",
-		"GetSystemTimeAsFileTime",
-		"GetTempPath",
-		"GetTimeZoneInformation",
-		"GetTokenInformation",
-		"GetUserNameEx",
-		"GetUserProfileDirectory",
-		"GetVersion",
-		"Getcwd",
-		"Getdents",
-		"Getdirentries",
-		"Getdtablesize",
-		"Getegid",
-		"Getenv",
-		"Geteuid",
-		"Getfsstat",
-		"Getgid",
-		"Getgroups",
-		"Getpagesize",
-		"Getpeername",
-		"Getpgid",
-		"Getpgrp",
-		"Getpid",
-		"Getppid",
-		"Getpriority",
-		"Getrlimit",
-		"Getrusage",
-		"Getsid",
-		"Getsockname",
-		"Getsockopt",
-		"GetsockoptByte",
-		"GetsockoptICMPv6Filter",
-		"GetsockoptIPMreq",
-		"GetsockoptIPMreqn",
-		"GetsockoptIPv6MTUInfo",
-		"GetsockoptIPv6Mreq",
-		"GetsockoptInet4Addr",
-		"GetsockoptInt",
-		"GetsockoptUcred",
-		"Gettid",
-		"Gettimeofday",
-		"Getuid",
-		"Getwd",
-		"Getxattr",
-		"HANDLE_FLAG_INHERIT",
-		"HKEY_CLASSES_ROOT",
-		"HKEY_CURRENT_CONFIG",
-		"HKEY_CURRENT_USER",
-		"HKEY_DYN_DATA",
-		"HKEY_LOCAL_MACHINE",
-		"HKEY_PERFORMANCE_DATA",
-		"HKEY_USERS",
-		"HUPCL",
-		"Handle",
-		"Hostent",
-		"ICANON",
-		"ICMP6_FILTER",
-		"ICMPV6_FILTER",
-		"ICMPv6Filter",
-		"ICRNL",
-		"IEXTEN",
-		"IFAN_ARRIVAL",
-		"IFAN_DEPARTURE",
-		"IFA_ADDRESS",
-		"IFA_ANYCAST",
-		"IFA_BROADCAST",
-		"IFA_CACHEINFO",
-		"IFA_F_DADFAILED",
-		"IFA_F_DEPRECATED",
-		"IFA_F_HOMEADDRESS",
-		"IFA_F_NODAD",
-		"IFA_F_OPTIMISTIC",
-		"IFA_F_PERMANENT",
-		"IFA_F_SECONDARY",
-		"IFA_F_TEMPORARY",
-		"IFA_F_TENTATIVE",
-		"IFA_LABEL",
-		"IFA_LOCAL",
-		"IFA_MAX",
-		"IFA_MULTICAST",
-		"IFA_ROUTE",
-		"IFA_UNSPEC",
-		"IFF_ALLMULTI",
-		"IFF_ALTPHYS",
-		"IFF_AUTOMEDIA",
-		"IFF_BROADCAST",
-		"IFF_CANTCHANGE",
-		"IFF_CANTCONFIG",
-		"IFF_DEBUG",
-		"IFF_DRV_OACTIVE",
-		"IFF_DRV_RUNNING",
-		"IFF_DYING",
-		"IFF_DYNAMIC",
-		"IFF_LINK0",
-		"IFF_LINK1",
-		"IFF_LINK2",
-		"IFF_LOOPBACK",
-		"IFF_MASTER",
-		"IFF_MONITOR",
-		"IFF_MULTICAST",
-		"IFF_NOARP",
-		"IFF_NOTRAILERS",
-		"IFF_NO_PI",
-		"IFF_OACTIVE",
-		"IFF_ONE_QUEUE",
-		"IFF_POINTOPOINT",
-		"IFF_POINTTOPOINT",
-		"IFF_PORTSEL",
-		"IFF_PPROMISC",
-		"IFF_PROMISC",
-		"IFF_RENAMING",
-		"IFF_RUNNING",
-		"IFF_SIMPLEX",
-		"IFF_SLAVE",
-		"IFF_SMART",
-		"IFF_STATICARP",
-		"IFF_TAP",
-		"IFF_TUN",
-		"IFF_TUN_EXCL",
-		"IFF_UP",
-		"IFF_VNET_HDR",
-		"IFLA_ADDRESS",
-		"IFLA_BROADCAST",
-		"IFLA_COST",
-		"IFLA_IFALIAS",
-		"IFLA_IFNAME",
-		"IFLA_LINK",
-		"IFLA_LINKINFO",
-		"IFLA_LINKMODE",
-		"IFLA_MAP",
-		"IFLA_MASTER",
-		"IFLA_MAX",
-		"IFLA_MTU",
-		"IFLA_NET_NS_PID",
-		"IFLA_OPERSTATE",
-		"IFLA_PRIORITY",
-		"IFLA_PROTINFO",
-		"IFLA_QDISC",
-		"IFLA_STATS",
-		"IFLA_TXQLEN",
-		"IFLA_UNSPEC",
-		"IFLA_WEIGHT",
-		"IFLA_WIRELESS",
-		"IFNAMSIZ",
-		"IFT_1822",
-		"IFT_A12MPPSWITCH",
-		"IFT_AAL2",
-		"IFT_AAL5",
-		"IFT_ADSL",
-		"IFT_AFLANE8023",
-		"IFT_AFLANE8025",
-		"IFT_ARAP",
-		"IFT_ARCNET",
-		"IFT_ARCNETPLUS",
-		"IFT_ASYNC",
-		"IFT_ATM",
-		"IFT_ATMDXI",
-		"IFT_ATMFUNI",
-		"IFT_ATMIMA",
-		"IFT_ATMLOGICAL",
-		"IFT_ATMRADIO",
-		"IFT_ATMSUBINTERFACE",
-		"IFT_ATMVCIENDPT",
-		"IFT_ATMVIRTUAL",
-		"IFT_BGPPOLICYACCOUNTING",
-		"IFT_BLUETOOTH",
-		"IFT_BRIDGE",
-		"IFT_BSC",
-		"IFT_CARP",
-		"IFT_CCTEMUL",
-		"IFT_CELLULAR",
-		"IFT_CEPT",
-		"IFT_CES",
-		"IFT_CHANNEL",
-		"IFT_CNR",
-		"IFT_COFFEE",
-		"IFT_COMPOSITELINK",
-		"IFT_DCN",
-		"IFT_DIGITALPOWERLINE",
-		"IFT_DIGITALWRAPPEROVERHEADCHANNEL",
-		"IFT_DLSW",
-		"IFT_DOCSCABLEDOWNSTREAM",
-		"IFT_DOCSCABLEMACLAYER",
-		"IFT_DOCSCABLEUPSTREAM",
-		"IFT_DOCSCABLEUPSTREAMCHANNEL",
-		"IFT_DS0",
-		"IFT_DS0BUNDLE",
-		"IFT_DS1FDL",
-		"IFT_DS3",
-		"IFT_DTM",
-		"IFT_DUMMY",
-		"IFT_DVBASILN",
-		"IFT_DVBASIOUT",
-		"IFT_DVBRCCDOWNSTREAM",
-		"IFT_DVBRCCMACLAYER",
-		"IFT_DVBRCCUPSTREAM",
-		"IFT_ECONET",
-		"IFT_ENC",
-		"IFT_EON",
-		"IFT_EPLRS",
-		"IFT_ESCON",
-		"IFT_ETHER",
-		"IFT_FAITH",
-		"IFT_FAST",
-		"IFT_FASTETHER",
-		"IFT_FASTETHERFX",
-		"IFT_FDDI",
-		"IFT_FIBRECHANNEL",
-		"IFT_FRAMERELAYINTERCONNECT",
-		"IFT_FRAMERELAYMPI",
-		"IFT_FRDLCIENDPT",
-		"IFT_FRELAY",
-		"IFT_FRELAYDCE",
-		"IFT_FRF16MFRBUNDLE",
-		"IFT_FRFORWARD",
-		"IFT_G703AT2MB",
-		"IFT_G703AT64K",
-		"IFT_GIF",
-		"IFT_GIGABITETHERNET",
-		"IFT_GR303IDT",
-		"IFT_GR303RDT",
-		"IFT_H323GATEKEEPER",
-		"IFT_H323PROXY",
-		"IFT_HDH1822",
-		"IFT_HDLC",
-		"IFT_HDSL2",
-		"IFT_HIPERLAN2",
-		"IFT_HIPPI",
-		"IFT_HIPPIINTERFACE",
-		"IFT_HOSTPAD",
-		"IFT_HSSI",
-		"IFT_HY",
-		"IFT_IBM370PARCHAN",
-		"IFT_IDSL",
-		"IFT_IEEE1394",
-		"IFT_IEEE80211",
-		"IFT_IEEE80212",
-		"IFT_IEEE8023ADLAG",
-		"IFT_IFGSN",
-		"IFT_IMT",
-		"IFT_INFINIBAND",
-		"IFT_INTERLEAVE",
-		"IFT_IP",
-		"IFT_IPFORWARD",
-		"IFT_IPOVERATM",
-		"IFT_IPOVERCDLC",
-		"IFT_IPOVERCLAW",
-		"IFT_IPSWITCH",
-		"IFT_IPXIP",
-		"IFT_ISDN",
-		"IFT_ISDNBASIC",
-		"IFT_ISDNPRIMARY",
-		"IFT_ISDNS",
-		"IFT_ISDNU",
-		"IFT_ISO88022LLC",
-		"IFT_ISO88023",
-		"IFT_ISO88024",
-		"IFT_ISO88025",
-		"IFT_ISO88025CRFPINT",
-		"IFT_ISO88025DTR",
-		"IFT_ISO88025FIBER",
-		"IFT_ISO88026",
-		"IFT_ISUP",
-		"IFT_L2VLAN",
-		"IFT_L3IPVLAN",
-		"IFT_L3IPXVLAN",
-		"IFT_LAPB",
-		"IFT_LAPD",
-		"IFT_LAPF",
-		"IFT_LINEGROUP",
-		"IFT_LOCALTALK",
-		"IFT_LOOP",
-		"IFT_MEDIAMAILOVERIP",
-		"IFT_MFSIGLINK",
-		"IFT_MIOX25",
-		"IFT_MODEM",
-		"IFT_MPC",
-		"IFT_MPLS",
-		"IFT_MPLSTUNNEL",
-		"IFT_MSDSL",
-		"IFT_MVL",
-		"IFT_MYRINET",
-		"IFT_NFAS",
-		"IFT_NSIP",
-		"IFT_OPTICALCHANNEL",
-		"IFT_OPTICALTRANSPORT",
-		"IFT_OTHER",
-		"IFT_P10",
-		"IFT_P80",
-		"IFT_PARA",
-		"IFT_PDP",
-		"IFT_PFLOG",
-		"IFT_PFLOW",
-		"IFT_PFSYNC",
-		"IFT_PLC",
-		"IFT_PON155",
-		"IFT_PON622",
-		"IFT_POS",
-		"IFT_PPP",
-		"IFT_PPPMULTILINKBUNDLE",
-		"IFT_PROPATM",
-		"IFT_PROPBWAP2MP",
-		"IFT_PROPCNLS",
-		"IFT_PROPDOCSWIRELESSDOWNSTREAM",
-		"IFT_PROPDOCSWIRELESSMACLAYER",
-		"IFT_PROPDOCSWIRELESSUPSTREAM",
-		"IFT_PROPMUX",
-		"IFT_PROPVIRTUAL",
-		"IFT_PROPWIRELESSP2P",
-		"IFT_PTPSERIAL",
-		"IFT_PVC",
-		"IFT_Q2931",
-		"IFT_QLLC",
-		"IFT_RADIOMAC",
-		"IFT_RADSL",
-		"IFT_REACHDSL",
-		"IFT_RFC1483",
-		"IFT_RS232",
-		"IFT_RSRB",
-		"IFT_SDLC",
-		"IFT_SDSL",
-		"IFT_SHDSL",
-		"IFT_SIP",
-		"IFT_SIPSIG",
-		"IFT_SIPTG",
-		"IFT_SLIP",
-		"IFT_SMDSDXI",
-		"IFT_SMDSICIP",
-		"IFT_SONET",
-		"IFT_SONETOVERHEADCHANNEL",
-		"IFT_SONETPATH",
-		"IFT_SONETVT",
-		"IFT_SRP",
-		"IFT_SS7SIGLINK",
-		"IFT_STACKTOSTACK",
-		"IFT_STARLAN",
-		"IFT_STF",
-		"IFT_T1",
-		"IFT_TDLC",
-		"IFT_TELINK",
-		"IFT_TERMPAD",
-		"IFT_TR008",
-		"IFT_TRANSPHDLC",
-		"IFT_TUNNEL",
-		"IFT_ULTRA",
-		"IFT_USB",
-		"IFT_V11",
-		"IFT_V35",
-		"IFT_V36",
-		"IFT_V37",
-		"IFT_VDSL",
-		"IFT_VIRTUALIPADDRESS",
-		"IFT_VIRTUALTG",
-		"IFT_VOICEDID",
-		"IFT_VOICEEM",
-		"IFT_VOICEEMFGD",
-		"IFT_VOICEENCAP",
-		"IFT_VOICEFGDEANA",
-		"IFT_VOICEFXO",
-		"IFT_VOICEFXS",
-		"IFT_VOICEOVERATM",
-		"IFT_VOICEOVERCABLE",
-		"IFT_VOICEOVERFRAMERELAY",
-		"IFT_VOICEOVERIP",
-		"IFT_X213",
-		"IFT_X25",
-		"IFT_X25DDN",
-		"IFT_X25HUNTGROUP",
-		"IFT_X25MLP",
-		"IFT_X25PLE",
-		"IFT_XETHER",
-		"IGNBRK",
-		"IGNCR",
-		"IGNORE",
-		"IGNPAR",
-		"IMAXBEL",
-		"INFINITE",
-		"INLCR",
-		"INPCK",
-		"INVALID_FILE_ATTRIBUTES",
-		"IN_ACCESS",
-		"IN_ALL_EVENTS",
-		"IN_ATTRIB",
-		"IN_CLASSA_HOST",
-		"IN_CLASSA_MAX",
-		"IN_CLASSA_NET",
-		"IN_CLASSA_NSHIFT",
-		"IN_CLASSB_HOST",
-		"IN_CLASSB_MAX",
-		"IN_CLASSB_NET",
-		"IN_CLASSB_NSHIFT",
-		"IN_CLASSC_HOST",
-		"IN_CLASSC_NET",
-		"IN_CLASSC_NSHIFT",
-		"IN_CLASSD_HOST",
-		"IN_CLASSD_NET",
-		"IN_CLASSD_NSHIFT",
-		"IN_CLOEXEC",
-		"IN_CLOSE",
-		"IN_CLOSE_NOWRITE",
-		"IN_CLOSE_WRITE",
-		"IN_CREATE",
-		"IN_DELETE",
-		"IN_DELETE_SELF",
-		"IN_DONT_FOLLOW",
-		"IN_EXCL_UNLINK",
-		"IN_IGNORED",
-		"IN_ISDIR",
-		"IN_LINKLOCALNETNUM",
-		"IN_LOOPBACKNET",
-		"IN_MASK_ADD",
-		"IN_MODIFY",
-		"IN_MOVE",
-		"IN_MOVED_FROM",
-		"IN_MOVED_TO",
-		"IN_MOVE_SELF",
-		"IN_NONBLOCK",
-		"IN_ONESHOT",
-		"IN_ONLYDIR",
-		"IN_OPEN",
-		"IN_Q_OVERFLOW",
-		"IN_RFC3021_HOST",
-		"IN_RFC3021_MASK",
-		"IN_RFC3021_NET",
-		"IN_RFC3021_NSHIFT",
-		"IN_UNMOUNT",
-		"IOC_IN",
-		"IOC_INOUT",
-		"IOC_OUT",
-		"IOC_VENDOR",
-		"IOC_WS2",
-		"IO_REPARSE_TAG_SYMLINK",
-		"IPMreq",
-		"IPMreqn",
-		"IPPROTO_3PC",
-		"IPPROTO_ADFS",
-		"IPPROTO_AH",
-		"IPPROTO_AHIP",
-		"IPPROTO_APES",
-		"IPPROTO_ARGUS",
-		"IPPROTO_AX25",
-		"IPPROTO_BHA",
-		"IPPROTO_BLT",
-		"IPPROTO_BRSATMON",
-		"IPPROTO_CARP",
-		"IPPROTO_CFTP",
-		"IPPROTO_CHAOS",
-		"IPPROTO_CMTP",
-		"IPPROTO_COMP",
-		"IPPROTO_CPHB",
-		"IPPROTO_CPNX",
-		"IPPROTO_DCCP",
-		"IPPROTO_DDP",
-		"IPPROTO_DGP",
-		"IPPROTO_DIVERT",
-		"IPPROTO_DIVERT_INIT",
-		"IPPROTO_DIVERT_RESP",
-		"IPPROTO_DONE",
-		"IPPROTO_DSTOPTS",
-		"IPPROTO_EGP",
-		"IPPROTO_EMCON",
-		"IPPROTO_ENCAP",
-		"IPPROTO_EON",
-		"IPPROTO_ESP",
-		"IPPROTO_ETHERIP",
-		"IPPROTO_FRAGMENT",
-		"IPPROTO_GGP",
-		"IPPROTO_GMTP",
-		"IPPROTO_GRE",
-		"IPPROTO_HELLO",
-		"IPPROTO_HMP",
-		"IPPROTO_HOPOPTS",
-		"IPPROTO_ICMP",
-		"IPPROTO_ICMPV6",
-		"IPPROTO_IDP",
-		"IPPROTO_IDPR",
-		"IPPROTO_IDRP",
-		"IPPROTO_IGMP",
-		"IPPROTO_IGP",
-		"IPPROTO_IGRP",
-		"IPPROTO_IL",
-		"IPPROTO_INLSP",
-		"IPPROTO_INP",
-		"IPPROTO_IP",
-		"IPPROTO_IPCOMP",
-		"IPPROTO_IPCV",
-		"IPPROTO_IPEIP",
-		"IPPROTO_IPIP",
-		"IPPROTO_IPPC",
-		"IPPROTO_IPV4",
-		"IPPROTO_IPV6",
-		"IPPROTO_IPV6_ICMP",
-		"IPPROTO_IRTP",
-		"IPPROTO_KRYPTOLAN",
-		"IPPROTO_LARP",
-		"IPPROTO_LEAF1",
-		"IPPROTO_LEAF2",
-		"IPPROTO_MAX",
-		"IPPROTO_MAXID",
-		"IPPROTO_MEAS",
-		"IPPROTO_MH",
-		"IPPROTO_MHRP",
-		"IPPROTO_MICP",
-		"IPPROTO_MOBILE",
-		"IPPROTO_MPLS",
-		"IPPROTO_MTP",
-		"IPPROTO_MUX",
-		"IPPROTO_ND",
-		"IPPROTO_NHRP",
-		"IPPROTO_NONE",
-		"IPPROTO_NSP",
-		"IPPROTO_NVPII",
-		"IPPROTO_OLD_DIVERT",
-		"IPPROTO_OSPFIGP",
-		"IPPROTO_PFSYNC",
-		"IPPROTO_PGM",
-		"IPPROTO_PIGP",
-		"IPPROTO_PIM",
-		"IPPROTO_PRM",
-		"IPPROTO_PUP",
-		"IPPROTO_PVP",
-		"IPPROTO_RAW",
-		"IPPROTO_RCCMON",
-		"IPPROTO_RDP",
-		"IPPROTO_ROUTING",
-		"IPPROTO_RSVP",
-		"IPPROTO_RVD",
-		"IPPROTO_SATEXPAK",
-		"IPPROTO_SATMON",
-		"IPPROTO_SCCSP",
-		"IPPROTO_SCTP",
-		"IPPROTO_SDRP",
-		"IPPROTO_SEND",
-		"IPPROTO_SEP",
-		"IPPROTO_SKIP",
-		"IPPROTO_SPACER",
-		"IPPROTO_SRPC",
-		"IPPROTO_ST",
-		"IPPROTO_SVMTP",
-		"IPPROTO_SWIPE",
-		"IPPROTO_TCF",
-		"IPPROTO_TCP",
-		"IPPROTO_TLSP",
-		"IPPROTO_TP",
-		"IPPROTO_TPXX",
-		"IPPROTO_TRUNK1",
-		"IPPROTO_TRUNK2",
-		"IPPROTO_TTP",
-		"IPPROTO_UDP",
-		"IPPROTO_UDPLITE",
-		"IPPROTO_VINES",
-		"IPPROTO_VISA",
-		"IPPROTO_VMTP",
-		"IPPROTO_VRRP",
-		"IPPROTO_WBEXPAK",
-		"IPPROTO_WBMON",
-		"IPPROTO_WSN",
-		"IPPROTO_XNET",
-		"IPPROTO_XTP",
-		"IPV6_2292DSTOPTS",
-		"IPV6_2292HOPLIMIT",
-		"IPV6_2292HOPOPTS",
-		"IPV6_2292NEXTHOP",
-		"IPV6_2292PKTINFO",
-		"IPV6_2292PKTOPTIONS",
-		"IPV6_2292RTHDR",
-		"IPV6_ADDRFORM",
-		"IPV6_ADD_MEMBERSHIP",
-		"IPV6_AUTHHDR",
-		"IPV6_AUTH_LEVEL",
-		"IPV6_AUTOFLOWLABEL",
-		"IPV6_BINDANY",
-		"IPV6_BINDV6ONLY",
-		"IPV6_BOUND_IF",
-		"IPV6_CHECKSUM",
-		"IPV6_DEFAULT_MULTICAST_HOPS",
-		"IPV6_DEFAULT_MULTICAST_LOOP",
-		"IPV6_DEFHLIM",
-		"IPV6_DONTFRAG",
-		"IPV6_DROP_MEMBERSHIP",
-		"IPV6_DSTOPTS",
-		"IPV6_ESP_NETWORK_LEVEL",
-		"IPV6_ESP_TRANS_LEVEL",
-		"IPV6_FAITH",
-		"IPV6_FLOWINFO_MASK",
-		"IPV6_FLOWLABEL_MASK",
-		"IPV6_FRAGTTL",
-		"IPV6_FW_ADD",
-		"IPV6_FW_DEL",
-		"IPV6_FW_FLUSH",
-		"IPV6_FW_GET",
-		"IPV6_FW_ZERO",
-		"IPV6_HLIMDEC",
-		"IPV6_HOPLIMIT",
-		"IPV6_HOPOPTS",
-		"IPV6_IPCOMP_LEVEL",
-		"IPV6_IPSEC_POLICY",
-		"IPV6_JOIN_ANYCAST",
-		"IPV6_JOIN_GROUP",
-		"IPV6_LEAVE_ANYCAST",
-		"IPV6_LEAVE_GROUP",
-		"IPV6_MAXHLIM",
-		"IPV6_MAXOPTHDR",
-		"IPV6_MAXPACKET",
-		"IPV6_MAX_GROUP_SRC_FILTER",
-		"IPV6_MAX_MEMBERSHIPS",
-		"IPV6_MAX_SOCK_SRC_FILTER",
-		"IPV6_MIN_MEMBERSHIPS",
-		"IPV6_MMTU",
-		"IPV6_MSFILTER",
-		"IPV6_MTU",
-		"IPV6_MTU_DISCOVER",
-		"IPV6_MULTICAST_HOPS",
-		"IPV6_MULTICAST_IF",
-		"IPV6_MULTICAST_LOOP",
-		"IPV6_NEXTHOP",
-		"IPV6_OPTIONS",
-		"IPV6_PATHMTU",
-		"IPV6_PIPEX",
-		"IPV6_PKTINFO",
-		"IPV6_PMTUDISC_DO",
-		"IPV6_PMTUDISC_DONT",
-		"IPV6_PMTUDISC_PROBE",
-		"IPV6_PMTUDISC_WANT",
-		"IPV6_PORTRANGE",
-		"IPV6_PORTRANGE_DEFAULT",
-		"IPV6_PORTRANGE_HIGH",
-		"IPV6_PORTRANGE_LOW",
-		"IPV6_PREFER_TEMPADDR",
-		"IPV6_RECVDSTOPTS",
-		"IPV6_RECVDSTPORT",
-		"IPV6_RECVERR",
-		"IPV6_RECVHOPLIMIT",
-		"IPV6_RECVHOPOPTS",
-		"IPV6_RECVPATHMTU",
-		"IPV6_RECVPKTINFO",
-		"IPV6_RECVRTHDR",
-		"IPV6_RECVTCLASS",
-		"IPV6_ROUTER_ALERT",
-		"IPV6_RTABLE",
-		"IPV6_RTHDR",
-		"IPV6_RTHDRDSTOPTS",
-		"IPV6_RTHDR_LOOSE",
-		"IPV6_RTHDR_STRICT",
-		"IPV6_RTHDR_TYPE_0",
-		"IPV6_RXDSTOPTS",
-		"IPV6_RXHOPOPTS",
-		"IPV6_SOCKOPT_RESERVED1",
-		"IPV6_TCLASS",
-		"IPV6_UNICAST_HOPS",
-		"IPV6_USE_MIN_MTU",
-		"IPV6_V6ONLY",
-		"IPV6_VERSION",
-		"IPV6_VERSION_MASK",
-		"IPV6_XFRM_POLICY",
-		"IP_ADD_MEMBERSHIP",
-		"IP_ADD_SOURCE_MEMBERSHIP",
-		"IP_AUTH_LEVEL",
-		"IP_BINDANY",
-		"IP_BLOCK_SOURCE",
-		"IP_BOUND_IF",
-		"IP_DEFAULT_MULTICAST_LOOP",
-		"IP_DEFAULT_MULTICAST_TTL",
-		"IP_DF",
-		"IP_DIVERTFL",
-		"IP_DONTFRAG",
-		"IP_DROP_MEMBERSHIP",
-		"IP_DROP_SOURCE_MEMBERSHIP",
-		"IP_DUMMYNET3",
-		"IP_DUMMYNET_CONFIGURE",
-		"IP_DUMMYNET_DEL",
-		"IP_DUMMYNET_FLUSH",
-		"IP_DUMMYNET_GET",
-		"IP_EF",
-		"IP_ERRORMTU",
-		"IP_ESP_NETWORK_LEVEL",
-		"IP_ESP_TRANS_LEVEL",
-		"IP_FAITH",
-		"IP_FREEBIND",
-		"IP_FW3",
-		"IP_FW_ADD",
-		"IP_FW_DEL",
-		"IP_FW_FLUSH",
-		"IP_FW_GET",
-		"IP_FW_NAT_CFG",
-		"IP_FW_NAT_DEL",
-		"IP_FW_NAT_GET_CONFIG",
-		"IP_FW_NAT_GET_LOG",
-		"IP_FW_RESETLOG",
-		"IP_FW_TABLE_ADD",
-		"IP_FW_TABLE_DEL",
-		"IP_FW_TABLE_FLUSH",
-		"IP_FW_TABLE_GETSIZE",
-		"IP_FW_TABLE_LIST",
-		"IP_FW_ZERO",
-		"IP_HDRINCL",
-		"IP_IPCOMP_LEVEL",
-		"IP_IPSECFLOWINFO",
-		"IP_IPSEC_LOCAL_AUTH",
-		"IP_IPSEC_LOCAL_CRED",
-		"IP_IPSEC_LOCAL_ID",
-		"IP_IPSEC_POLICY",
-		"IP_IPSEC_REMOTE_AUTH",
-		"IP_IPSEC_REMOTE_CRED",
-		"IP_IPSEC_REMOTE_ID",
-		"IP_MAXPACKET",
-		"IP_MAX_GROUP_SRC_FILTER",
-		"IP_MAX_MEMBERSHIPS",
-		"IP_MAX_SOCK_MUTE_FILTER",
-		"IP_MAX_SOCK_SRC_FILTER",
-		"IP_MAX_SOURCE_FILTER",
-		"IP_MF",
-		"IP_MINFRAGSIZE",
-		"IP_MINTTL",
-		"IP_MIN_MEMBERSHIPS",
-		"IP_MSFILTER",
-		"IP_MSS",
-		"IP_MTU",
-		"IP_MTU_DISCOVER",
-		"IP_MULTICAST_IF",
-		"IP_MULTICAST_IFINDEX",
-		"IP_MULTICAST_LOOP",
-		"IP_MULTICAST_TTL",
-		"IP_MULTICAST_VIF",
-		"IP_NAT__XXX",
-		"IP_OFFMASK",
-		"IP_OLD_FW_ADD",
-		"IP_OLD_FW_DEL",
-		"IP_OLD_FW_FLUSH",
-		"IP_OLD_FW_GET",
-		"IP_OLD_FW_RESETLOG",
-		"IP_OLD_FW_ZERO",
-		"IP_ONESBCAST",
-		"IP_OPTIONS",
-		"IP_ORIGDSTADDR",
-		"IP_PASSSEC",
-		"IP_PIPEX",
-		"IP_PKTINFO",
-		"IP_PKTOPTIONS",
-		"IP_PMTUDISC",
-		"IP_PMTUDISC_DO",
-		"IP_PMTUDISC_DONT",
-		"IP_PMTUDISC_PROBE",
-		"IP_PMTUDISC_WANT",
-		"IP_PORTRANGE",
-		"IP_PORTRANGE_DEFAULT",
-		"IP_PORTRANGE_HIGH",
-		"IP_PORTRANGE_LOW",
-		"IP_RECVDSTADDR",
-		"IP_RECVDSTPORT",
-		"IP_RECVERR",
-		"IP_RECVIF",
-		"IP_RECVOPTS",
-		"IP_RECVORIGDSTADDR",
-		"IP_RECVPKTINFO",
-		"IP_RECVRETOPTS",
-		"IP_RECVRTABLE",
-		"IP_RECVTOS",
-		"IP_RECVTTL",
-		"IP_RETOPTS",
-		"IP_RF",
-		"IP_ROUTER_ALERT",
-		"IP_RSVP_OFF",
-		"IP_RSVP_ON",
-		"IP_RSVP_VIF_OFF",
-		"IP_RSVP_VIF_ON",
-		"IP_RTABLE",
-		"IP_SENDSRCADDR",
-		"IP_STRIPHDR",
-		"IP_TOS",
-		"IP_TRAFFIC_MGT_BACKGROUND",
-		"IP_TRANSPARENT",
-		"IP_TTL",
-		"IP_UNBLOCK_SOURCE",
-		"IP_XFRM_POLICY",
-		"IPv6MTUInfo",
-		"IPv6Mreq",
-		"ISIG",
-		"ISTRIP",
-		"IUCLC",
-		"IUTF8",
-		"IXANY",
-		"IXOFF",
-		"IXON",
-		"IfAddrmsg",
-		"IfAnnounceMsghdr",
-		"IfData",
-		"IfInfomsg",
-		"IfMsghdr",
-		"IfaMsghdr",
-		"IfmaMsghdr",
-		"IfmaMsghdr2",
-		"ImplementsGetwd",
-		"Inet4Pktinfo",
-		"Inet6Pktinfo",
-		"InotifyAddWatch",
-		"InotifyEvent",
-		"InotifyInit",
-		"InotifyInit1",
-		"InotifyRmWatch",
-		"InterfaceAddrMessage",
-		"InterfaceAnnounceMessage",
-		"InterfaceInfo",
-		"InterfaceMessage",
-		"InterfaceMulticastAddrMessage",
-		"InvalidHandle",
-		"Ioperm",
-		"Iopl",
-		"Iovec",
-		"IpAdapterInfo",
-		"IpAddrString",
-		"IpAddressString",
-		"IpMaskString",
-		"Issetugid",
-		"KEY_ALL_ACCESS",
-		"KEY_CREATE_LINK",
-		"KEY_CREATE_SUB_KEY",
-		"KEY_ENUMERATE_SUB_KEYS",
-		"KEY_EXECUTE",
-		"KEY_NOTIFY",
-		"KEY_QUERY_VALUE",
-		"KEY_READ",
-		"KEY_SET_VALUE",
-		"KEY_WOW64_32KEY",
-		"KEY_WOW64_64KEY",
-		"KEY_WRITE",
-		"Kevent",
-		"Kevent_t",
-		"Kill",
-		"Klogctl",
-		"Kqueue",
-		"LANG_ENGLISH",
-		"LAYERED_PROTOCOL",
-		"LCNT_OVERLOAD_FLUSH",
-		"LINUX_REBOOT_CMD_CAD_OFF",
-		"LINUX_REBOOT_CMD_CAD_ON",
-		"LINUX_REBOOT_CMD_HALT",
-		"LINUX_REBOOT_CMD_KEXEC",
-		"LINUX_REBOOT_CMD_POWER_OFF",
-		"LINUX_REBOOT_CMD_RESTART",
-		"LINUX_REBOOT_CMD_RESTART2",
-		"LINUX_REBOOT_CMD_SW_SUSPEND",
-		"LINUX_REBOOT_MAGIC1",
-		"LINUX_REBOOT_MAGIC2",
-		"LOCK_EX",
-		"LOCK_NB",
-		"LOCK_SH",
-		"LOCK_UN",
-		"LazyDLL",
-		"LazyProc",
-		"Lchown",
-		"Linger",
-		"Link",
-		"Listen",
-		"Listxattr",
-		"LoadCancelIoEx",
-		"LoadConnectEx",
-		"LoadCreateSymbolicLink",
-		"LoadDLL",
-		"LoadGetAddrInfo",
-		"LoadLibrary",
-		"LoadSetFileCompletionNotificationModes",
-		"LocalFree",
-		"Log2phys_t",
-		"LookupAccountName",
-		"LookupAccountSid",
-		"LookupSID",
-		"LsfJump",
-		"LsfSocket",
-		"LsfStmt",
-		"Lstat",
-		"MADV_AUTOSYNC",
-		"MADV_CAN_REUSE",
-		"MADV_CORE",
-		"MADV_DOFORK",
-		"MADV_DONTFORK",
-		"MADV_DONTNEED",
-		"MADV_FREE",
-		"MADV_FREE_REUSABLE",
-		"MADV_FREE_REUSE",
-		"MADV_HUGEPAGE",
-		"MADV_HWPOISON",
-		"MADV_MERGEABLE",
-		"MADV_NOCORE",
-		"MADV_NOHUGEPAGE",
-		"MADV_NORMAL",
-		"MADV_NOSYNC",
-		"MADV_PROTECT",
-		"MADV_RANDOM",
-		"MADV_REMOVE",
-		"MADV_SEQUENTIAL",
-		"MADV_SPACEAVAIL",
-		"MADV_UNMERGEABLE",
-		"MADV_WILLNEED",
-		"MADV_ZERO_WIRED_PAGES",
-		"MAP_32BIT",
-		"MAP_ALIGNED_SUPER",
-		"MAP_ALIGNMENT_16MB",
-		"MAP_ALIGNMENT_1TB",
-		"MAP_ALIGNMENT_256TB",
-		"MAP_ALIGNMENT_4GB",
-		"MAP_ALIGNMENT_64KB",
-		"MAP_ALIGNMENT_64PB",
-		"MAP_ALIGNMENT_MASK",
-		"MAP_ALIGNMENT_SHIFT",
-		"MAP_ANON",
-		"MAP_ANONYMOUS",
-		"MAP_COPY",
-		"MAP_DENYWRITE",
-		"MAP_EXECUTABLE",
-		"MAP_FILE",
-		"MAP_FIXED",
-		"MAP_FLAGMASK",
-		"MAP_GROWSDOWN",
-		"MAP_HASSEMAPHORE",
-		"MAP_HUGETLB",
-		"MAP_INHERIT",
-		"MAP_INHERIT_COPY",
-		"MAP_INHERIT_DEFAULT",
-		"MAP_INHERIT_DONATE_COPY",
-		"MAP_INHERIT_NONE",
-		"MAP_INHERIT_SHARE",
-		"MAP_JIT",
-		"MAP_LOCKED",
-		"MAP_NOCACHE",
-		"MAP_NOCORE",
-		"MAP_NOEXTEND",
-		"MAP_NONBLOCK",
-		"MAP_NORESERVE",
-		"MAP_NOSYNC",
-		"MAP_POPULATE",
-		"MAP_PREFAULT_READ",
-		"MAP_PRIVATE",
-		"MAP_RENAME",
-		"MAP_RESERVED0080",
-		"MAP_RESERVED0100",
-		"MAP_SHARED",
-		"MAP_STACK",
-		"MAP_TRYFIXED",
-		"MAP_TYPE",
-		"MAP_WIRED",
-		"MAXIMUM_REPARSE_DATA_BUFFER_SIZE",
-		"MAXLEN_IFDESCR",
-		"MAXLEN_PHYSADDR",
-		"MAX_ADAPTER_ADDRESS_LENGTH",
-		"MAX_ADAPTER_DESCRIPTION_LENGTH",
-		"MAX_ADAPTER_NAME_LENGTH",
-		"MAX_COMPUTERNAME_LENGTH",
-		"MAX_INTERFACE_NAME_LEN",
-		"MAX_LONG_PATH",
-		"MAX_PATH",
-		"MAX_PROTOCOL_CHAIN",
-		"MCL_CURRENT",
-		"MCL_FUTURE",
-		"MNT_DETACH",
-		"MNT_EXPIRE",
-		"MNT_FORCE",
-		"MSG_BCAST",
-		"MSG_CMSG_CLOEXEC",
-		"MSG_COMPAT",
-		"MSG_CONFIRM",
-		"MSG_CONTROLMBUF",
-		"MSG_CTRUNC",
-		"MSG_DONTROUTE",
-		"MSG_DONTWAIT",
-		"MSG_EOF",
-		"MSG_EOR",
-		"MSG_ERRQUEUE",
-		"MSG_FASTOPEN",
-		"MSG_FIN",
-		"MSG_FLUSH",
-		"MSG_HAVEMORE",
-		"MSG_HOLD",
-		"MSG_IOVUSRSPACE",
-		"MSG_LENUSRSPACE",
-		"MSG_MCAST",
-		"MSG_MORE",
-		"MSG_NAMEMBUF",
-		"MSG_NBIO",
-		"MSG_NEEDSA",
-		"MSG_NOSIGNAL",
-		"MSG_NOTIFICATION",
-		"MSG_OOB",
-		"MSG_PEEK",
-		"MSG_PROXY",
-		"MSG_RCVMORE",
-		"MSG_RST",
-		"MSG_SEND",
-		"MSG_SYN",
-		"MSG_TRUNC",
-		"MSG_TRYHARD",
-		"MSG_USERFLAGS",
-		"MSG_WAITALL",
-		"MSG_WAITFORONE",
-		"MSG_WAITSTREAM",
-		"MS_ACTIVE",
-		"MS_ASYNC",
-		"MS_BIND",
-		"MS_DEACTIVATE",
-		"MS_DIRSYNC",
-		"MS_INVALIDATE",
-		"MS_I_VERSION",
-		"MS_KERNMOUNT",
-		"MS_KILLPAGES",
-		"MS_MANDLOCK",
-		"MS_MGC_MSK",
-		"MS_MGC_VAL",
-		"MS_MOVE",
-		"MS_NOATIME",
-		"MS_NODEV",
-		"MS_NODIRATIME",
-		"MS_NOEXEC",
-		"MS_NOSUID",
-		"MS_NOUSER",
-		"MS_POSIXACL",
-		"MS_PRIVATE",
-		"MS_RDONLY",
-		"MS_REC",
-		"MS_RELATIME",
-		"MS_REMOUNT",
-		"MS_RMT_MASK",
-		"MS_SHARED",
-		"MS_SILENT",
-		"MS_SLAVE",
-		"MS_STRICTATIME",
-		"MS_SYNC",
-		"MS_SYNCHRONOUS",
-		"MS_UNBINDABLE",
-		"Madvise",
-		"MapViewOfFile",
-		"MaxTokenInfoClass",
-		"Mclpool",
-		"MibIfRow",
-		"Mkdir",
-		"Mkdirat",
-		"Mkfifo",
-		"Mknod",
-		"Mknodat",
-		"Mlock",
-		"Mlockall",
-		"Mmap",
-		"Mount",
-		"MoveFile",
-		"Mprotect",
-		"Msghdr",
-		"Munlock",
-		"Munlockall",
-		"Munmap",
-		"MustLoadDLL",
-		"NAME_MAX",
-		"NETLINK_ADD_MEMBERSHIP",
-		"NETLINK_AUDIT",
-		"NETLINK_BROADCAST_ERROR",
-		"NETLINK_CONNECTOR",
-		"NETLINK_DNRTMSG",
-		"NETLINK_DROP_MEMBERSHIP",
-		"NETLINK_ECRYPTFS",
-		"NETLINK_FIB_LOOKUP",
-		"NETLINK_FIREWALL",
-		"NETLINK_GENERIC",
-		"NETLINK_INET_DIAG",
-		"NETLINK_IP6_FW",
-		"NETLINK_ISCSI",
-		"NETLINK_KOBJECT_UEVENT",
-		"NETLINK_NETFILTER",
-		"NETLINK_NFLOG",
-		"NETLINK_NO_ENOBUFS",
-		"NETLINK_PKTINFO",
-		"NETLINK_RDMA",
-		"NETLINK_ROUTE",
-		"NETLINK_SCSITRANSPORT",
-		"NETLINK_SELINUX",
-		"NETLINK_UNUSED",
-		"NETLINK_USERSOCK",
-		"NETLINK_XFRM",
-		"NET_RT_DUMP",
-		"NET_RT_DUMP2",
-		"NET_RT_FLAGS",
-		"NET_RT_IFLIST",
-		"NET_RT_IFLIST2",
-		"NET_RT_IFLISTL",
-		"NET_RT_IFMALIST",
-		"NET_RT_MAXID",
-		"NET_RT_OIFLIST",
-		"NET_RT_OOIFLIST",
-		"NET_RT_STAT",
-		"NET_RT_STATS",
-		"NET_RT_TABLE",
-		"NET_RT_TRASH",
-		"NLA_ALIGNTO",
-		"NLA_F_NESTED",
-		"NLA_F_NET_BYTEORDER",
-		"NLA_HDRLEN",
-		"NLMSG_ALIGNTO",
-		"NLMSG_DONE",
-		"NLMSG_ERROR",
-		"NLMSG_HDRLEN",
-		"NLMSG_MIN_TYPE",
-		"NLMSG_NOOP",
-		"NLMSG_OVERRUN",
-		"NLM_F_ACK",
-		"NLM_F_APPEND",
-		"NLM_F_ATOMIC",
-		"NLM_F_CREATE",
-		"NLM_F_DUMP",
-		"NLM_F_ECHO",
-		"NLM_F_EXCL",
-		"NLM_F_MATCH",
-		"NLM_F_MULTI",
-		"NLM_F_REPLACE",
-		"NLM_F_REQUEST",
-		"NLM_F_ROOT",
-		"NOFLSH",
-		"NOTE_ABSOLUTE",
-		"NOTE_ATTRIB",
-		"NOTE_BACKGROUND",
-		"NOTE_CHILD",
-		"NOTE_CRITICAL",
-		"NOTE_DELETE",
-		"NOTE_EOF",
-		"NOTE_EXEC",
-		"NOTE_EXIT",
-		"NOTE_EXITSTATUS",
-		"NOTE_EXIT_CSERROR",
-		"NOTE_EXIT_DECRYPTFAIL",
-		"NOTE_EXIT_DETAIL",
-		"NOTE_EXIT_DETAIL_MASK",
-		"NOTE_EXIT_MEMORY",
-		"NOTE_EXIT_REPARENTED",
-		"NOTE_EXTEND",
-		"NOTE_FFAND",
-		"NOTE_FFCOPY",
-		"NOTE_FFCTRLMASK",
-		"NOTE_FFLAGSMASK",
-		"NOTE_FFNOP",
-		"NOTE_FFOR",
-		"NOTE_FORK",
-		"NOTE_LEEWAY",
-		"NOTE_LINK",
-		"NOTE_LOWAT",
-		"NOTE_NONE",
-		"NOTE_NSECONDS",
-		"NOTE_PCTRLMASK",
-		"NOTE_PDATAMASK",
-		"NOTE_REAP",
-		"NOTE_RENAME",
-		"NOTE_RESOURCEEND",
-		"NOTE_REVOKE",
-		"NOTE_SECONDS",
-		"NOTE_SIGNAL",
-		"NOTE_TRACK",
-		"NOTE_TRACKERR",
-		"NOTE_TRIGGER",
-		"NOTE_TRUNCATE",
-		"NOTE_USECONDS",
-		"NOTE_VM_ERROR",
-		"NOTE_VM_PRESSURE",
-		"NOTE_VM_PRESSURE_SUDDEN_TERMINATE",
-		"NOTE_VM_PRESSURE_TERMINATE",
-		"NOTE_WRITE",
-		"NameCanonical",
-		"NameCanonicalEx",
-		"NameDisplay",
-		"NameDnsDomain",
-		"NameFullyQualifiedDN",
-		"NameSamCompatible",
-		"NameServicePrincipal",
-		"NameUniqueId",
-		"NameUnknown",
-		"NameUserPrincipal",
-		"Nanosleep",
-		"NetApiBufferFree",
-		"NetGetJoinInformation",
-		"NetSetupDomainName",
-		"NetSetupUnjoined",
-		"NetSetupUnknownStatus",
-		"NetSetupWorkgroupName",
-		"NetUserGetInfo",
-		"NetlinkMessage",
-		"NetlinkRIB",
-		"NetlinkRouteAttr",
-		"NetlinkRouteRequest",
-		"NewCallback",
-		"NewCallbackCDecl",
-		"NewLazyDLL",
-		"NlAttr",
-		"NlMsgerr",
-		"NlMsghdr",
-		"NsecToFiletime",
-		"NsecToTimespec",
-		"NsecToTimeval",
-		"Ntohs",
-		"OCRNL",
-		"OFDEL",
-		"OFILL",
-		"OFIOGETBMAP",
-		"OID_PKIX_KP_SERVER_AUTH",
-		"OID_SERVER_GATED_CRYPTO",
-		"OID_SGC_NETSCAPE",
-		"OLCUC",
-		"ONLCR",
-		"ONLRET",
-		"ONOCR",
-		"ONOEOT",
-		"OPEN_ALWAYS",
-		"OPEN_EXISTING",
-		"OPOST",
-		"O_ACCMODE",
-		"O_ALERT",
-		"O_ALT_IO",
-		"O_APPEND",
-		"O_ASYNC",
-		"O_CLOEXEC",
-		"O_CREAT",
-		"O_DIRECT",
-		"O_DIRECTORY",
-		"O_DP_GETRAWENCRYPTED",
-		"O_DSYNC",
-		"O_EVTONLY",
-		"O_EXCL",
-		"O_EXEC",
-		"O_EXLOCK",
-		"O_FSYNC",
-		"O_LARGEFILE",
-		"O_NDELAY",
-		"O_NOATIME",
-		"O_NOCTTY",
-		"O_NOFOLLOW",
-		"O_NONBLOCK",
-		"O_NOSIGPIPE",
-		"O_POPUP",
-		"O_RDONLY",
-		"O_RDWR",
-		"O_RSYNC",
-		"O_SHLOCK",
-		"O_SYMLINK",
-		"O_SYNC",
-		"O_TRUNC",
-		"O_TTY_INIT",
-		"O_WRONLY",
-		"Open",
-		"OpenCurrentProcessToken",
-		"OpenProcess",
-		"OpenProcessToken",
-		"Openat",
-		"Overlapped",
-		"PACKET_ADD_MEMBERSHIP",
-		"PACKET_BROADCAST",
-		"PACKET_DROP_MEMBERSHIP",
-		"PACKET_FASTROUTE",
-		"PACKET_HOST",
-		"PACKET_LOOPBACK",
-		"PACKET_MR_ALLMULTI",
-		"PACKET_MR_MULTICAST",
-		"PACKET_MR_PROMISC",
-		"PACKET_MULTICAST",
-		"PACKET_OTHERHOST",
-		"PACKET_OUTGOING",
-		"PACKET_RECV_OUTPUT",
-		"PACKET_RX_RING",
-		"PACKET_STATISTICS",
-		"PAGE_EXECUTE_READ",
-		"PAGE_EXECUTE_READWRITE",
-		"PAGE_EXECUTE_WRITECOPY",
-		"PAGE_READONLY",
-		"PAGE_READWRITE",
-		"PAGE_WRITECOPY",
-		"PARENB",
-		"PARMRK",
-		"PARODD",
-		"PENDIN",
-		"PFL_HIDDEN",
-		"PFL_MATCHES_PROTOCOL_ZERO",
-		"PFL_MULTIPLE_PROTO_ENTRIES",
-		"PFL_NETWORKDIRECT_PROVIDER",
-		"PFL_RECOMMENDED_PROTO_ENTRY",
-		"PF_FLUSH",
-		"PKCS_7_ASN_ENCODING",
-		"PMC5_PIPELINE_FLUSH",
-		"PRIO_PGRP",
-		"PRIO_PROCESS",
-		"PRIO_USER",
-		"PRI_IOFLUSH",
-		"PROCESS_QUERY_INFORMATION",
-		"PROCESS_TERMINATE",
-		"PROT_EXEC",
-		"PROT_GROWSDOWN",
-		"PROT_GROWSUP",
-		"PROT_NONE",
-		"PROT_READ",
-		"PROT_WRITE",
-		"PROV_DH_SCHANNEL",
-		"PROV_DSS",
-		"PROV_DSS_DH",
-		"PROV_EC_ECDSA_FULL",
-		"PROV_EC_ECDSA_SIG",
-		"PROV_EC_ECNRA_FULL",
-		"PROV_EC_ECNRA_SIG",
-		"PROV_FORTEZZA",
-		"PROV_INTEL_SEC",
-		"PROV_MS_EXCHANGE",
-		"PROV_REPLACE_OWF",
-		"PROV_RNG",
-		"PROV_RSA_AES",
-		"PROV_RSA_FULL",
-		"PROV_RSA_SCHANNEL",
-		"PROV_RSA_SIG",
-		"PROV_SPYRUS_LYNKS",
-		"PROV_SSL",
-		"PR_CAPBSET_DROP",
-		"PR_CAPBSET_READ",
-		"PR_CLEAR_SECCOMP_FILTER",
-		"PR_ENDIAN_BIG",
-		"PR_ENDIAN_LITTLE",
-		"PR_ENDIAN_PPC_LITTLE",
-		"PR_FPEMU_NOPRINT",
-		"PR_FPEMU_SIGFPE",
-		"PR_FP_EXC_ASYNC",
-		"PR_FP_EXC_DISABLED",
-		"PR_FP_EXC_DIV",
-		"PR_FP_EXC_INV",
-		"PR_FP_EXC_NONRECOV",
-		"PR_FP_EXC_OVF",
-		"PR_FP_EXC_PRECISE",
-		"PR_FP_EXC_RES",
-		"PR_FP_EXC_SW_ENABLE",
-		"PR_FP_EXC_UND",
-		"PR_GET_DUMPABLE",
-		"PR_GET_ENDIAN",
-		"PR_GET_FPEMU",
-		"PR_GET_FPEXC",
-		"PR_GET_KEEPCAPS",
-		"PR_GET_NAME",
-		"PR_GET_PDEATHSIG",
-		"PR_GET_SECCOMP",
-		"PR_GET_SECCOMP_FILTER",
-		"PR_GET_SECUREBITS",
-		"PR_GET_TIMERSLACK",
-		"PR_GET_TIMING",
-		"PR_GET_TSC",
-		"PR_GET_UNALIGN",
-		"PR_MCE_KILL",
-		"PR_MCE_KILL_CLEAR",
-		"PR_MCE_KILL_DEFAULT",
-		"PR_MCE_KILL_EARLY",
-		"PR_MCE_KILL_GET",
-		"PR_MCE_KILL_LATE",
-		"PR_MCE_KILL_SET",
-		"PR_SECCOMP_FILTER_EVENT",
-		"PR_SECCOMP_FILTER_SYSCALL",
-		"PR_SET_DUMPABLE",
-		"PR_SET_ENDIAN",
-		"PR_SET_FPEMU",
-		"PR_SET_FPEXC",
-		"PR_SET_KEEPCAPS",
-		"PR_SET_NAME",
-		"PR_SET_PDEATHSIG",
-		"PR_SET_PTRACER",
-		"PR_SET_SECCOMP",
-		"PR_SET_SECCOMP_FILTER",
-		"PR_SET_SECUREBITS",
-		"PR_SET_TIMERSLACK",
-		"PR_SET_TIMING",
-		"PR_SET_TSC",
-		"PR_SET_UNALIGN",
-		"PR_TASK_PERF_EVENTS_DISABLE",
-		"PR_TASK_PERF_EVENTS_ENABLE",
-		"PR_TIMING_STATISTICAL",
-		"PR_TIMING_TIMESTAMP",
-		"PR_TSC_ENABLE",
-		"PR_TSC_SIGSEGV",
-		"PR_UNALIGN_NOPRINT",
-		"PR_UNALIGN_SIGBUS",
-		"PTRACE_ARCH_PRCTL",
-		"PTRACE_ATTACH",
-		"PTRACE_CONT",
-		"PTRACE_DETACH",
-		"PTRACE_EVENT_CLONE",
-		"PTRACE_EVENT_EXEC",
-		"PTRACE_EVENT_EXIT",
-		"PTRACE_EVENT_FORK",
-		"PTRACE_EVENT_VFORK",
-		"PTRACE_EVENT_VFORK_DONE",
-		"PTRACE_GETCRUNCHREGS",
-		"PTRACE_GETEVENTMSG",
-		"PTRACE_GETFPREGS",
-		"PTRACE_GETFPXREGS",
-		"PTRACE_GETHBPREGS",
-		"PTRACE_GETREGS",
-		"PTRACE_GETREGSET",
-		"PTRACE_GETSIGINFO",
-		"PTRACE_GETVFPREGS",
-		"PTRACE_GETWMMXREGS",
-		"PTRACE_GET_THREAD_AREA",
-		"PTRACE_KILL",
-		"PTRACE_OLDSETOPTIONS",
-		"PTRACE_O_MASK",
-		"PTRACE_O_TRACECLONE",
-		"PTRACE_O_TRACEEXEC",
-		"PTRACE_O_TRACEEXIT",
-		"PTRACE_O_TRACEFORK",
-		"PTRACE_O_TRACESYSGOOD",
-		"PTRACE_O_TRACEVFORK",
-		"PTRACE_O_TRACEVFORKDONE",
-		"PTRACE_PEEKDATA",
-		"PTRACE_PEEKTEXT",
-		"PTRACE_PEEKUSR",
-		"PTRACE_POKEDATA",
-		"PTRACE_POKETEXT",
-		"PTRACE_POKEUSR",
-		"PTRACE_SETCRUNCHREGS",
-		"PTRACE_SETFPREGS",
-		"PTRACE_SETFPXREGS",
-		"PTRACE_SETHBPREGS",
-		"PTRACE_SETOPTIONS",
-		"PTRACE_SETREGS",
-		"PTRACE_SETREGSET",
-		"PTRACE_SETSIGINFO",
-		"PTRACE_SETVFPREGS",
-		"PTRACE_SETWMMXREGS",
-		"PTRACE_SET_SYSCALL",
-		"PTRACE_SET_THREAD_AREA",
-		"PTRACE_SINGLEBLOCK",
-		"PTRACE_SINGLESTEP",
-		"PTRACE_SYSCALL",
-		"PTRACE_SYSEMU",
-		"PTRACE_SYSEMU_SINGLESTEP",
-		"PTRACE_TRACEME",
-		"PT_ATTACH",
-		"PT_ATTACHEXC",
-		"PT_CONTINUE",
-		"PT_DATA_ADDR",
-		"PT_DENY_ATTACH",
-		"PT_DETACH",
-		"PT_FIRSTMACH",
-		"PT_FORCEQUOTA",
-		"PT_KILL",
-		"PT_MASK",
-		"PT_READ_D",
-		"PT_READ_I",
-		"PT_READ_U",
-		"PT_SIGEXC",
-		"PT_STEP",
-		"PT_TEXT_ADDR",
-		"PT_TEXT_END_ADDR",
-		"PT_THUPDATE",
-		"PT_TRACE_ME",
-		"PT_WRITE_D",
-		"PT_WRITE_I",
-		"PT_WRITE_U",
-		"ParseDirent",
-		"ParseNetlinkMessage",
-		"ParseNetlinkRouteAttr",
-		"ParseRoutingMessage",
-		"ParseRoutingSockaddr",
-		"ParseSocketControlMessage",
-		"ParseUnixCredentials",
-		"ParseUnixRights",
-		"PathMax",
-		"Pathconf",
-		"Pause",
-		"Pipe",
-		"Pipe2",
-		"PivotRoot",
-		"Pointer",
-		"PostQueuedCompletionStatus",
-		"Pread",
-		"Proc",
-		"ProcAttr",
-		"Process32First",
-		"Process32Next",
-		"ProcessEntry32",
-		"ProcessInformation",
-		"Protoent",
-		"PtraceAttach",
-		"PtraceCont",
-		"PtraceDetach",
-		"PtraceGetEventMsg",
-		"PtraceGetRegs",
-		"PtracePeekData",
-		"PtracePeekText",
-		"PtracePokeData",
-		"PtracePokeText",
-		"PtraceRegs",
-		"PtraceSetOptions",
-		"PtraceSetRegs",
-		"PtraceSingleStep",
-		"PtraceSyscall",
-		"Pwrite",
-		"REG_BINARY",
-		"REG_DWORD",
-		"REG_DWORD_BIG_ENDIAN",
-		"REG_DWORD_LITTLE_ENDIAN",
-		"REG_EXPAND_SZ",
-		"REG_FULL_RESOURCE_DESCRIPTOR",
-		"REG_LINK",
-		"REG_MULTI_SZ",
-		"REG_NONE",
-		"REG_QWORD",
-		"REG_QWORD_LITTLE_ENDIAN",
-		"REG_RESOURCE_LIST",
-		"REG_RESOURCE_REQUIREMENTS_LIST",
-		"REG_SZ",
-		"RLIMIT_AS",
-		"RLIMIT_CORE",
-		"RLIMIT_CPU",
-		"RLIMIT_CPU_USAGE_MONITOR",
-		"RLIMIT_DATA",
-		"RLIMIT_FSIZE",
-		"RLIMIT_NOFILE",
-		"RLIMIT_STACK",
-		"RLIM_INFINITY",
-		"RTAX_ADVMSS",
-		"RTAX_AUTHOR",
-		"RTAX_BRD",
-		"RTAX_CWND",
-		"RTAX_DST",
-		"RTAX_FEATURES",
-		"RTAX_FEATURE_ALLFRAG",
-		"RTAX_FEATURE_ECN",
-		"RTAX_FEATURE_SACK",
-		"RTAX_FEATURE_TIMESTAMP",
-		"RTAX_GATEWAY",
-		"RTAX_GENMASK",
-		"RTAX_HOPLIMIT",
-		"RTAX_IFA",
-		"RTAX_IFP",
-		"RTAX_INITCWND",
-		"RTAX_INITRWND",
-		"RTAX_LABEL",
-		"RTAX_LOCK",
-		"RTAX_MAX",
-		"RTAX_MTU",
-		"RTAX_NETMASK",
-		"RTAX_REORDERING",
-		"RTAX_RTO_MIN",
-		"RTAX_RTT",
-		"RTAX_RTTVAR",
-		"RTAX_SRC",
-		"RTAX_SRCMASK",
-		"RTAX_SSTHRESH",
-		"RTAX_TAG",
-		"RTAX_UNSPEC",
-		"RTAX_WINDOW",
-		"RTA_ALIGNTO",
-		"RTA_AUTHOR",
-		"RTA_BRD",
-		"RTA_CACHEINFO",
-		"RTA_DST",
-		"RTA_FLOW",
-		"RTA_GATEWAY",
-		"RTA_GENMASK",
-		"RTA_IFA",
-		"RTA_IFP",
-		"RTA_IIF",
-		"RTA_LABEL",
-		"RTA_MAX",
-		"RTA_METRICS",
-		"RTA_MULTIPATH",
-		"RTA_NETMASK",
-		"RTA_OIF",
-		"RTA_PREFSRC",
-		"RTA_PRIORITY",
-		"RTA_SRC",
-		"RTA_SRCMASK",
-		"RTA_TABLE",
-		"RTA_TAG",
-		"RTA_UNSPEC",
-		"RTCF_DIRECTSRC",
-		"RTCF_DOREDIRECT",
-		"RTCF_LOG",
-		"RTCF_MASQ",
-		"RTCF_NAT",
-		"RTCF_VALVE",
-		"RTF_ADDRCLASSMASK",
-		"RTF_ADDRCONF",
-		"RTF_ALLONLINK",
-		"RTF_ANNOUNCE",
-		"RTF_BLACKHOLE",
-		"RTF_BROADCAST",
-		"RTF_CACHE",
-		"RTF_CLONED",
-		"RTF_CLONING",
-		"RTF_CONDEMNED",
-		"RTF_DEFAULT",
-		"RTF_DELCLONE",
-		"RTF_DONE",
-		"RTF_DYNAMIC",
-		"RTF_FLOW",
-		"RTF_FMASK",
-		"RTF_GATEWAY",
-		"RTF_GWFLAG_COMPAT",
-		"RTF_HOST",
-		"RTF_IFREF",
-		"RTF_IFSCOPE",
-		"RTF_INTERFACE",
-		"RTF_IRTT",
-		"RTF_LINKRT",
-		"RTF_LLDATA",
-		"RTF_LLINFO",
-		"RTF_LOCAL",
-		"RTF_MASK",
-		"RTF_MODIFIED",
-		"RTF_MPATH",
-		"RTF_MPLS",
-		"RTF_MSS",
-		"RTF_MTU",
-		"RTF_MULTICAST",
-		"RTF_NAT",
-		"RTF_NOFORWARD",
-		"RTF_NONEXTHOP",
-		"RTF_NOPMTUDISC",
-		"RTF_PERMANENT_ARP",
-		"RTF_PINNED",
-		"RTF_POLICY",
-		"RTF_PRCLONING",
-		"RTF_PROTO1",
-		"RTF_PROTO2",
-		"RTF_PROTO3",
-		"RTF_PROXY",
-		"RTF_REINSTATE",
-		"RTF_REJECT",
-		"RTF_RNH_LOCKED",
-		"RTF_ROUTER",
-		"RTF_SOURCE",
-		"RTF_SRC",
-		"RTF_STATIC",
-		"RTF_STICKY",
-		"RTF_THROW",
-		"RTF_TUNNEL",
-		"RTF_UP",
-		"RTF_USETRAILERS",
-		"RTF_WASCLONED",
-		"RTF_WINDOW",
-		"RTF_XRESOLVE",
-		"RTM_ADD",
-		"RTM_BASE",
-		"RTM_CHANGE",
-		"RTM_CHGADDR",
-		"RTM_DELACTION",
-		"RTM_DELADDR",
-		"RTM_DELADDRLABEL",
-		"RTM_DELETE",
-		"RTM_DELLINK",
-		"RTM_DELMADDR",
-		"RTM_DELNEIGH",
-		"RTM_DELQDISC",
-		"RTM_DELROUTE",
-		"RTM_DELRULE",
-		"RTM_DELTCLASS",
-		"RTM_DELTFILTER",
-		"RTM_DESYNC",
-		"RTM_F_CLONED",
-		"RTM_F_EQUALIZE",
-		"RTM_F_NOTIFY",
-		"RTM_F_PREFIX",
-		"RTM_GET",
-		"RTM_GET2",
-		"RTM_GETACTION",
-		"RTM_GETADDR",
-		"RTM_GETADDRLABEL",
-		"RTM_GETANYCAST",
-		"RTM_GETDCB",
-		"RTM_GETLINK",
-		"RTM_GETMULTICAST",
-		"RTM_GETNEIGH",
-		"RTM_GETNEIGHTBL",
-		"RTM_GETQDISC",
-		"RTM_GETROUTE",
-		"RTM_GETRULE",
-		"RTM_GETTCLASS",
-		"RTM_GETTFILTER",
-		"RTM_IEEE80211",
-		"RTM_IFANNOUNCE",
-		"RTM_IFINFO",
-		"RTM_IFINFO2",
-		"RTM_LLINFO_UPD",
-		"RTM_LOCK",
-		"RTM_LOSING",
-		"RTM_MAX",
-		"RTM_MAXSIZE",
-		"RTM_MISS",
-		"RTM_NEWACTION",
-		"RTM_NEWADDR",
-		"RTM_NEWADDRLABEL",
-		"RTM_NEWLINK",
-		"RTM_NEWMADDR",
-		"RTM_NEWMADDR2",
-		"RTM_NEWNDUSEROPT",
-		"RTM_NEWNEIGH",
-		"RTM_NEWNEIGHTBL",
-		"RTM_NEWPREFIX",
-		"RTM_NEWQDISC",
-		"RTM_NEWROUTE",
-		"RTM_NEWRULE",
-		"RTM_NEWTCLASS",
-		"RTM_NEWTFILTER",
-		"RTM_NR_FAMILIES",
-		"RTM_NR_MSGTYPES",
-		"RTM_OIFINFO",
-		"RTM_OLDADD",
-		"RTM_OLDDEL",
-		"RTM_OOIFINFO",
-		"RTM_REDIRECT",
-		"RTM_RESOLVE",
-		"RTM_RTTUNIT",
-		"RTM_SETDCB",
-		"RTM_SETGATE",
-		"RTM_SETLINK",
-		"RTM_SETNEIGHTBL",
-		"RTM_VERSION",
-		"RTNH_ALIGNTO",
-		"RTNH_F_DEAD",
-		"RTNH_F_ONLINK",
-		"RTNH_F_PERVASIVE",
-		"RTNLGRP_IPV4_IFADDR",
-		"RTNLGRP_IPV4_MROUTE",
-		"RTNLGRP_IPV4_ROUTE",
-		"RTNLGRP_IPV4_RULE",
-		"RTNLGRP_IPV6_IFADDR",
-		"RTNLGRP_IPV6_IFINFO",
-		"RTNLGRP_IPV6_MROUTE",
-		"RTNLGRP_IPV6_PREFIX",
-		"RTNLGRP_IPV6_ROUTE",
-		"RTNLGRP_IPV6_RULE",
-		"RTNLGRP_LINK",
-		"RTNLGRP_ND_USEROPT",
-		"RTNLGRP_NEIGH",
-		"RTNLGRP_NONE",
-		"RTNLGRP_NOTIFY",
-		"RTNLGRP_TC",
-		"RTN_ANYCAST",
-		"RTN_BLACKHOLE",
-		"RTN_BROADCAST",
-		"RTN_LOCAL",
-		"RTN_MAX",
-		"RTN_MULTICAST",
-		"RTN_NAT",
-		"RTN_PROHIBIT",
-		"RTN_THROW",
-		"RTN_UNICAST",
-		"RTN_UNREACHABLE",
-		"RTN_UNSPEC",
-		"RTN_XRESOLVE",
-		"RTPROT_BIRD",
-		"RTPROT_BOOT",
-		"RTPROT_DHCP",
-		"RTPROT_DNROUTED",
-		"RTPROT_GATED",
-		"RTPROT_KERNEL",
-		"RTPROT_MRT",
-		"RTPROT_NTK",
-		"RTPROT_RA",
-		"RTPROT_REDIRECT",
-		"RTPROT_STATIC",
-		"RTPROT_UNSPEC",
-		"RTPROT_XORP",
-		"RTPROT_ZEBRA",
-		"RTV_EXPIRE",
-		"RTV_HOPCOUNT",
-		"RTV_MTU",
-		"RTV_RPIPE",
-		"RTV_RTT",
-		"RTV_RTTVAR",
-		"RTV_SPIPE",
-		"RTV_SSTHRESH",
-		"RTV_WEIGHT",
-		"RT_CACHING_CONTEXT",
-		"RT_CLASS_DEFAULT",
-		"RT_CLASS_LOCAL",
-		"RT_CLASS_MAIN",
-		"RT_CLASS_MAX",
-		"RT_CLASS_UNSPEC",
-		"RT_DEFAULT_FIB",
-		"RT_NORTREF",
-		"RT_SCOPE_HOST",
-		"RT_SCOPE_LINK",
-		"RT_SCOPE_NOWHERE",
-		"RT_SCOPE_SITE",
-		"RT_SCOPE_UNIVERSE",
-		"RT_TABLEID_MAX",
-		"RT_TABLE_COMPAT",
-		"RT_TABLE_DEFAULT",
-		"RT_TABLE_LOCAL",
-		"RT_TABLE_MAIN",
-		"RT_TABLE_MAX",
-		"RT_TABLE_UNSPEC",
-		"RUSAGE_CHILDREN",
-		"RUSAGE_SELF",
-		"RUSAGE_THREAD",
-		"Radvisory_t",
-		"RawConn",
-		"RawSockaddr",
-		"RawSockaddrAny",
-		"RawSockaddrDatalink",
-		"RawSockaddrInet4",
-		"RawSockaddrInet6",
-		"RawSockaddrLinklayer",
-		"RawSockaddrNetlink",
-		"RawSockaddrUnix",
-		"RawSyscall",
-		"RawSyscall6",
-		"Read",
-		"ReadConsole",
-		"ReadDirectoryChanges",
-		"ReadDirent",
-		"ReadFile",
-		"Readlink",
-		"Reboot",
-		"Recvfrom",
-		"Recvmsg",
-		"RegCloseKey",
-		"RegEnumKeyEx",
-		"RegOpenKeyEx",
-		"RegQueryInfoKey",
-		"RegQueryValueEx",
-		"RemoveDirectory",
-		"Removexattr",
-		"Rename",
-		"Renameat",
-		"Revoke",
-		"Rlimit",
-		"Rmdir",
-		"RouteMessage",
-		"RouteRIB",
-		"RoutingMessage",
-		"RtAttr",
-		"RtGenmsg",
-		"RtMetrics",
-		"RtMsg",
-		"RtMsghdr",
-		"RtNexthop",
-		"Rusage",
-		"SCM_BINTIME",
-		"SCM_CREDENTIALS",
-		"SCM_CREDS",
-		"SCM_RIGHTS",
-		"SCM_TIMESTAMP",
-		"SCM_TIMESTAMPING",
-		"SCM_TIMESTAMPNS",
-		"SCM_TIMESTAMP_MONOTONIC",
-		"SHUT_RD",
-		"SHUT_RDWR",
-		"SHUT_WR",
-		"SID",
-		"SIDAndAttributes",
-		"SIGABRT",
-		"SIGALRM",
-		"SIGBUS",
-		"SIGCHLD",
-		"SIGCLD",
-		"SIGCONT",
-		"SIGEMT",
-		"SIGFPE",
-		"SIGHUP",
-		"SIGILL",
-		"SIGINFO",
-		"SIGINT",
-		"SIGIO",
-		"SIGIOT",
-		"SIGKILL",
-		"SIGLIBRT",
-		"SIGLWP",
-		"SIGPIPE",
-		"SIGPOLL",
-		"SIGPROF",
-		"SIGPWR",
-		"SIGQUIT",
-		"SIGSEGV",
-		"SIGSTKFLT",
-		"SIGSTOP",
-		"SIGSYS",
-		"SIGTERM",
-		"SIGTHR",
-		"SIGTRAP",
-		"SIGTSTP",
-		"SIGTTIN",
-		"SIGTTOU",
-		"SIGUNUSED",
-		"SIGURG",
-		"SIGUSR1",
-		"SIGUSR2",
-		"SIGVTALRM",
-		"SIGWINCH",
-		"SIGXCPU",
-		"SIGXFSZ",
-		"SIOCADDDLCI",
-		"SIOCADDMULTI",
-		"SIOCADDRT",
-		"SIOCAIFADDR",
-		"SIOCAIFGROUP",
-		"SIOCALIFADDR",
-		"SIOCARPIPLL",
-		"SIOCATMARK",
-		"SIOCAUTOADDR",
-		"SIOCAUTONETMASK",
-		"SIOCBRDGADD",
-		"SIOCBRDGADDS",
-		"SIOCBRDGARL",
-		"SIOCBRDGDADDR",
-		"SIOCBRDGDEL",
-		"SIOCBRDGDELS",
-		"SIOCBRDGFLUSH",
-		"SIOCBRDGFRL",
-		"SIOCBRDGGCACHE",
-		"SIOCBRDGGFD",
-		"SIOCBRDGGHT",
-		"SIOCBRDGGIFFLGS",
-		"SIOCBRDGGMA",
-		"SIOCBRDGGPARAM",
-		"SIOCBRDGGPRI",
-		"SIOCBRDGGRL",
-		"SIOCBRDGGSIFS",
-		"SIOCBRDGGTO",
-		"SIOCBRDGIFS",
-		"SIOCBRDGRTS",
-		"SIOCBRDGSADDR",
-		"SIOCBRDGSCACHE",
-		"SIOCBRDGSFD",
-		"SIOCBRDGSHT",
-		"SIOCBRDGSIFCOST",
-		"SIOCBRDGSIFFLGS",
-		"SIOCBRDGSIFPRIO",
-		"SIOCBRDGSMA",
-		"SIOCBRDGSPRI",
-		"SIOCBRDGSPROTO",
-		"SIOCBRDGSTO",
-		"SIOCBRDGSTXHC",
-		"SIOCDARP",
-		"SIOCDELDLCI",
-		"SIOCDELMULTI",
-		"SIOCDELRT",
-		"SIOCDEVPRIVATE",
-		"SIOCDIFADDR",
-		"SIOCDIFGROUP",
-		"SIOCDIFPHYADDR",
-		"SIOCDLIFADDR",
-		"SIOCDRARP",
-		"SIOCGARP",
-		"SIOCGDRVSPEC",
-		"SIOCGETKALIVE",
-		"SIOCGETLABEL",
-		"SIOCGETPFLOW",
-		"SIOCGETPFSYNC",
-		"SIOCGETSGCNT",
-		"SIOCGETVIFCNT",
-		"SIOCGETVLAN",
-		"SIOCGHIWAT",
-		"SIOCGIFADDR",
-		"SIOCGIFADDRPREF",
-		"SIOCGIFALIAS",
-		"SIOCGIFALTMTU",
-		"SIOCGIFASYNCMAP",
-		"SIOCGIFBOND",
-		"SIOCGIFBR",
-		"SIOCGIFBRDADDR",
-		"SIOCGIFCAP",
-		"SIOCGIFCONF",
-		"SIOCGIFCOUNT",
-		"SIOCGIFDATA",
-		"SIOCGIFDESCR",
-		"SIOCGIFDEVMTU",
-		"SIOCGIFDLT",
-		"SIOCGIFDSTADDR",
-		"SIOCGIFENCAP",
-		"SIOCGIFFIB",
-		"SIOCGIFFLAGS",
-		"SIOCGIFGATTR",
-		"SIOCGIFGENERIC",
-		"SIOCGIFGMEMB",
-		"SIOCGIFGROUP",
-		"SIOCGIFHARDMTU",
-		"SIOCGIFHWADDR",
-		"SIOCGIFINDEX",
-		"SIOCGIFKPI",
-		"SIOCGIFMAC",
-		"SIOCGIFMAP",
-		"SIOCGIFMEDIA",
-		"SIOCGIFMEM",
-		"SIOCGIFMETRIC",
-		"SIOCGIFMTU",
-		"SIOCGIFNAME",
-		"SIOCGIFNETMASK",
-		"SIOCGIFPDSTADDR",
-		"SIOCGIFPFLAGS",
-		"SIOCGIFPHYS",
-		"SIOCGIFPRIORITY",
-		"SIOCGIFPSRCADDR",
-		"SIOCGIFRDOMAIN",
-		"SIOCGIFRTLABEL",
-		"SIOCGIFSLAVE",
-		"SIOCGIFSTATUS",
-		"SIOCGIFTIMESLOT",
-		"SIOCGIFTXQLEN",
-		"SIOCGIFVLAN",
-		"SIOCGIFWAKEFLAGS",
-		"SIOCGIFXFLAGS",
-		"SIOCGLIFADDR",
-		"SIOCGLIFPHYADDR",
-		"SIOCGLIFPHYRTABLE",
-		"SIOCGLIFPHYTTL",
-		"SIOCGLINKSTR",
-		"SIOCGLOWAT",
-		"SIOCGPGRP",
-		"SIOCGPRIVATE_0",
-		"SIOCGPRIVATE_1",
-		"SIOCGRARP",
-		"SIOCGSPPPPARAMS",
-		"SIOCGSTAMP",
-		"SIOCGSTAMPNS",
-		"SIOCGVH",
-		"SIOCGVNETID",
-		"SIOCIFCREATE",
-		"SIOCIFCREATE2",
-		"SIOCIFDESTROY",
-		"SIOCIFGCLONERS",
-		"SIOCINITIFADDR",
-		"SIOCPROTOPRIVATE",
-		"SIOCRSLVMULTI",
-		"SIOCRTMSG",
-		"SIOCSARP",
-		"SIOCSDRVSPEC",
-		"SIOCSETKALIVE",
-		"SIOCSETLABEL",
-		"SIOCSETPFLOW",
-		"SIOCSETPFSYNC",
-		"SIOCSETVLAN",
-		"SIOCSHIWAT",
-		"SIOCSIFADDR",
-		"SIOCSIFADDRPREF",
-		"SIOCSIFALTMTU",
-		"SIOCSIFASYNCMAP",
-		"SIOCSIFBOND",
-		"SIOCSIFBR",
-		"SIOCSIFBRDADDR",
-		"SIOCSIFCAP",
-		"SIOCSIFDESCR",
-		"SIOCSIFDSTADDR",
-		"SIOCSIFENCAP",
-		"SIOCSIFFIB",
-		"SIOCSIFFLAGS",
-		"SIOCSIFGATTR",
-		"SIOCSIFGENERIC",
-		"SIOCSIFHWADDR",
-		"SIOCSIFHWBROADCAST",
-		"SIOCSIFKPI",
-		"SIOCSIFLINK",
-		"SIOCSIFLLADDR",
-		"SIOCSIFMAC",
-		"SIOCSIFMAP",
-		"SIOCSIFMEDIA",
-		"SIOCSIFMEM",
-		"SIOCSIFMETRIC",
-		"SIOCSIFMTU",
-		"SIOCSIFNAME",
-		"SIOCSIFNETMASK",
-		"SIOCSIFPFLAGS",
-		"SIOCSIFPHYADDR",
-		"SIOCSIFPHYS",
-		"SIOCSIFPRIORITY",
-		"SIOCSIFRDOMAIN",
-		"SIOCSIFRTLABEL",
-		"SIOCSIFRVNET",
-		"SIOCSIFSLAVE",
-		"SIOCSIFTIMESLOT",
-		"SIOCSIFTXQLEN",
-		"SIOCSIFVLAN",
-		"SIOCSIFVNET",
-		"SIOCSIFXFLAGS",
-		"SIOCSLIFPHYADDR",
-		"SIOCSLIFPHYRTABLE",
-		"SIOCSLIFPHYTTL",
-		"SIOCSLINKSTR",
-		"SIOCSLOWAT",
-		"SIOCSPGRP",
-		"SIOCSRARP",
-		"SIOCSSPPPPARAMS",
-		"SIOCSVH",
-		"SIOCSVNETID",
-		"SIOCZIFDATA",
-		"SIO_GET_EXTENSION_FUNCTION_POINTER",
-		"SIO_GET_INTERFACE_LIST",
-		"SIO_KEEPALIVE_VALS",
-		"SIO_UDP_CONNRESET",
-		"SOCK_CLOEXEC",
-		"SOCK_DCCP",
-		"SOCK_DGRAM",
-		"SOCK_FLAGS_MASK",
-		"SOCK_MAXADDRLEN",
-		"SOCK_NONBLOCK",
-		"SOCK_NOSIGPIPE",
-		"SOCK_PACKET",
-		"SOCK_RAW",
-		"SOCK_RDM",
-		"SOCK_SEQPACKET",
-		"SOCK_STREAM",
-		"SOL_AAL",
-		"SOL_ATM",
-		"SOL_DECNET",
-		"SOL_ICMPV6",
-		"SOL_IP",
-		"SOL_IPV6",
-		"SOL_IRDA",
-		"SOL_PACKET",
-		"SOL_RAW",
-		"SOL_SOCKET",
-		"SOL_TCP",
-		"SOL_X25",
-		"SOMAXCONN",
-		"SO_ACCEPTCONN",
-		"SO_ACCEPTFILTER",
-		"SO_ATTACH_FILTER",
-		"SO_BINDANY",
-		"SO_BINDTODEVICE",
-		"SO_BINTIME",
-		"SO_BROADCAST",
-		"SO_BSDCOMPAT",
-		"SO_DEBUG",
-		"SO_DETACH_FILTER",
-		"SO_DOMAIN",
-		"SO_DONTROUTE",
-		"SO_DONTTRUNC",
-		"SO_ERROR",
-		"SO_KEEPALIVE",
-		"SO_LABEL",
-		"SO_LINGER",
-		"SO_LINGER_SEC",
-		"SO_LISTENINCQLEN",
-		"SO_LISTENQLEN",
-		"SO_LISTENQLIMIT",
-		"SO_MARK",
-		"SO_NETPROC",
-		"SO_NKE",
-		"SO_NOADDRERR",
-		"SO_NOHEADER",
-		"SO_NOSIGPIPE",
-		"SO_NOTIFYCONFLICT",
-		"SO_NO_CHECK",
-		"SO_NO_DDP",
-		"SO_NO_OFFLOAD",
-		"SO_NP_EXTENSIONS",
-		"SO_NREAD",
-		"SO_NUMRCVPKT",
-		"SO_NWRITE",
-		"SO_OOBINLINE",
-		"SO_OVERFLOWED",
-		"SO_PASSCRED",
-		"SO_PASSSEC",
-		"SO_PEERCRED",
-		"SO_PEERLABEL",
-		"SO_PEERNAME",
-		"SO_PEERSEC",
-		"SO_PRIORITY",
-		"SO_PROTOCOL",
-		"SO_PROTOTYPE",
-		"SO_RANDOMPORT",
-		"SO_RCVBUF",
-		"SO_RCVBUFFORCE",
-		"SO_RCVLOWAT",
-		"SO_RCVTIMEO",
-		"SO_RESTRICTIONS",
-		"SO_RESTRICT_DENYIN",
-		"SO_RESTRICT_DENYOUT",
-		"SO_RESTRICT_DENYSET",
-		"SO_REUSEADDR",
-		"SO_REUSEPORT",
-		"SO_REUSESHAREUID",
-		"SO_RTABLE",
-		"SO_RXQ_OVFL",
-		"SO_SECURITY_AUTHENTICATION",
-		"SO_SECURITY_ENCRYPTION_NETWORK",
-		"SO_SECURITY_ENCRYPTION_TRANSPORT",
-		"SO_SETFIB",
-		"SO_SNDBUF",
-		"SO_SNDBUFFORCE",
-		"SO_SNDLOWAT",
-		"SO_SNDTIMEO",
-		"SO_SPLICE",
-		"SO_TIMESTAMP",
-		"SO_TIMESTAMPING",
-		"SO_TIMESTAMPNS",
-		"SO_TIMESTAMP_MONOTONIC",
-		"SO_TYPE",
-		"SO_UPCALLCLOSEWAIT",
-		"SO_UPDATE_ACCEPT_CONTEXT",
-		"SO_UPDATE_CONNECT_CONTEXT",
-		"SO_USELOOPBACK",
-		"SO_USER_COOKIE",
-		"SO_VENDOR",
-		"SO_WANTMORE",
-		"SO_WANTOOBFLAG",
-		"SSLExtraCertChainPolicyPara",
-		"STANDARD_RIGHTS_ALL",
-		"STANDARD_RIGHTS_EXECUTE",
-		"STANDARD_RIGHTS_READ",
-		"STANDARD_RIGHTS_REQUIRED",
-		"STANDARD_RIGHTS_WRITE",
-		"STARTF_USESHOWWINDOW",
-		"STARTF_USESTDHANDLES",
-		"STD_ERROR_HANDLE",
-		"STD_INPUT_HANDLE",
-		"STD_OUTPUT_HANDLE",
-		"SUBLANG_ENGLISH_US",
-		"SW_FORCEMINIMIZE",
-		"SW_HIDE",
-		"SW_MAXIMIZE",
-		"SW_MINIMIZE",
-		"SW_NORMAL",
-		"SW_RESTORE",
-		"SW_SHOW",
-		"SW_SHOWDEFAULT",
-		"SW_SHOWMAXIMIZED",
-		"SW_SHOWMINIMIZED",
-		"SW_SHOWMINNOACTIVE",
-		"SW_SHOWNA",
-		"SW_SHOWNOACTIVATE",
-		"SW_SHOWNORMAL",
-		"SYMBOLIC_LINK_FLAG_DIRECTORY",
-		"SYNCHRONIZE",
-		"SYSCTL_VERSION",
-		"SYSCTL_VERS_0",
-		"SYSCTL_VERS_1",
-		"SYSCTL_VERS_MASK",
-		"SYS_ABORT2",
-		"SYS_ACCEPT",
-		"SYS_ACCEPT4",
-		"SYS_ACCEPT_NOCANCEL",
-		"SYS_ACCESS",
-		"SYS_ACCESS_EXTENDED",
-		"SYS_ACCT",
-		"SYS_ADD_KEY",
-		"SYS_ADD_PROFIL",
-		"SYS_ADJFREQ",
-		"SYS_ADJTIME",
-		"SYS_ADJTIMEX",
-		"SYS_AFS_SYSCALL",
-		"SYS_AIO_CANCEL",
-		"SYS_AIO_ERROR",
-		"SYS_AIO_FSYNC",
-		"SYS_AIO_READ",
-		"SYS_AIO_RETURN",
-		"SYS_AIO_SUSPEND",
-		"SYS_AIO_SUSPEND_NOCANCEL",
-		"SYS_AIO_WRITE",
-		"SYS_ALARM",
-		"SYS_ARCH_PRCTL",
-		"SYS_ARM_FADVISE64_64",
-		"SYS_ARM_SYNC_FILE_RANGE",
-		"SYS_ATGETMSG",
-		"SYS_ATPGETREQ",
-		"SYS_ATPGETRSP",
-		"SYS_ATPSNDREQ",
-		"SYS_ATPSNDRSP",
-		"SYS_ATPUTMSG",
-		"SYS_ATSOCKET",
-		"SYS_AUDIT",
-		"SYS_AUDITCTL",
-		"SYS_AUDITON",
-		"SYS_AUDIT_SESSION_JOIN",
-		"SYS_AUDIT_SESSION_PORT",
-		"SYS_AUDIT_SESSION_SELF",
-		"SYS_BDFLUSH",
-		"SYS_BIND",
-		"SYS_BINDAT",
-		"SYS_BREAK",
-		"SYS_BRK",
-		"SYS_BSDTHREAD_CREATE",
-		"SYS_BSDTHREAD_REGISTER",
-		"SYS_BSDTHREAD_TERMINATE",
-		"SYS_CAPGET",
-		"SYS_CAPSET",
-		"SYS_CAP_ENTER",
-		"SYS_CAP_FCNTLS_GET",
-		"SYS_CAP_FCNTLS_LIMIT",
-		"SYS_CAP_GETMODE",
-		"SYS_CAP_GETRIGHTS",
-		"SYS_CAP_IOCTLS_GET",
-		"SYS_CAP_IOCTLS_LIMIT",
-		"SYS_CAP_NEW",
-		"SYS_CAP_RIGHTS_GET",
-		"SYS_CAP_RIGHTS_LIMIT",
-		"SYS_CHDIR",
-		"SYS_CHFLAGS",
-		"SYS_CHFLAGSAT",
-		"SYS_CHMOD",
-		"SYS_CHMOD_EXTENDED",
-		"SYS_CHOWN",
-		"SYS_CHOWN32",
-		"SYS_CHROOT",
-		"SYS_CHUD",
-		"SYS_CLOCK_ADJTIME",
-		"SYS_CLOCK_GETCPUCLOCKID2",
-		"SYS_CLOCK_GETRES",
-		"SYS_CLOCK_GETTIME",
-		"SYS_CLOCK_NANOSLEEP",
-		"SYS_CLOCK_SETTIME",
-		"SYS_CLONE",
-		"SYS_CLOSE",
-		"SYS_CLOSEFROM",
-		"SYS_CLOSE_NOCANCEL",
-		"SYS_CONNECT",
-		"SYS_CONNECTAT",
-		"SYS_CONNECT_NOCANCEL",
-		"SYS_COPYFILE",
-		"SYS_CPUSET",
-		"SYS_CPUSET_GETAFFINITY",
-		"SYS_CPUSET_GETID",
-		"SYS_CPUSET_SETAFFINITY",
-		"SYS_CPUSET_SETID",
-		"SYS_CREAT",
-		"SYS_CREATE_MODULE",
-		"SYS_CSOPS",
-		"SYS_CSOPS_AUDITTOKEN",
-		"SYS_DELETE",
-		"SYS_DELETE_MODULE",
-		"SYS_DUP",
-		"SYS_DUP2",
-		"SYS_DUP3",
-		"SYS_EACCESS",
-		"SYS_EPOLL_CREATE",
-		"SYS_EPOLL_CREATE1",
-		"SYS_EPOLL_CTL",
-		"SYS_EPOLL_CTL_OLD",
-		"SYS_EPOLL_PWAIT",
-		"SYS_EPOLL_WAIT",
-		"SYS_EPOLL_WAIT_OLD",
-		"SYS_EVENTFD",
-		"SYS_EVENTFD2",
-		"SYS_EXCHANGEDATA",
-		"SYS_EXECVE",
-		"SYS_EXIT",
-		"SYS_EXIT_GROUP",
-		"SYS_EXTATTRCTL",
-		"SYS_EXTATTR_DELETE_FD",
-		"SYS_EXTATTR_DELETE_FILE",
-		"SYS_EXTATTR_DELETE_LINK",
-		"SYS_EXTATTR_GET_FD",
-		"SYS_EXTATTR_GET_FILE",
-		"SYS_EXTATTR_GET_LINK",
-		"SYS_EXTATTR_LIST_FD",
-		"SYS_EXTATTR_LIST_FILE",
-		"SYS_EXTATTR_LIST_LINK",
-		"SYS_EXTATTR_SET_FD",
-		"SYS_EXTATTR_SET_FILE",
-		"SYS_EXTATTR_SET_LINK",
-		"SYS_FACCESSAT",
-		"SYS_FADVISE64",
-		"SYS_FADVISE64_64",
-		"SYS_FALLOCATE",
-		"SYS_FANOTIFY_INIT",
-		"SYS_FANOTIFY_MARK",
-		"SYS_FCHDIR",
-		"SYS_FCHFLAGS",
-		"SYS_FCHMOD",
-		"SYS_FCHMODAT",
-		"SYS_FCHMOD_EXTENDED",
-		"SYS_FCHOWN",
-		"SYS_FCHOWN32",
-		"SYS_FCHOWNAT",
-		"SYS_FCHROOT",
-		"SYS_FCNTL",
-		"SYS_FCNTL64",
-		"SYS_FCNTL_NOCANCEL",
-		"SYS_FDATASYNC",
-		"SYS_FEXECVE",
-		"SYS_FFCLOCK_GETCOUNTER",
-		"SYS_FFCLOCK_GETESTIMATE",
-		"SYS_FFCLOCK_SETESTIMATE",
-		"SYS_FFSCTL",
-		"SYS_FGETATTRLIST",
-		"SYS_FGETXATTR",
-		"SYS_FHOPEN",
-		"SYS_FHSTAT",
-		"SYS_FHSTATFS",
-		"SYS_FILEPORT_MAKEFD",
-		"SYS_FILEPORT_MAKEPORT",
-		"SYS_FKTRACE",
-		"SYS_FLISTXATTR",
-		"SYS_FLOCK",
-		"SYS_FORK",
-		"SYS_FPATHCONF",
-		"SYS_FREEBSD6_FTRUNCATE",
-		"SYS_FREEBSD6_LSEEK",
-		"SYS_FREEBSD6_MMAP",
-		"SYS_FREEBSD6_PREAD",
-		"SYS_FREEBSD6_PWRITE",
-		"SYS_FREEBSD6_TRUNCATE",
-		"SYS_FREMOVEXATTR",
-		"SYS_FSCTL",
-		"SYS_FSETATTRLIST",
-		"SYS_FSETXATTR",
-		"SYS_FSGETPATH",
-		"SYS_FSTAT",
-		"SYS_FSTAT64",
-		"SYS_FSTAT64_EXTENDED",
-		"SYS_FSTATAT",
-		"SYS_FSTATAT64",
-		"SYS_FSTATFS",
-		"SYS_FSTATFS64",
-		"SYS_FSTATV",
-		"SYS_FSTATVFS1",
-		"SYS_FSTAT_EXTENDED",
-		"SYS_FSYNC",
-		"SYS_FSYNC_NOCANCEL",
-		"SYS_FSYNC_RANGE",
-		"SYS_FTIME",
-		"SYS_FTRUNCATE",
-		"SYS_FTRUNCATE64",
-		"SYS_FUTEX",
-		"SYS_FUTIMENS",
-		"SYS_FUTIMES",
-		"SYS_FUTIMESAT",
-		"SYS_GETATTRLIST",
-		"SYS_GETAUDIT",
-		"SYS_GETAUDIT_ADDR",
-		"SYS_GETAUID",
-		"SYS_GETCONTEXT",
-		"SYS_GETCPU",
-		"SYS_GETCWD",
-		"SYS_GETDENTS",
-		"SYS_GETDENTS64",
-		"SYS_GETDIRENTRIES",
-		"SYS_GETDIRENTRIES64",
-		"SYS_GETDIRENTRIESATTR",
-		"SYS_GETDTABLECOUNT",
-		"SYS_GETDTABLESIZE",
-		"SYS_GETEGID",
-		"SYS_GETEGID32",
-		"SYS_GETEUID",
-		"SYS_GETEUID32",
-		"SYS_GETFH",
-		"SYS_GETFSSTAT",
-		"SYS_GETFSSTAT64",
-		"SYS_GETGID",
-		"SYS_GETGID32",
-		"SYS_GETGROUPS",
-		"SYS_GETGROUPS32",
-		"SYS_GETHOSTUUID",
-		"SYS_GETITIMER",
-		"SYS_GETLCID",
-		"SYS_GETLOGIN",
-		"SYS_GETLOGINCLASS",
-		"SYS_GETPEERNAME",
-		"SYS_GETPGID",
-		"SYS_GETPGRP",
-		"SYS_GETPID",
-		"SYS_GETPMSG",
-		"SYS_GETPPID",
-		"SYS_GETPRIORITY",
-		"SYS_GETRESGID",
-		"SYS_GETRESGID32",
-		"SYS_GETRESUID",
-		"SYS_GETRESUID32",
-		"SYS_GETRLIMIT",
-		"SYS_GETRTABLE",
-		"SYS_GETRUSAGE",
-		"SYS_GETSGROUPS",
-		"SYS_GETSID",
-		"SYS_GETSOCKNAME",
-		"SYS_GETSOCKOPT",
-		"SYS_GETTHRID",
-		"SYS_GETTID",
-		"SYS_GETTIMEOFDAY",
-		"SYS_GETUID",
-		"SYS_GETUID32",
-		"SYS_GETVFSSTAT",
-		"SYS_GETWGROUPS",
-		"SYS_GETXATTR",
-		"SYS_GET_KERNEL_SYMS",
-		"SYS_GET_MEMPOLICY",
-		"SYS_GET_ROBUST_LIST",
-		"SYS_GET_THREAD_AREA",
-		"SYS_GTTY",
-		"SYS_IDENTITYSVC",
-		"SYS_IDLE",
-		"SYS_INITGROUPS",
-		"SYS_INIT_MODULE",
-		"SYS_INOTIFY_ADD_WATCH",
-		"SYS_INOTIFY_INIT",
-		"SYS_INOTIFY_INIT1",
-		"SYS_INOTIFY_RM_WATCH",
-		"SYS_IOCTL",
-		"SYS_IOPERM",
-		"SYS_IOPL",
-		"SYS_IOPOLICYSYS",
-		"SYS_IOPRIO_GET",
-		"SYS_IOPRIO_SET",
-		"SYS_IO_CANCEL",
-		"SYS_IO_DESTROY",
-		"SYS_IO_GETEVENTS",
-		"SYS_IO_SETUP",
-		"SYS_IO_SUBMIT",
-		"SYS_IPC",
-		"SYS_ISSETUGID",
-		"SYS_JAIL",
-		"SYS_JAIL_ATTACH",
-		"SYS_JAIL_GET",
-		"SYS_JAIL_REMOVE",
-		"SYS_JAIL_SET",
-		"SYS_KAS_INFO",
-		"SYS_KDEBUG_TRACE",
-		"SYS_KENV",
-		"SYS_KEVENT",
-		"SYS_KEVENT64",
-		"SYS_KEXEC_LOAD",
-		"SYS_KEYCTL",
-		"SYS_KILL",
-		"SYS_KLDFIND",
-		"SYS_KLDFIRSTMOD",
-		"SYS_KLDLOAD",
-		"SYS_KLDNEXT",
-		"SYS_KLDSTAT",
-		"SYS_KLDSYM",
-		"SYS_KLDUNLOAD",
-		"SYS_KLDUNLOADF",
-		"SYS_KQUEUE",
-		"SYS_KQUEUE1",
-		"SYS_KTIMER_CREATE",
-		"SYS_KTIMER_DELETE",
-		"SYS_KTIMER_GETOVERRUN",
-		"SYS_KTIMER_GETTIME",
-		"SYS_KTIMER_SETTIME",
-		"SYS_KTRACE",
-		"SYS_LCHFLAGS",
-		"SYS_LCHMOD",
-		"SYS_LCHOWN",
-		"SYS_LCHOWN32",
-		"SYS_LEDGER",
-		"SYS_LGETFH",
-		"SYS_LGETXATTR",
-		"SYS_LINK",
-		"SYS_LINKAT",
-		"SYS_LIO_LISTIO",
-		"SYS_LISTEN",
-		"SYS_LISTXATTR",
-		"SYS_LLISTXATTR",
-		"SYS_LOCK",
-		"SYS_LOOKUP_DCOOKIE",
-		"SYS_LPATHCONF",
-		"SYS_LREMOVEXATTR",
-		"SYS_LSEEK",
-		"SYS_LSETXATTR",
-		"SYS_LSTAT",
-		"SYS_LSTAT64",
-		"SYS_LSTAT64_EXTENDED",
-		"SYS_LSTATV",
-		"SYS_LSTAT_EXTENDED",
-		"SYS_LUTIMES",
-		"SYS_MAC_SYSCALL",
-		"SYS_MADVISE",
-		"SYS_MADVISE1",
-		"SYS_MAXSYSCALL",
-		"SYS_MBIND",
-		"SYS_MIGRATE_PAGES",
-		"SYS_MINCORE",
-		"SYS_MINHERIT",
-		"SYS_MKCOMPLEX",
-		"SYS_MKDIR",
-		"SYS_MKDIRAT",
-		"SYS_MKDIR_EXTENDED",
-		"SYS_MKFIFO",
-		"SYS_MKFIFOAT",
-		"SYS_MKFIFO_EXTENDED",
-		"SYS_MKNOD",
-		"SYS_MKNODAT",
-		"SYS_MLOCK",
-		"SYS_MLOCKALL",
-		"SYS_MMAP",
-		"SYS_MMAP2",
-		"SYS_MODCTL",
-		"SYS_MODFIND",
-		"SYS_MODFNEXT",
-		"SYS_MODIFY_LDT",
-		"SYS_MODNEXT",
-		"SYS_MODSTAT",
-		"SYS_MODWATCH",
-		"SYS_MOUNT",
-		"SYS_MOVE_PAGES",
-		"SYS_MPROTECT",
-		"SYS_MPX",
-		"SYS_MQUERY",
-		"SYS_MQ_GETSETATTR",
-		"SYS_MQ_NOTIFY",
-		"SYS_MQ_OPEN",
-		"SYS_MQ_TIMEDRECEIVE",
-		"SYS_MQ_TIMEDSEND",
-		"SYS_MQ_UNLINK",
-		"SYS_MREMAP",
-		"SYS_MSGCTL",
-		"SYS_MSGGET",
-		"SYS_MSGRCV",
-		"SYS_MSGRCV_NOCANCEL",
-		"SYS_MSGSND",
-		"SYS_MSGSND_NOCANCEL",
-		"SYS_MSGSYS",
-		"SYS_MSYNC",
-		"SYS_MSYNC_NOCANCEL",
-		"SYS_MUNLOCK",
-		"SYS_MUNLOCKALL",
-		"SYS_MUNMAP",
-		"SYS_NAME_TO_HANDLE_AT",
-		"SYS_NANOSLEEP",
-		"SYS_NEWFSTATAT",
-		"SYS_NFSCLNT",
-		"SYS_NFSSERVCTL",
-		"SYS_NFSSVC",
-		"SYS_NFSTAT",
-		"SYS_NICE",
-		"SYS_NLSTAT",
-		"SYS_NMOUNT",
-		"SYS_NSTAT",
-		"SYS_NTP_ADJTIME",
-		"SYS_NTP_GETTIME",
-		"SYS_OABI_SYSCALL_BASE",
-		"SYS_OBREAK",
-		"SYS_OLDFSTAT",
-		"SYS_OLDLSTAT",
-		"SYS_OLDOLDUNAME",
-		"SYS_OLDSTAT",
-		"SYS_OLDUNAME",
-		"SYS_OPEN",
-		"SYS_OPENAT",
-		"SYS_OPENBSD_POLL",
-		"SYS_OPEN_BY_HANDLE_AT",
-		"SYS_OPEN_DPROTECTED_NP",
-		"SYS_OPEN_EXTENDED",
-		"SYS_OPEN_NOCANCEL",
-		"SYS_OVADVISE",
-		"SYS_PACCEPT",
-		"SYS_PATHCONF",
-		"SYS_PAUSE",
-		"SYS_PCICONFIG_IOBASE",
-		"SYS_PCICONFIG_READ",
-		"SYS_PCICONFIG_WRITE",
-		"SYS_PDFORK",
-		"SYS_PDGETPID",
-		"SYS_PDKILL",
-		"SYS_PERF_EVENT_OPEN",
-		"SYS_PERSONALITY",
-		"SYS_PID_HIBERNATE",
-		"SYS_PID_RESUME",
-		"SYS_PID_SHUTDOWN_SOCKETS",
-		"SYS_PID_SUSPEND",
-		"SYS_PIPE",
-		"SYS_PIPE2",
-		"SYS_PIVOT_ROOT",
-		"SYS_PMC_CONTROL",
-		"SYS_PMC_GET_INFO",
-		"SYS_POLL",
-		"SYS_POLLTS",
-		"SYS_POLL_NOCANCEL",
-		"SYS_POSIX_FADVISE",
-		"SYS_POSIX_FALLOCATE",
-		"SYS_POSIX_OPENPT",
-		"SYS_POSIX_SPAWN",
-		"SYS_PPOLL",
-		"SYS_PRCTL",
-		"SYS_PREAD",
-		"SYS_PREAD64",
-		"SYS_PREADV",
-		"SYS_PREAD_NOCANCEL",
-		"SYS_PRLIMIT64",
-		"SYS_PROCCTL",
-		"SYS_PROCESS_POLICY",
-		"SYS_PROCESS_VM_READV",
-		"SYS_PROCESS_VM_WRITEV",
-		"SYS_PROC_INFO",
-		"SYS_PROF",
-		"SYS_PROFIL",
-		"SYS_PSELECT",
-		"SYS_PSELECT6",
-		"SYS_PSET_ASSIGN",
-		"SYS_PSET_CREATE",
-		"SYS_PSET_DESTROY",
-		"SYS_PSYNCH_CVBROAD",
-		"SYS_PSYNCH_CVCLRPREPOST",
-		"SYS_PSYNCH_CVSIGNAL",
-		"SYS_PSYNCH_CVWAIT",
-		"SYS_PSYNCH_MUTEXDROP",
-		"SYS_PSYNCH_MUTEXWAIT",
-		"SYS_PSYNCH_RW_DOWNGRADE",
-		"SYS_PSYNCH_RW_LONGRDLOCK",
-		"SYS_PSYNCH_RW_RDLOCK",
-		"SYS_PSYNCH_RW_UNLOCK",
-		"SYS_PSYNCH_RW_UNLOCK2",
-		"SYS_PSYNCH_RW_UPGRADE",
-		"SYS_PSYNCH_RW_WRLOCK",
-		"SYS_PSYNCH_RW_YIELDWRLOCK",
-		"SYS_PTRACE",
-		"SYS_PUTPMSG",
-		"SYS_PWRITE",
-		"SYS_PWRITE64",
-		"SYS_PWRITEV",
-		"SYS_PWRITE_NOCANCEL",
-		"SYS_QUERY_MODULE",
-		"SYS_QUOTACTL",
-		"SYS_RASCTL",
-		"SYS_RCTL_ADD_RULE",
-		"SYS_RCTL_GET_LIMITS",
-		"SYS_RCTL_GET_RACCT",
-		"SYS_RCTL_GET_RULES",
-		"SYS_RCTL_REMOVE_RULE",
-		"SYS_READ",
-		"SYS_READAHEAD",
-		"SYS_READDIR",
-		"SYS_READLINK",
-		"SYS_READLINKAT",
-		"SYS_READV",
-		"SYS_READV_NOCANCEL",
-		"SYS_READ_NOCANCEL",
-		"SYS_REBOOT",
-		"SYS_RECV",
-		"SYS_RECVFROM",
-		"SYS_RECVFROM_NOCANCEL",
-		"SYS_RECVMMSG",
-		"SYS_RECVMSG",
-		"SYS_RECVMSG_NOCANCEL",
-		"SYS_REMAP_FILE_PAGES",
-		"SYS_REMOVEXATTR",
-		"SYS_RENAME",
-		"SYS_RENAMEAT",
-		"SYS_REQUEST_KEY",
-		"SYS_RESTART_SYSCALL",
-		"SYS_REVOKE",
-		"SYS_RFORK",
-		"SYS_RMDIR",
-		"SYS_RTPRIO",
-		"SYS_RTPRIO_THREAD",
-		"SYS_RT_SIGACTION",
-		"SYS_RT_SIGPENDING",
-		"SYS_RT_SIGPROCMASK",
-		"SYS_RT_SIGQUEUEINFO",
-		"SYS_RT_SIGRETURN",
-		"SYS_RT_SIGSUSPEND",
-		"SYS_RT_SIGTIMEDWAIT",
-		"SYS_RT_TGSIGQUEUEINFO",
-		"SYS_SBRK",
-		"SYS_SCHED_GETAFFINITY",
-		"SYS_SCHED_GETPARAM",
-		"SYS_SCHED_GETSCHEDULER",
-		"SYS_SCHED_GET_PRIORITY_MAX",
-		"SYS_SCHED_GET_PRIORITY_MIN",
-		"SYS_SCHED_RR_GET_INTERVAL",
-		"SYS_SCHED_SETAFFINITY",
-		"SYS_SCHED_SETPARAM",
-		"SYS_SCHED_SETSCHEDULER",
-		"SYS_SCHED_YIELD",
-		"SYS_SCTP_GENERIC_RECVMSG",
-		"SYS_SCTP_GENERIC_SENDMSG",
-		"SYS_SCTP_GENERIC_SENDMSG_IOV",
-		"SYS_SCTP_PEELOFF",
-		"SYS_SEARCHFS",
-		"SYS_SECURITY",
-		"SYS_SELECT",
-		"SYS_SELECT_NOCANCEL",
-		"SYS_SEMCONFIG",
-		"SYS_SEMCTL",
-		"SYS_SEMGET",
-		"SYS_SEMOP",
-		"SYS_SEMSYS",
-		"SYS_SEMTIMEDOP",
-		"SYS_SEM_CLOSE",
-		"SYS_SEM_DESTROY",
-		"SYS_SEM_GETVALUE",
-		"SYS_SEM_INIT",
-		"SYS_SEM_OPEN",
-		"SYS_SEM_POST",
-		"SYS_SEM_TRYWAIT",
-		"SYS_SEM_UNLINK",
-		"SYS_SEM_WAIT",
-		"SYS_SEM_WAIT_NOCANCEL",
-		"SYS_SEND",
-		"SYS_SENDFILE",
-		"SYS_SENDFILE64",
-		"SYS_SENDMMSG",
-		"SYS_SENDMSG",
-		"SYS_SENDMSG_NOCANCEL",
-		"SYS_SENDTO",
-		"SYS_SENDTO_NOCANCEL",
-		"SYS_SETATTRLIST",
-		"SYS_SETAUDIT",
-		"SYS_SETAUDIT_ADDR",
-		"SYS_SETAUID",
-		"SYS_SETCONTEXT",
-		"SYS_SETDOMAINNAME",
-		"SYS_SETEGID",
-		"SYS_SETEUID",
-		"SYS_SETFIB",
-		"SYS_SETFSGID",
-		"SYS_SETFSGID32",
-		"SYS_SETFSUID",
-		"SYS_SETFSUID32",
-		"SYS_SETGID",
-		"SYS_SETGID32",
-		"SYS_SETGROUPS",
-		"SYS_SETGROUPS32",
-		"SYS_SETHOSTNAME",
-		"SYS_SETITIMER",
-		"SYS_SETLCID",
-		"SYS_SETLOGIN",
-		"SYS_SETLOGINCLASS",
-		"SYS_SETNS",
-		"SYS_SETPGID",
-		"SYS_SETPRIORITY",
-		"SYS_SETPRIVEXEC",
-		"SYS_SETREGID",
-		"SYS_SETREGID32",
-		"SYS_SETRESGID",
-		"SYS_SETRESGID32",
-		"SYS_SETRESUID",
-		"SYS_SETRESUID32",
-		"SYS_SETREUID",
-		"SYS_SETREUID32",
-		"SYS_SETRLIMIT",
-		"SYS_SETRTABLE",
-		"SYS_SETSGROUPS",
-		"SYS_SETSID",
-		"SYS_SETSOCKOPT",
-		"SYS_SETTID",
-		"SYS_SETTID_WITH_PID",
-		"SYS_SETTIMEOFDAY",
-		"SYS_SETUID",
-		"SYS_SETUID32",
-		"SYS_SETWGROUPS",
-		"SYS_SETXATTR",
-		"SYS_SET_MEMPOLICY",
-		"SYS_SET_ROBUST_LIST",
-		"SYS_SET_THREAD_AREA",
-		"SYS_SET_TID_ADDRESS",
-		"SYS_SGETMASK",
-		"SYS_SHARED_REGION_CHECK_NP",
-		"SYS_SHARED_REGION_MAP_AND_SLIDE_NP",
-		"SYS_SHMAT",
-		"SYS_SHMCTL",
-		"SYS_SHMDT",
-		"SYS_SHMGET",
-		"SYS_SHMSYS",
-		"SYS_SHM_OPEN",
-		"SYS_SHM_UNLINK",
-		"SYS_SHUTDOWN",
-		"SYS_SIGACTION",
-		"SYS_SIGALTSTACK",
-		"SYS_SIGNAL",
-		"SYS_SIGNALFD",
-		"SYS_SIGNALFD4",
-		"SYS_SIGPENDING",
-		"SYS_SIGPROCMASK",
-		"SYS_SIGQUEUE",
-		"SYS_SIGQUEUEINFO",
-		"SYS_SIGRETURN",
-		"SYS_SIGSUSPEND",
-		"SYS_SIGSUSPEND_NOCANCEL",
-		"SYS_SIGTIMEDWAIT",
-		"SYS_SIGWAIT",
-		"SYS_SIGWAITINFO",
-		"SYS_SOCKET",
-		"SYS_SOCKETCALL",
-		"SYS_SOCKETPAIR",
-		"SYS_SPLICE",
-		"SYS_SSETMASK",
-		"SYS_SSTK",
-		"SYS_STACK_SNAPSHOT",
-		"SYS_STAT",
-		"SYS_STAT64",
-		"SYS_STAT64_EXTENDED",
-		"SYS_STATFS",
-		"SYS_STATFS64",
-		"SYS_STATV",
-		"SYS_STATVFS1",
-		"SYS_STAT_EXTENDED",
-		"SYS_STIME",
-		"SYS_STTY",
-		"SYS_SWAPCONTEXT",
-		"SYS_SWAPCTL",
-		"SYS_SWAPOFF",
-		"SYS_SWAPON",
-		"SYS_SYMLINK",
-		"SYS_SYMLINKAT",
-		"SYS_SYNC",
-		"SYS_SYNCFS",
-		"SYS_SYNC_FILE_RANGE",
-		"SYS_SYSARCH",
-		"SYS_SYSCALL",
-		"SYS_SYSCALL_BASE",
-		"SYS_SYSFS",
-		"SYS_SYSINFO",
-		"SYS_SYSLOG",
-		"SYS_TEE",
-		"SYS_TGKILL",
-		"SYS_THREAD_SELFID",
-		"SYS_THR_CREATE",
-		"SYS_THR_EXIT",
-		"SYS_THR_KILL",
-		"SYS_THR_KILL2",
-		"SYS_THR_NEW",
-		"SYS_THR_SELF",
-		"SYS_THR_SET_NAME",
-		"SYS_THR_SUSPEND",
-		"SYS_THR_WAKE",
-		"SYS_TIME",
-		"SYS_TIMERFD_CREATE",
-		"SYS_TIMERFD_GETTIME",
-		"SYS_TIMERFD_SETTIME",
-		"SYS_TIMER_CREATE",
-		"SYS_TIMER_DELETE",
-		"SYS_TIMER_GETOVERRUN",
-		"SYS_TIMER_GETTIME",
-		"SYS_TIMER_SETTIME",
-		"SYS_TIMES",
-		"SYS_TKILL",
-		"SYS_TRUNCATE",
-		"SYS_TRUNCATE64",
-		"SYS_TUXCALL",
-		"SYS_UGETRLIMIT",
-		"SYS_ULIMIT",
-		"SYS_UMASK",
-		"SYS_UMASK_EXTENDED",
-		"SYS_UMOUNT",
-		"SYS_UMOUNT2",
-		"SYS_UNAME",
-		"SYS_UNDELETE",
-		"SYS_UNLINK",
-		"SYS_UNLINKAT",
-		"SYS_UNMOUNT",
-		"SYS_UNSHARE",
-		"SYS_USELIB",
-		"SYS_USTAT",
-		"SYS_UTIME",
-		"SYS_UTIMENSAT",
-		"SYS_UTIMES",
-		"SYS_UTRACE",
-		"SYS_UUIDGEN",
-		"SYS_VADVISE",
-		"SYS_VFORK",
-		"SYS_VHANGUP",
-		"SYS_VM86",
-		"SYS_VM86OLD",
-		"SYS_VMSPLICE",
-		"SYS_VM_PRESSURE_MONITOR",
-		"SYS_VSERVER",
-		"SYS_WAIT4",
-		"SYS_WAIT4_NOCANCEL",
-		"SYS_WAIT6",
-		"SYS_WAITEVENT",
-		"SYS_WAITID",
-		"SYS_WAITID_NOCANCEL",
-		"SYS_WAITPID",
-		"SYS_WATCHEVENT",
-		"SYS_WORKQ_KERNRETURN",
-		"SYS_WORKQ_OPEN",
-		"SYS_WRITE",
-		"SYS_WRITEV",
-		"SYS_WRITEV_NOCANCEL",
-		"SYS_WRITE_NOCANCEL",
-		"SYS_YIELD",
-		"SYS__LLSEEK",
-		"SYS__LWP_CONTINUE",
-		"SYS__LWP_CREATE",
-		"SYS__LWP_CTL",
-		"SYS__LWP_DETACH",
-		"SYS__LWP_EXIT",
-		"SYS__LWP_GETNAME",
-		"SYS__LWP_GETPRIVATE",
-		"SYS__LWP_KILL",
-		"SYS__LWP_PARK",
-		"SYS__LWP_SELF",
-		"SYS__LWP_SETNAME",
-		"SYS__LWP_SETPRIVATE",
-		"SYS__LWP_SUSPEND",
-		"SYS__LWP_UNPARK",
-		"SYS__LWP_UNPARK_ALL",
-		"SYS__LWP_WAIT",
-		"SYS__LWP_WAKEUP",
-		"SYS__NEWSELECT",
-		"SYS__PSET_BIND",
-		"SYS__SCHED_GETAFFINITY",
-		"SYS__SCHED_GETPARAM",
-		"SYS__SCHED_SETAFFINITY",
-		"SYS__SCHED_SETPARAM",
-		"SYS__SYSCTL",
-		"SYS__UMTX_LOCK",
-		"SYS__UMTX_OP",
-		"SYS__UMTX_UNLOCK",
-		"SYS___ACL_ACLCHECK_FD",
-		"SYS___ACL_ACLCHECK_FILE",
-		"SYS___ACL_ACLCHECK_LINK",
-		"SYS___ACL_DELETE_FD",
-		"SYS___ACL_DELETE_FILE",
-		"SYS___ACL_DELETE_LINK",
-		"SYS___ACL_GET_FD",
-		"SYS___ACL_GET_FILE",
-		"SYS___ACL_GET_LINK",
-		"SYS___ACL_SET_FD",
-		"SYS___ACL_SET_FILE",
-		"SYS___ACL_SET_LINK",
-		"SYS___CLONE",
-		"SYS___DISABLE_THREADSIGNAL",
-		"SYS___GETCWD",
-		"SYS___GETLOGIN",
-		"SYS___GET_TCB",
-		"SYS___MAC_EXECVE",
-		"SYS___MAC_GETFSSTAT",
-		"SYS___MAC_GET_FD",
-		"SYS___MAC_GET_FILE",
-		"SYS___MAC_GET_LCID",
-		"SYS___MAC_GET_LCTX",
-		"SYS___MAC_GET_LINK",
-		"SYS___MAC_GET_MOUNT",
-		"SYS___MAC_GET_PID",
-		"SYS___MAC_GET_PROC",
-		"SYS___MAC_MOUNT",
-		"SYS___MAC_SET_FD",
-		"SYS___MAC_SET_FILE",
-		"SYS___MAC_SET_LCTX",
-		"SYS___MAC_SET_LINK",
-		"SYS___MAC_SET_PROC",
-		"SYS___MAC_SYSCALL",
-		"SYS___OLD_SEMWAIT_SIGNAL",
-		"SYS___OLD_SEMWAIT_SIGNAL_NOCANCEL",
-		"SYS___POSIX_CHOWN",
-		"SYS___POSIX_FCHOWN",
-		"SYS___POSIX_LCHOWN",
-		"SYS___POSIX_RENAME",
-		"SYS___PTHREAD_CANCELED",
-		"SYS___PTHREAD_CHDIR",
-		"SYS___PTHREAD_FCHDIR",
-		"SYS___PTHREAD_KILL",
-		"SYS___PTHREAD_MARKCANCEL",
-		"SYS___PTHREAD_SIGMASK",
-		"SYS___QUOTACTL",
-		"SYS___SEMCTL",
-		"SYS___SEMWAIT_SIGNAL",
-		"SYS___SEMWAIT_SIGNAL_NOCANCEL",
-		"SYS___SETLOGIN",
-		"SYS___SETUGID",
-		"SYS___SET_TCB",
-		"SYS___SIGACTION_SIGTRAMP",
-		"SYS___SIGTIMEDWAIT",
-		"SYS___SIGWAIT",
-		"SYS___SIGWAIT_NOCANCEL",
-		"SYS___SYSCTL",
-		"SYS___TFORK",
-		"SYS___THREXIT",
-		"SYS___THRSIGDIVERT",
-		"SYS___THRSLEEP",
-		"SYS___THRWAKEUP",
-		"S_ARCH1",
-		"S_ARCH2",
-		"S_BLKSIZE",
-		"S_IEXEC",
-		"S_IFBLK",
-		"S_IFCHR",
-		"S_IFDIR",
-		"S_IFIFO",
-		"S_IFLNK",
-		"S_IFMT",
-		"S_IFREG",
-		"S_IFSOCK",
-		"S_IFWHT",
-		"S_IREAD",
-		"S_IRGRP",
-		"S_IROTH",
-		"S_IRUSR",
-		"S_IRWXG",
-		"S_IRWXO",
-		"S_IRWXU",
-		"S_ISGID",
-		"S_ISTXT",
-		"S_ISUID",
-		"S_ISVTX",
-		"S_IWGRP",
-		"S_IWOTH",
-		"S_IWRITE",
-		"S_IWUSR",
-		"S_IXGRP",
-		"S_IXOTH",
-		"S_IXUSR",
-		"S_LOGIN_SET",
-		"SecurityAttributes",
-		"Seek",
-		"Select",
-		"Sendfile",
-		"Sendmsg",
-		"SendmsgN",
-		"Sendto",
-		"Servent",
-		"SetBpf",
-		"SetBpfBuflen",
-		"SetBpfDatalink",
-		"SetBpfHeadercmpl",
-		"SetBpfImmediate",
-		"SetBpfInterface",
-		"SetBpfPromisc",
-		"SetBpfTimeout",
-		"SetCurrentDirectory",
-		"SetEndOfFile",
-		"SetEnvironmentVariable",
-		"SetFileAttributes",
-		"SetFileCompletionNotificationModes",
-		"SetFilePointer",
-		"SetFileTime",
-		"SetHandleInformation",
-		"SetKevent",
-		"SetLsfPromisc",
-		"SetNonblock",
-		"Setdomainname",
-		"Setegid",
-		"Setenv",
-		"Seteuid",
-		"Setfsgid",
-		"Setfsuid",
-		"Setgid",
-		"Setgroups",
-		"Sethostname",
-		"Setlogin",
-		"Setpgid",
-		"Setpriority",
-		"Setprivexec",
-		"Setregid",
-		"Setresgid",
-		"Setresuid",
-		"Setreuid",
-		"Setrlimit",
-		"Setsid",
-		"Setsockopt",
-		"SetsockoptByte",
-		"SetsockoptICMPv6Filter",
-		"SetsockoptIPMreq",
-		"SetsockoptIPMreqn",
-		"SetsockoptIPv6Mreq",
-		"SetsockoptInet4Addr",
-		"SetsockoptInt",
-		"SetsockoptLinger",
-		"SetsockoptString",
-		"SetsockoptTimeval",
-		"Settimeofday",
-		"Setuid",
-		"Setxattr",
-		"Shutdown",
-		"SidTypeAlias",
-		"SidTypeComputer",
-		"SidTypeDeletedAccount",
-		"SidTypeDomain",
-		"SidTypeGroup",
-		"SidTypeInvalid",
-		"SidTypeLabel",
-		"SidTypeUnknown",
-		"SidTypeUser",
-		"SidTypeWellKnownGroup",
-		"Signal",
-		"SizeofBpfHdr",
-		"SizeofBpfInsn",
-		"SizeofBpfProgram",
-		"SizeofBpfStat",
-		"SizeofBpfVersion",
-		"SizeofBpfZbuf",
-		"SizeofBpfZbufHeader",
-		"SizeofCmsghdr",
-		"SizeofICMPv6Filter",
-		"SizeofIPMreq",
-		"SizeofIPMreqn",
-		"SizeofIPv6MTUInfo",
-		"SizeofIPv6Mreq",
-		"SizeofIfAddrmsg",
-		"SizeofIfAnnounceMsghdr",
-		"SizeofIfData",
-		"SizeofIfInfomsg",
-		"SizeofIfMsghdr",
-		"SizeofIfaMsghdr",
-		"SizeofIfmaMsghdr",
-		"SizeofIfmaMsghdr2",
-		"SizeofInet4Pktinfo",
-		"SizeofInet6Pktinfo",
-		"SizeofInotifyEvent",
-		"SizeofLinger",
-		"SizeofMsghdr",
-		"SizeofNlAttr",
-		"SizeofNlMsgerr",
-		"SizeofNlMsghdr",
-		"SizeofRtAttr",
-		"SizeofRtGenmsg",
-		"SizeofRtMetrics",
-		"SizeofRtMsg",
-		"SizeofRtMsghdr",
-		"SizeofRtNexthop",
-		"SizeofSockFilter",
-		"SizeofSockFprog",
-		"SizeofSockaddrAny",
-		"SizeofSockaddrDatalink",
-		"SizeofSockaddrInet4",
-		"SizeofSockaddrInet6",
-		"SizeofSockaddrLinklayer",
-		"SizeofSockaddrNetlink",
-		"SizeofSockaddrUnix",
-		"SizeofTCPInfo",
-		"SizeofUcred",
-		"SlicePtrFromStrings",
-		"SockFilter",
-		"SockFprog",
-		"Sockaddr",
-		"SockaddrDatalink",
-		"SockaddrGen",
-		"SockaddrInet4",
-		"SockaddrInet6",
-		"SockaddrLinklayer",
-		"SockaddrNetlink",
-		"SockaddrUnix",
-		"Socket",
-		"SocketControlMessage",
-		"SocketDisableIPv6",
-		"Socketpair",
-		"Splice",
-		"StartProcess",
-		"StartupInfo",
-		"Stat",
-		"Stat_t",
-		"Statfs",
-		"Statfs_t",
-		"Stderr",
-		"Stdin",
-		"Stdout",
-		"StringBytePtr",
-		"StringByteSlice",
-		"StringSlicePtr",
-		"StringToSid",
-		"StringToUTF16",
-		"StringToUTF16Ptr",
-		"Symlink",
-		"Sync",
-		"SyncFileRange",
-		"SysProcAttr",
-		"SysProcIDMap",
-		"Syscall",
-		"Syscall12",
-		"Syscall15",
-		"Syscall18",
-		"Syscall6",
-		"Syscall9",
-		"SyscallN",
-		"Sysctl",
-		"SysctlUint32",
-		"Sysctlnode",
-		"Sysinfo",
-		"Sysinfo_t",
-		"Systemtime",
-		"TCGETS",
-		"TCIFLUSH",
-		"TCIOFLUSH",
-		"TCOFLUSH",
-		"TCPInfo",
-		"TCPKeepalive",
-		"TCP_CA_NAME_MAX",
-		"TCP_CONGCTL",
-		"TCP_CONGESTION",
-		"TCP_CONNECTIONTIMEOUT",
-		"TCP_CORK",
-		"TCP_DEFER_ACCEPT",
-		"TCP_ENABLE_ECN",
-		"TCP_INFO",
-		"TCP_KEEPALIVE",
-		"TCP_KEEPCNT",
-		"TCP_KEEPIDLE",
-		"TCP_KEEPINIT",
-		"TCP_KEEPINTVL",
-		"TCP_LINGER2",
-		"TCP_MAXBURST",
-		"TCP_MAXHLEN",
-		"TCP_MAXOLEN",
-		"TCP_MAXSEG",
-		"TCP_MAXWIN",
-		"TCP_MAX_SACK",
-		"TCP_MAX_WINSHIFT",
-		"TCP_MD5SIG",
-		"TCP_MD5SIG_MAXKEYLEN",
-		"TCP_MINMSS",
-		"TCP_MINMSSOVERLOAD",
-		"TCP_MSS",
-		"TCP_NODELAY",
-		"TCP_NOOPT",
-		"TCP_NOPUSH",
-		"TCP_NOTSENT_LOWAT",
-		"TCP_NSTATES",
-		"TCP_QUICKACK",
-		"TCP_RXT_CONNDROPTIME",
-		"TCP_RXT_FINDROP",
-		"TCP_SACK_ENABLE",
-		"TCP_SENDMOREACKS",
-		"TCP_SYNCNT",
-		"TCP_VENDOR",
-		"TCP_WINDOW_CLAMP",
-		"TCSAFLUSH",
-		"TCSETS",
-		"TF_DISCONNECT",
-		"TF_REUSE_SOCKET",
-		"TF_USE_DEFAULT_WORKER",
-		"TF_USE_KERNEL_APC",
-		"TF_USE_SYSTEM_THREAD",
-		"TF_WRITE_BEHIND",
-		"TH32CS_INHERIT",
-		"TH32CS_SNAPALL",
-		"TH32CS_SNAPHEAPLIST",
-		"TH32CS_SNAPMODULE",
-		"TH32CS_SNAPMODULE32",
-		"TH32CS_SNAPPROCESS",
-		"TH32CS_SNAPTHREAD",
-		"TIME_ZONE_ID_DAYLIGHT",
-		"TIME_ZONE_ID_STANDARD",
-		"TIME_ZONE_ID_UNKNOWN",
-		"TIOCCBRK",
-		"TIOCCDTR",
-		"TIOCCONS",
-		"TIOCDCDTIMESTAMP",
-		"TIOCDRAIN",
-		"TIOCDSIMICROCODE",
-		"TIOCEXCL",
-		"TIOCEXT",
-		"TIOCFLAG_CDTRCTS",
-		"TIOCFLAG_CLOCAL",
-		"TIOCFLAG_CRTSCTS",
-		"TIOCFLAG_MDMBUF",
-		"TIOCFLAG_PPS",
-		"TIOCFLAG_SOFTCAR",
-		"TIOCFLUSH",
-		"TIOCGDEV",
-		"TIOCGDRAINWAIT",
-		"TIOCGETA",
-		"TIOCGETD",
-		"TIOCGFLAGS",
-		"TIOCGICOUNT",
-		"TIOCGLCKTRMIOS",
-		"TIOCGLINED",
-		"TIOCGPGRP",
-		"TIOCGPTN",
-		"TIOCGQSIZE",
-		"TIOCGRANTPT",
-		"TIOCGRS485",
-		"TIOCGSERIAL",
-		"TIOCGSID",
-		"TIOCGSIZE",
-		"TIOCGSOFTCAR",
-		"TIOCGTSTAMP",
-		"TIOCGWINSZ",
-		"TIOCINQ",
-		"TIOCIXOFF",
-		"TIOCIXON",
-		"TIOCLINUX",
-		"TIOCMBIC",
-		"TIOCMBIS",
-		"TIOCMGDTRWAIT",
-		"TIOCMGET",
-		"TIOCMIWAIT",
-		"TIOCMODG",
-		"TIOCMODS",
-		"TIOCMSDTRWAIT",
-		"TIOCMSET",
-		"TIOCM_CAR",
-		"TIOCM_CD",
-		"TIOCM_CTS",
-		"TIOCM_DCD",
-		"TIOCM_DSR",
-		"TIOCM_DTR",
-		"TIOCM_LE",
-		"TIOCM_RI",
-		"TIOCM_RNG",
-		"TIOCM_RTS",
-		"TIOCM_SR",
-		"TIOCM_ST",
-		"TIOCNOTTY",
-		"TIOCNXCL",
-		"TIOCOUTQ",
-		"TIOCPKT",
-		"TIOCPKT_DATA",
-		"TIOCPKT_DOSTOP",
-		"TIOCPKT_FLUSHREAD",
-		"TIOCPKT_FLUSHWRITE",
-		"TIOCPKT_IOCTL",
-		"TIOCPKT_NOSTOP",
-		"TIOCPKT_START",
-		"TIOCPKT_STOP",
-		"TIOCPTMASTER",
-		"TIOCPTMGET",
-		"TIOCPTSNAME",
-		"TIOCPTYGNAME",
-		"TIOCPTYGRANT",
-		"TIOCPTYUNLK",
-		"TIOCRCVFRAME",
-		"TIOCREMOTE",
-		"TIOCSBRK",
-		"TIOCSCONS",
-		"TIOCSCTTY",
-		"TIOCSDRAINWAIT",
-		"TIOCSDTR",
-		"TIOCSERCONFIG",
-		"TIOCSERGETLSR",
-		"TIOCSERGETMULTI",
-		"TIOCSERGSTRUCT",
-		"TIOCSERGWILD",
-		"TIOCSERSETMULTI",
-		"TIOCSERSWILD",
-		"TIOCSER_TEMT",
-		"TIOCSETA",
-		"TIOCSETAF",
-		"TIOCSETAW",
-		"TIOCSETD",
-		"TIOCSFLAGS",
-		"TIOCSIG",
-		"TIOCSLCKTRMIOS",
-		"TIOCSLINED",
-		"TIOCSPGRP",
-		"TIOCSPTLCK",
-		"TIOCSQSIZE",
-		"TIOCSRS485",
-		"TIOCSSERIAL",
-		"TIOCSSIZE",
-		"TIOCSSOFTCAR",
-		"TIOCSTART",
-		"TIOCSTAT",
-		"TIOCSTI",
-		"TIOCSTOP",
-		"TIOCSTSTAMP",
-		"TIOCSWINSZ",
-		"TIOCTIMESTAMP",
-		"TIOCUCNTL",
-		"TIOCVHANGUP",
-		"TIOCXMTFRAME",
-		"TOKEN_ADJUST_DEFAULT",
-		"TOKEN_ADJUST_GROUPS",
-		"TOKEN_ADJUST_PRIVILEGES",
-		"TOKEN_ADJUST_SESSIONID",
-		"TOKEN_ALL_ACCESS",
-		"TOKEN_ASSIGN_PRIMARY",
-		"TOKEN_DUPLICATE",
-		"TOKEN_EXECUTE",
-		"TOKEN_IMPERSONATE",
-		"TOKEN_QUERY",
-		"TOKEN_QUERY_SOURCE",
-		"TOKEN_READ",
-		"TOKEN_WRITE",
-		"TOSTOP",
-		"TRUNCATE_EXISTING",
-		"TUNATTACHFILTER",
-		"TUNDETACHFILTER",
-		"TUNGETFEATURES",
-		"TUNGETIFF",
-		"TUNGETSNDBUF",
-		"TUNGETVNETHDRSZ",
-		"TUNSETDEBUG",
-		"TUNSETGROUP",
-		"TUNSETIFF",
-		"TUNSETLINK",
-		"TUNSETNOCSUM",
-		"TUNSETOFFLOAD",
-		"TUNSETOWNER",
-		"TUNSETPERSIST",
-		"TUNSETSNDBUF",
-		"TUNSETTXFILTER",
-		"TUNSETVNETHDRSZ",
-		"Tee",
-		"TerminateProcess",
-		"Termios",
-		"Tgkill",
-		"Time",
-		"Time_t",
-		"Times",
-		"Timespec",
-		"TimespecToNsec",
-		"Timeval",
-		"Timeval32",
-		"TimevalToNsec",
-		"Timex",
-		"Timezoneinformation",
-		"Tms",
-		"Token",
-		"TokenAccessInformation",
-		"TokenAuditPolicy",
-		"TokenDefaultDacl",
-		"TokenElevation",
-		"TokenElevationType",
-		"TokenGroups",
-		"TokenGroupsAndPrivileges",
-		"TokenHasRestrictions",
-		"TokenImpersonationLevel",
-		"TokenIntegrityLevel",
-		"TokenLinkedToken",
-		"TokenLogonSid",
-		"TokenMandatoryPolicy",
-		"TokenOrigin",
-		"TokenOwner",
-		"TokenPrimaryGroup",
-		"TokenPrivileges",
-		"TokenRestrictedSids",
-		"TokenSandBoxInert",
-		"TokenSessionId",
-		"TokenSessionReference",
-		"TokenSource",
-		"TokenStatistics",
-		"TokenType",
-		"TokenUIAccess",
-		"TokenUser",
-		"TokenVirtualizationAllowed",
-		"TokenVirtualizationEnabled",
-		"Tokenprimarygroup",
-		"Tokenuser",
-		"TranslateAccountName",
-		"TranslateName",
-		"TransmitFile",
-		"TransmitFileBuffers",
-		"Truncate",
-		"UNIX_PATH_MAX",
-		"USAGE_MATCH_TYPE_AND",
-		"USAGE_MATCH_TYPE_OR",
-		"UTF16FromString",
-		"UTF16PtrFromString",
-		"UTF16ToString",
-		"Ucred",
-		"Umask",
-		"Uname",
-		"Undelete",
-		"UnixCredentials",
-		"UnixRights",
-		"Unlink",
-		"Unlinkat",
-		"UnmapViewOfFile",
-		"Unmount",
-		"Unsetenv",
-		"Unshare",
-		"UserInfo10",
-		"Ustat",
-		"Ustat_t",
-		"Utimbuf",
-		"Utime",
-		"Utimes",
-		"UtimesNano",
-		"Utsname",
-		"VDISCARD",
-		"VDSUSP",
-		"VEOF",
-		"VEOL",
-		"VEOL2",
-		"VERASE",
-		"VERASE2",
-		"VINTR",
-		"VKILL",
-		"VLNEXT",
-		"VMIN",
-		"VQUIT",
-		"VREPRINT",
-		"VSTART",
-		"VSTATUS",
-		"VSTOP",
-		"VSUSP",
-		"VSWTC",
-		"VT0",
-		"VT1",
-		"VTDLY",
-		"VTIME",
-		"VWERASE",
-		"VirtualLock",
-		"VirtualUnlock",
-		"WAIT_ABANDONED",
-		"WAIT_FAILED",
-		"WAIT_OBJECT_0",
-		"WAIT_TIMEOUT",
-		"WALL",
-		"WALLSIG",
-		"WALTSIG",
-		"WCLONE",
-		"WCONTINUED",
-		"WCOREFLAG",
-		"WEXITED",
-		"WLINUXCLONE",
-		"WNOHANG",
-		"WNOTHREAD",
-		"WNOWAIT",
-		"WNOZOMBIE",
-		"WOPTSCHECKED",
-		"WORDSIZE",
-		"WSABuf",
-		"WSACleanup",
-		"WSADESCRIPTION_LEN",
-		"WSAData",
-		"WSAEACCES",
-		"WSAECONNABORTED",
-		"WSAECONNRESET",
-		"WSAEnumProtocols",
-		"WSAID_CONNECTEX",
-		"WSAIoctl",
-		"WSAPROTOCOL_LEN",
-		"WSAProtocolChain",
-		"WSAProtocolInfo",
-		"WSARecv",
-		"WSARecvFrom",
-		"WSASYS_STATUS_LEN",
-		"WSASend",
-		"WSASendTo",
-		"WSASendto",
-		"WSAStartup",
-		"WSTOPPED",
-		"WTRAPPED",
-		"WUNTRACED",
-		"Wait4",
-		"WaitForSingleObject",
-		"WaitStatus",
-		"Win32FileAttributeData",
-		"Win32finddata",
-		"Write",
-		"WriteConsole",
-		"WriteFile",
-		"X509_ASN_ENCODING",
-		"XCASE",
-		"XP1_CONNECTIONLESS",
-		"XP1_CONNECT_DATA",
-		"XP1_DISCONNECT_DATA",
-		"XP1_EXPEDITED_DATA",
-		"XP1_GRACEFUL_CLOSE",
-		"XP1_GUARANTEED_DELIVERY",
-		"XP1_GUARANTEED_ORDER",
-		"XP1_IFS_HANDLES",
-		"XP1_MESSAGE_ORIENTED",
-		"XP1_MULTIPOINT_CONTROL_PLANE",
-		"XP1_MULTIPOINT_DATA_PLANE",
-		"XP1_PARTIAL_MESSAGE",
-		"XP1_PSEUDO_STREAM",
-		"XP1_QOS_SUPPORTED",
-		"XP1_SAN_SUPPORT_SDP",
-		"XP1_SUPPORT_BROADCAST",
-		"XP1_SUPPORT_MULTIPOINT",
-		"XP1_UNI_RECV",
-		"XP1_UNI_SEND",
-	},
-	"syscall/js": {
-		"CopyBytesToGo",
-		"CopyBytesToJS",
-		"Error",
-		"Func",
-		"FuncOf",
-		"Global",
-		"Null",
-		"Type",
-		"TypeBoolean",
-		"TypeFunction",
-		"TypeNull",
-		"TypeNumber",
-		"TypeObject",
-		"TypeString",
-		"TypeSymbol",
-		"TypeUndefined",
-		"Undefined",
-		"Value",
-		"ValueError",
-		"ValueOf",
-	},
-	"testing": {
-		"AllocsPerRun",
-		"B",
-		"Benchmark",
-		"BenchmarkResult",
-		"Cover",
-		"CoverBlock",
-		"CoverMode",
-		"Coverage",
-		"F",
-		"Init",
-		"InternalBenchmark",
-		"InternalExample",
-		"InternalFuzzTarget",
-		"InternalTest",
-		"M",
-		"Main",
-		"MainStart",
-		"PB",
-		"RegisterCover",
-		"RunBenchmarks",
-		"RunExamples",
-		"RunTests",
-		"Short",
-		"T",
-		"TB",
-		"Verbose",
-	},
-	"testing/fstest": {
-		"MapFS",
-		"MapFile",
-		"TestFS",
-	},
-	"testing/iotest": {
-		"DataErrReader",
-		"ErrReader",
-		"ErrTimeout",
-		"HalfReader",
-		"NewReadLogger",
-		"NewWriteLogger",
-		"OneByteReader",
-		"TestReader",
-		"TimeoutReader",
-		"TruncateWriter",
-	},
-	"testing/quick": {
-		"Check",
-		"CheckEqual",
-		"CheckEqualError",
-		"CheckError",
-		"Config",
-		"Generator",
-		"SetupError",
-		"Value",
-	},
-	"text/scanner": {
-		"Char",
-		"Comment",
-		"EOF",
-		"Float",
-		"GoTokens",
-		"GoWhitespace",
-		"Ident",
-		"Int",
-		"Position",
-		"RawString",
-		"ScanChars",
-		"ScanComments",
-		"ScanFloats",
-		"ScanIdents",
-		"ScanInts",
-		"ScanRawStrings",
-		"ScanStrings",
-		"Scanner",
-		"SkipComments",
-		"String",
-		"TokenString",
-	},
-	"text/tabwriter": {
-		"AlignRight",
-		"Debug",
-		"DiscardEmptyColumns",
-		"Escape",
-		"FilterHTML",
-		"NewWriter",
-		"StripEscape",
-		"TabIndent",
-		"Writer",
-	},
-	"text/template": {
-		"ExecError",
-		"FuncMap",
-		"HTMLEscape",
-		"HTMLEscapeString",
-		"HTMLEscaper",
-		"IsTrue",
-		"JSEscape",
-		"JSEscapeString",
-		"JSEscaper",
-		"Must",
-		"New",
-		"ParseFS",
-		"ParseFiles",
-		"ParseGlob",
-		"Template",
-		"URLQueryEscaper",
-	},
-	"text/template/parse": {
-		"ActionNode",
-		"BoolNode",
-		"BranchNode",
-		"BreakNode",
-		"ChainNode",
-		"CommandNode",
-		"CommentNode",
-		"ContinueNode",
-		"DotNode",
-		"FieldNode",
-		"IdentifierNode",
-		"IfNode",
-		"IsEmptyTree",
-		"ListNode",
-		"Mode",
-		"New",
-		"NewIdentifier",
-		"NilNode",
-		"Node",
-		"NodeAction",
-		"NodeBool",
-		"NodeBreak",
-		"NodeChain",
-		"NodeCommand",
-		"NodeComment",
-		"NodeContinue",
-		"NodeDot",
-		"NodeField",
-		"NodeIdentifier",
-		"NodeIf",
-		"NodeList",
-		"NodeNil",
-		"NodeNumber",
-		"NodePipe",
-		"NodeRange",
-		"NodeString",
-		"NodeTemplate",
-		"NodeText",
-		"NodeType",
-		"NodeVariable",
-		"NodeWith",
-		"NumberNode",
-		"Parse",
-		"ParseComments",
-		"PipeNode",
-		"Pos",
-		"RangeNode",
-		"SkipFuncCheck",
-		"StringNode",
-		"TemplateNode",
-		"TextNode",
-		"Tree",
-		"VariableNode",
-		"WithNode",
-	},
-	"time": {
-		"ANSIC",
-		"After",
-		"AfterFunc",
-		"April",
-		"August",
-		"Date",
-		"DateOnly",
-		"DateTime",
-		"December",
-		"Duration",
-		"February",
-		"FixedZone",
-		"Friday",
-		"Hour",
-		"January",
-		"July",
-		"June",
-		"Kitchen",
-		"Layout",
-		"LoadLocation",
-		"LoadLocationFromTZData",
-		"Local",
-		"Location",
-		"March",
-		"May",
-		"Microsecond",
-		"Millisecond",
-		"Minute",
-		"Monday",
-		"Month",
-		"Nanosecond",
-		"NewTicker",
-		"NewTimer",
-		"November",
-		"Now",
-		"October",
-		"Parse",
-		"ParseDuration",
-		"ParseError",
-		"ParseInLocation",
-		"RFC1123",
-		"RFC1123Z",
-		"RFC3339",
-		"RFC3339Nano",
-		"RFC822",
-		"RFC822Z",
-		"RFC850",
-		"RubyDate",
-		"Saturday",
-		"Second",
-		"September",
-		"Since",
-		"Sleep",
-		"Stamp",
-		"StampMicro",
-		"StampMilli",
-		"StampNano",
-		"Sunday",
-		"Thursday",
-		"Tick",
-		"Ticker",
-		"Time",
-		"TimeOnly",
-		"Timer",
-		"Tuesday",
-		"UTC",
-		"Unix",
-		"UnixDate",
-		"UnixMicro",
-		"UnixMilli",
-		"Until",
-		"Wednesday",
-		"Weekday",
-	},
-	"unicode": {
-		"ASCII_Hex_Digit",
-		"Adlam",
-		"Ahom",
-		"Anatolian_Hieroglyphs",
-		"Arabic",
-		"Armenian",
-		"Avestan",
-		"AzeriCase",
-		"Balinese",
-		"Bamum",
-		"Bassa_Vah",
-		"Batak",
-		"Bengali",
-		"Bhaiksuki",
-		"Bidi_Control",
-		"Bopomofo",
-		"Brahmi",
-		"Braille",
-		"Buginese",
-		"Buhid",
-		"C",
-		"Canadian_Aboriginal",
-		"Carian",
-		"CaseRange",
-		"CaseRanges",
-		"Categories",
-		"Caucasian_Albanian",
-		"Cc",
-		"Cf",
-		"Chakma",
-		"Cham",
-		"Cherokee",
-		"Chorasmian",
-		"Co",
-		"Common",
-		"Coptic",
-		"Cs",
-		"Cuneiform",
-		"Cypriot",
-		"Cyrillic",
-		"Dash",
-		"Deprecated",
-		"Deseret",
-		"Devanagari",
-		"Diacritic",
-		"Digit",
-		"Dives_Akuru",
-		"Dogra",
-		"Duployan",
-		"Egyptian_Hieroglyphs",
-		"Elbasan",
-		"Elymaic",
-		"Ethiopic",
-		"Extender",
-		"FoldCategory",
-		"FoldScript",
-		"Georgian",
-		"Glagolitic",
-		"Gothic",
-		"Grantha",
-		"GraphicRanges",
-		"Greek",
-		"Gujarati",
-		"Gunjala_Gondi",
-		"Gurmukhi",
-		"Han",
-		"Hangul",
-		"Hanifi_Rohingya",
-		"Hanunoo",
-		"Hatran",
-		"Hebrew",
-		"Hex_Digit",
-		"Hiragana",
-		"Hyphen",
-		"IDS_Binary_Operator",
-		"IDS_Trinary_Operator",
-		"Ideographic",
-		"Imperial_Aramaic",
-		"In",
-		"Inherited",
-		"Inscriptional_Pahlavi",
-		"Inscriptional_Parthian",
-		"Is",
-		"IsControl",
-		"IsDigit",
-		"IsGraphic",
-		"IsLetter",
-		"IsLower",
-		"IsMark",
-		"IsNumber",
-		"IsOneOf",
-		"IsPrint",
-		"IsPunct",
-		"IsSpace",
-		"IsSymbol",
-		"IsTitle",
-		"IsUpper",
-		"Javanese",
-		"Join_Control",
-		"Kaithi",
-		"Kannada",
-		"Katakana",
-		"Kayah_Li",
-		"Kharoshthi",
-		"Khitan_Small_Script",
-		"Khmer",
-		"Khojki",
-		"Khudawadi",
-		"L",
-		"Lao",
-		"Latin",
-		"Lepcha",
-		"Letter",
-		"Limbu",
-		"Linear_A",
-		"Linear_B",
-		"Lisu",
-		"Ll",
-		"Lm",
-		"Lo",
-		"Logical_Order_Exception",
-		"Lower",
-		"LowerCase",
-		"Lt",
-		"Lu",
-		"Lycian",
-		"Lydian",
-		"M",
-		"Mahajani",
-		"Makasar",
-		"Malayalam",
-		"Mandaic",
-		"Manichaean",
-		"Marchen",
-		"Mark",
-		"Masaram_Gondi",
-		"MaxASCII",
-		"MaxCase",
-		"MaxLatin1",
-		"MaxRune",
-		"Mc",
-		"Me",
-		"Medefaidrin",
-		"Meetei_Mayek",
-		"Mende_Kikakui",
-		"Meroitic_Cursive",
-		"Meroitic_Hieroglyphs",
-		"Miao",
-		"Mn",
-		"Modi",
-		"Mongolian",
-		"Mro",
-		"Multani",
-		"Myanmar",
-		"N",
-		"Nabataean",
-		"Nandinagari",
-		"Nd",
-		"New_Tai_Lue",
-		"Newa",
-		"Nko",
-		"Nl",
-		"No",
-		"Noncharacter_Code_Point",
-		"Number",
-		"Nushu",
-		"Nyiakeng_Puachue_Hmong",
-		"Ogham",
-		"Ol_Chiki",
-		"Old_Hungarian",
-		"Old_Italic",
-		"Old_North_Arabian",
-		"Old_Permic",
-		"Old_Persian",
-		"Old_Sogdian",
-		"Old_South_Arabian",
-		"Old_Turkic",
-		"Oriya",
-		"Osage",
-		"Osmanya",
-		"Other",
-		"Other_Alphabetic",
-		"Other_Default_Ignorable_Code_Point",
-		"Other_Grapheme_Extend",
-		"Other_ID_Continue",
-		"Other_ID_Start",
-		"Other_Lowercase",
-		"Other_Math",
-		"Other_Uppercase",
-		"P",
-		"Pahawh_Hmong",
-		"Palmyrene",
-		"Pattern_Syntax",
-		"Pattern_White_Space",
-		"Pau_Cin_Hau",
-		"Pc",
-		"Pd",
-		"Pe",
-		"Pf",
-		"Phags_Pa",
-		"Phoenician",
-		"Pi",
-		"Po",
-		"Prepended_Concatenation_Mark",
-		"PrintRanges",
-		"Properties",
-		"Ps",
-		"Psalter_Pahlavi",
-		"Punct",
-		"Quotation_Mark",
-		"Radical",
-		"Range16",
-		"Range32",
-		"RangeTable",
-		"Regional_Indicator",
-		"Rejang",
-		"ReplacementChar",
-		"Runic",
-		"S",
-		"STerm",
-		"Samaritan",
-		"Saurashtra",
-		"Sc",
-		"Scripts",
-		"Sentence_Terminal",
-		"Sharada",
-		"Shavian",
-		"Siddham",
-		"SignWriting",
-		"SimpleFold",
-		"Sinhala",
-		"Sk",
-		"Sm",
-		"So",
-		"Soft_Dotted",
-		"Sogdian",
-		"Sora_Sompeng",
-		"Soyombo",
-		"Space",
-		"SpecialCase",
-		"Sundanese",
-		"Syloti_Nagri",
-		"Symbol",
-		"Syriac",
-		"Tagalog",
-		"Tagbanwa",
-		"Tai_Le",
-		"Tai_Tham",
-		"Tai_Viet",
-		"Takri",
-		"Tamil",
-		"Tangut",
-		"Telugu",
-		"Terminal_Punctuation",
-		"Thaana",
-		"Thai",
-		"Tibetan",
-		"Tifinagh",
-		"Tirhuta",
-		"Title",
-		"TitleCase",
-		"To",
-		"ToLower",
-		"ToTitle",
-		"ToUpper",
-		"TurkishCase",
-		"Ugaritic",
-		"Unified_Ideograph",
-		"Upper",
-		"UpperCase",
-		"UpperLower",
-		"Vai",
-		"Variation_Selector",
-		"Version",
-		"Wancho",
-		"Warang_Citi",
-		"White_Space",
-		"Yezidi",
-		"Yi",
-		"Z",
-		"Zanabazar_Square",
-		"Zl",
-		"Zp",
-		"Zs",
-	},
-	"unicode/utf16": {
-		"AppendRune",
-		"Decode",
-		"DecodeRune",
-		"Encode",
-		"EncodeRune",
-		"IsSurrogate",
-	},
-	"unicode/utf8": {
-		"AppendRune",
-		"DecodeLastRune",
-		"DecodeLastRuneInString",
-		"DecodeRune",
-		"DecodeRuneInString",
-		"EncodeRune",
-		"FullRune",
-		"FullRuneInString",
-		"MaxRune",
-		"RuneCount",
-		"RuneCountInString",
-		"RuneError",
-		"RuneLen",
-		"RuneSelf",
-		"RuneStart",
-		"UTFMax",
-		"Valid",
-		"ValidRune",
-		"ValidString",
-	},
-	"unsafe": {
-		"Add",
-		"Alignof",
-		"Offsetof",
-		"Pointer",
-		"Sizeof",
-		"Slice",
-		"SliceData",
-		"String",
-		"StringData",
-	},
-}
diff --git a/vendor/golang.org/x/tools/internal/stdlib/manifest.go b/vendor/golang.org/x/tools/internal/stdlib/manifest.go
new file mode 100644
index 000000000..fd6892075
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/stdlib/manifest.go
@@ -0,0 +1,17320 @@
+// Copyright 2024 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Code generated by generate.go. DO NOT EDIT.
+
+package stdlib
+
+var PackageSymbols = map[string][]Symbol{
+	"archive/tar": {
+		{"(*Header).FileInfo", Method, 1},
+		{"(*Reader).Next", Method, 0},
+		{"(*Reader).Read", Method, 0},
+		{"(*Writer).AddFS", Method, 22},
+		{"(*Writer).Close", Method, 0},
+		{"(*Writer).Flush", Method, 0},
+		{"(*Writer).Write", Method, 0},
+		{"(*Writer).WriteHeader", Method, 0},
+		{"(Format).String", Method, 10},
+		{"ErrFieldTooLong", Var, 0},
+		{"ErrHeader", Var, 0},
+		{"ErrInsecurePath", Var, 20},
+		{"ErrWriteAfterClose", Var, 0},
+		{"ErrWriteTooLong", Var, 0},
+		{"FileInfoHeader", Func, 1},
+		{"Format", Type, 10},
+		{"FormatGNU", Const, 10},
+		{"FormatPAX", Const, 10},
+		{"FormatUSTAR", Const, 10},
+		{"FormatUnknown", Const, 10},
+		{"Header", Type, 0},
+		{"Header.AccessTime", Field, 0},
+		{"Header.ChangeTime", Field, 0},
+		{"Header.Devmajor", Field, 0},
+		{"Header.Devminor", Field, 0},
+		{"Header.Format", Field, 10},
+		{"Header.Gid", Field, 0},
+		{"Header.Gname", Field, 0},
+		{"Header.Linkname", Field, 0},
+		{"Header.ModTime", Field, 0},
+		{"Header.Mode", Field, 0},
+		{"Header.Name", Field, 0},
+		{"Header.PAXRecords", Field, 10},
+		{"Header.Size", Field, 0},
+		{"Header.Typeflag", Field, 0},
+		{"Header.Uid", Field, 0},
+		{"Header.Uname", Field, 0},
+		{"Header.Xattrs", Field, 3},
+		{"NewReader", Func, 0},
+		{"NewWriter", Func, 0},
+		{"Reader", Type, 0},
+		{"TypeBlock", Const, 0},
+		{"TypeChar", Const, 0},
+		{"TypeCont", Const, 0},
+		{"TypeDir", Const, 0},
+		{"TypeFifo", Const, 0},
+		{"TypeGNULongLink", Const, 1},
+		{"TypeGNULongName", Const, 1},
+		{"TypeGNUSparse", Const, 3},
+		{"TypeLink", Const, 0},
+		{"TypeReg", Const, 0},
+		{"TypeRegA", Const, 0},
+		{"TypeSymlink", Const, 0},
+		{"TypeXGlobalHeader", Const, 0},
+		{"TypeXHeader", Const, 0},
+		{"Writer", Type, 0},
+	},
+	"archive/zip": {
+		{"(*File).DataOffset", Method, 2},
+		{"(*File).FileInfo", Method, 0},
+		{"(*File).ModTime", Method, 0},
+		{"(*File).Mode", Method, 0},
+		{"(*File).Open", Method, 0},
+		{"(*File).OpenRaw", Method, 17},
+		{"(*File).SetModTime", Method, 0},
+		{"(*File).SetMode", Method, 0},
+		{"(*FileHeader).FileInfo", Method, 0},
+		{"(*FileHeader).ModTime", Method, 0},
+		{"(*FileHeader).Mode", Method, 0},
+		{"(*FileHeader).SetModTime", Method, 0},
+		{"(*FileHeader).SetMode", Method, 0},
+		{"(*ReadCloser).Close", Method, 0},
+		{"(*ReadCloser).Open", Method, 16},
+		{"(*ReadCloser).RegisterDecompressor", Method, 6},
+		{"(*Reader).Open", Method, 16},
+		{"(*Reader).RegisterDecompressor", Method, 6},
+		{"(*Writer).AddFS", Method, 22},
+		{"(*Writer).Close", Method, 0},
+		{"(*Writer).Copy", Method, 17},
+		{"(*Writer).Create", Method, 0},
+		{"(*Writer).CreateHeader", Method, 0},
+		{"(*Writer).CreateRaw", Method, 17},
+		{"(*Writer).Flush", Method, 4},
+		{"(*Writer).RegisterCompressor", Method, 6},
+		{"(*Writer).SetComment", Method, 10},
+		{"(*Writer).SetOffset", Method, 5},
+		{"Compressor", Type, 2},
+		{"Decompressor", Type, 2},
+		{"Deflate", Const, 0},
+		{"ErrAlgorithm", Var, 0},
+		{"ErrChecksum", Var, 0},
+		{"ErrFormat", Var, 0},
+		{"ErrInsecurePath", Var, 20},
+		{"File", Type, 0},
+		{"File.FileHeader", Field, 0},
+		{"FileHeader", Type, 0},
+		{"FileHeader.CRC32", Field, 0},
+		{"FileHeader.Comment", Field, 0},
+		{"FileHeader.CompressedSize", Field, 0},
+		{"FileHeader.CompressedSize64", Field, 1},
+		{"FileHeader.CreatorVersion", Field, 0},
+		{"FileHeader.ExternalAttrs", Field, 0},
+		{"FileHeader.Extra", Field, 0},
+		{"FileHeader.Flags", Field, 0},
+		{"FileHeader.Method", Field, 0},
+		{"FileHeader.Modified", Field, 10},
+		{"FileHeader.ModifiedDate", Field, 0},
+		{"FileHeader.ModifiedTime", Field, 0},
+		{"FileHeader.Name", Field, 0},
+		{"FileHeader.NonUTF8", Field, 10},
+		{"FileHeader.ReaderVersion", Field, 0},
+		{"FileHeader.UncompressedSize", Field, 0},
+		{"FileHeader.UncompressedSize64", Field, 1},
+		{"FileInfoHeader", Func, 0},
+		{"NewReader", Func, 0},
+		{"NewWriter", Func, 0},
+		{"OpenReader", Func, 0},
+		{"ReadCloser", Type, 0},
+		{"ReadCloser.Reader", Field, 0},
+		{"Reader", Type, 0},
+		{"Reader.Comment", Field, 0},
+		{"Reader.File", Field, 0},
+		{"RegisterCompressor", Func, 2},
+		{"RegisterDecompressor", Func, 2},
+		{"Store", Const, 0},
+		{"Writer", Type, 0},
+	},
+	"bufio": {
+		{"(*Reader).Buffered", Method, 0},
+		{"(*Reader).Discard", Method, 5},
+		{"(*Reader).Peek", Method, 0},
+		{"(*Reader).Read", Method, 0},
+		{"(*Reader).ReadByte", Method, 0},
+		{"(*Reader).ReadBytes", Method, 0},
+		{"(*Reader).ReadLine", Method, 0},
+		{"(*Reader).ReadRune", Method, 0},
+		{"(*Reader).ReadSlice", Method, 0},
+		{"(*Reader).ReadString", Method, 0},
+		{"(*Reader).Reset", Method, 2},
+		{"(*Reader).Size", Method, 10},
+		{"(*Reader).UnreadByte", Method, 0},
+		{"(*Reader).UnreadRune", Method, 0},
+		{"(*Reader).WriteTo", Method, 1},
+		{"(*Scanner).Buffer", Method, 6},
+		{"(*Scanner).Bytes", Method, 1},
+		{"(*Scanner).Err", Method, 1},
+		{"(*Scanner).Scan", Method, 1},
+		{"(*Scanner).Split", Method, 1},
+		{"(*Scanner).Text", Method, 1},
+		{"(*Writer).Available", Method, 0},
+		{"(*Writer).AvailableBuffer", Method, 18},
+		{"(*Writer).Buffered", Method, 0},
+		{"(*Writer).Flush", Method, 0},
+		{"(*Writer).ReadFrom", Method, 1},
+		{"(*Writer).Reset", Method, 2},
+		{"(*Writer).Size", Method, 10},
+		{"(*Writer).Write", Method, 0},
+		{"(*Writer).WriteByte", Method, 0},
+		{"(*Writer).WriteRune", Method, 0},
+		{"(*Writer).WriteString", Method, 0},
+		{"(ReadWriter).Available", Method, 0},
+		{"(ReadWriter).AvailableBuffer", Method, 18},
+		{"(ReadWriter).Discard", Method, 5},
+		{"(ReadWriter).Flush", Method, 0},
+		{"(ReadWriter).Peek", Method, 0},
+		{"(ReadWriter).Read", Method, 0},
+		{"(ReadWriter).ReadByte", Method, 0},
+		{"(ReadWriter).ReadBytes", Method, 0},
+		{"(ReadWriter).ReadFrom", Method, 1},
+		{"(ReadWriter).ReadLine", Method, 0},
+		{"(ReadWriter).ReadRune", Method, 0},
+		{"(ReadWriter).ReadSlice", Method, 0},
+		{"(ReadWriter).ReadString", Method, 0},
+		{"(ReadWriter).UnreadByte", Method, 0},
+		{"(ReadWriter).UnreadRune", Method, 0},
+		{"(ReadWriter).Write", Method, 0},
+		{"(ReadWriter).WriteByte", Method, 0},
+		{"(ReadWriter).WriteRune", Method, 0},
+		{"(ReadWriter).WriteString", Method, 0},
+		{"(ReadWriter).WriteTo", Method, 1},
+		{"ErrAdvanceTooFar", Var, 1},
+		{"ErrBadReadCount", Var, 15},
+		{"ErrBufferFull", Var, 0},
+		{"ErrFinalToken", Var, 6},
+		{"ErrInvalidUnreadByte", Var, 0},
+		{"ErrInvalidUnreadRune", Var, 0},
+		{"ErrNegativeAdvance", Var, 1},
+		{"ErrNegativeCount", Var, 0},
+		{"ErrTooLong", Var, 1},
+		{"MaxScanTokenSize", Const, 1},
+		{"NewReadWriter", Func, 0},
+		{"NewReader", Func, 0},
+		{"NewReaderSize", Func, 0},
+		{"NewScanner", Func, 1},
+		{"NewWriter", Func, 0},
+		{"NewWriterSize", Func, 0},
+		{"ReadWriter", Type, 0},
+		{"ReadWriter.Reader", Field, 0},
+		{"ReadWriter.Writer", Field, 0},
+		{"Reader", Type, 0},
+		{"ScanBytes", Func, 1},
+		{"ScanLines", Func, 1},
+		{"ScanRunes", Func, 1},
+		{"ScanWords", Func, 1},
+		{"Scanner", Type, 1},
+		{"SplitFunc", Type, 1},
+		{"Writer", Type, 0},
+	},
+	"bytes": {
+		{"(*Buffer).Available", Method, 21},
+		{"(*Buffer).AvailableBuffer", Method, 21},
+		{"(*Buffer).Bytes", Method, 0},
+		{"(*Buffer).Cap", Method, 5},
+		{"(*Buffer).Grow", Method, 1},
+		{"(*Buffer).Len", Method, 0},
+		{"(*Buffer).Next", Method, 0},
+		{"(*Buffer).Read", Method, 0},
+		{"(*Buffer).ReadByte", Method, 0},
+		{"(*Buffer).ReadBytes", Method, 0},
+		{"(*Buffer).ReadFrom", Method, 0},
+		{"(*Buffer).ReadRune", Method, 0},
+		{"(*Buffer).ReadString", Method, 0},
+		{"(*Buffer).Reset", Method, 0},
+		{"(*Buffer).String", Method, 0},
+		{"(*Buffer).Truncate", Method, 0},
+		{"(*Buffer).UnreadByte", Method, 0},
+		{"(*Buffer).UnreadRune", Method, 0},
+		{"(*Buffer).Write", Method, 0},
+		{"(*Buffer).WriteByte", Method, 0},
+		{"(*Buffer).WriteRune", Method, 0},
+		{"(*Buffer).WriteString", Method, 0},
+		{"(*Buffer).WriteTo", Method, 0},
+		{"(*Reader).Len", Method, 0},
+		{"(*Reader).Read", Method, 0},
+		{"(*Reader).ReadAt", Method, 0},
+		{"(*Reader).ReadByte", Method, 0},
+		{"(*Reader).ReadRune", Method, 0},
+		{"(*Reader).Reset", Method, 7},
+		{"(*Reader).Seek", Method, 0},
+		{"(*Reader).Size", Method, 5},
+		{"(*Reader).UnreadByte", Method, 0},
+		{"(*Reader).UnreadRune", Method, 0},
+		{"(*Reader).WriteTo", Method, 1},
+		{"Buffer", Type, 0},
+		{"Clone", Func, 20},
+		{"Compare", Func, 0},
+		{"Contains", Func, 0},
+		{"ContainsAny", Func, 7},
+		{"ContainsFunc", Func, 21},
+		{"ContainsRune", Func, 7},
+		{"Count", Func, 0},
+		{"Cut", Func, 18},
+		{"CutPrefix", Func, 20},
+		{"CutSuffix", Func, 20},
+		{"Equal", Func, 0},
+		{"EqualFold", Func, 0},
+		{"ErrTooLarge", Var, 0},
+		{"Fields", Func, 0},
+		{"FieldsFunc", Func, 0},
+		{"HasPrefix", Func, 0},
+		{"HasSuffix", Func, 0},
+		{"Index", Func, 0},
+		{"IndexAny", Func, 0},
+		{"IndexByte", Func, 0},
+		{"IndexFunc", Func, 0},
+		{"IndexRune", Func, 0},
+		{"Join", Func, 0},
+		{"LastIndex", Func, 0},
+		{"LastIndexAny", Func, 0},
+		{"LastIndexByte", Func, 5},
+		{"LastIndexFunc", Func, 0},
+		{"Map", Func, 0},
+		{"MinRead", Const, 0},
+		{"NewBuffer", Func, 0},
+		{"NewBufferString", Func, 0},
+		{"NewReader", Func, 0},
+		{"Reader", Type, 0},
+		{"Repeat", Func, 0},
+		{"Replace", Func, 0},
+		{"ReplaceAll", Func, 12},
+		{"Runes", Func, 0},
+		{"Split", Func, 0},
+		{"SplitAfter", Func, 0},
+		{"SplitAfterN", Func, 0},
+		{"SplitN", Func, 0},
+		{"Title", Func, 0},
+		{"ToLower", Func, 0},
+		{"ToLowerSpecial", Func, 0},
+		{"ToTitle", Func, 0},
+		{"ToTitleSpecial", Func, 0},
+		{"ToUpper", Func, 0},
+		{"ToUpperSpecial", Func, 0},
+		{"ToValidUTF8", Func, 13},
+		{"Trim", Func, 0},
+		{"TrimFunc", Func, 0},
+		{"TrimLeft", Func, 0},
+		{"TrimLeftFunc", Func, 0},
+		{"TrimPrefix", Func, 1},
+		{"TrimRight", Func, 0},
+		{"TrimRightFunc", Func, 0},
+		{"TrimSpace", Func, 0},
+		{"TrimSuffix", Func, 1},
+	},
+	"cmp": {
+		{"Compare", Func, 21},
+		{"Less", Func, 21},
+		{"Or", Func, 22},
+		{"Ordered", Type, 21},
+	},
+	"compress/bzip2": {
+		{"(StructuralError).Error", Method, 0},
+		{"NewReader", Func, 0},
+		{"StructuralError", Type, 0},
+	},
+	"compress/flate": {
+		{"(*ReadError).Error", Method, 0},
+		{"(*WriteError).Error", Method, 0},
+		{"(*Writer).Close", Method, 0},
+		{"(*Writer).Flush", Method, 0},
+		{"(*Writer).Reset", Method, 2},
+		{"(*Writer).Write", Method, 0},
+		{"(CorruptInputError).Error", Method, 0},
+		{"(InternalError).Error", Method, 0},
+		{"BestCompression", Const, 0},
+		{"BestSpeed", Const, 0},
+		{"CorruptInputError", Type, 0},
+		{"DefaultCompression", Const, 0},
+		{"HuffmanOnly", Const, 7},
+		{"InternalError", Type, 0},
+		{"NewReader", Func, 0},
+		{"NewReaderDict", Func, 0},
+		{"NewWriter", Func, 0},
+		{"NewWriterDict", Func, 0},
+		{"NoCompression", Const, 0},
+		{"ReadError", Type, 0},
+		{"ReadError.Err", Field, 0},
+		{"ReadError.Offset", Field, 0},
+		{"Reader", Type, 0},
+		{"Resetter", Type, 4},
+		{"WriteError", Type, 0},
+		{"WriteError.Err", Field, 0},
+		{"WriteError.Offset", Field, 0},
+		{"Writer", Type, 0},
+	},
+	"compress/gzip": {
+		{"(*Reader).Close", Method, 0},
+		{"(*Reader).Multistream", Method, 4},
+		{"(*Reader).Read", Method, 0},
+		{"(*Reader).Reset", Method, 3},
+		{"(*Writer).Close", Method, 0},
+		{"(*Writer).Flush", Method, 1},
+		{"(*Writer).Reset", Method, 2},
+		{"(*Writer).Write", Method, 0},
+		{"BestCompression", Const, 0},
+		{"BestSpeed", Const, 0},
+		{"DefaultCompression", Const, 0},
+		{"ErrChecksum", Var, 0},
+		{"ErrHeader", Var, 0},
+		{"Header", Type, 0},
+		{"Header.Comment", Field, 0},
+		{"Header.Extra", Field, 0},
+		{"Header.ModTime", Field, 0},
+		{"Header.Name", Field, 0},
+		{"Header.OS", Field, 0},
+		{"HuffmanOnly", Const, 8},
+		{"NewReader", Func, 0},
+		{"NewWriter", Func, 0},
+		{"NewWriterLevel", Func, 0},
+		{"NoCompression", Const, 0},
+		{"Reader", Type, 0},
+		{"Reader.Header", Field, 0},
+		{"Writer", Type, 0},
+		{"Writer.Header", Field, 0},
+	},
+	"compress/lzw": {
+		{"(*Reader).Close", Method, 17},
+		{"(*Reader).Read", Method, 17},
+		{"(*Reader).Reset", Method, 17},
+		{"(*Writer).Close", Method, 17},
+		{"(*Writer).Reset", Method, 17},
+		{"(*Writer).Write", Method, 17},
+		{"LSB", Const, 0},
+		{"MSB", Const, 0},
+		{"NewReader", Func, 0},
+		{"NewWriter", Func, 0},
+		{"Order", Type, 0},
+		{"Reader", Type, 17},
+		{"Writer", Type, 17},
+	},
+	"compress/zlib": {
+		{"(*Writer).Close", Method, 0},
+		{"(*Writer).Flush", Method, 0},
+		{"(*Writer).Reset", Method, 2},
+		{"(*Writer).Write", Method, 0},
+		{"BestCompression", Const, 0},
+		{"BestSpeed", Const, 0},
+		{"DefaultCompression", Const, 0},
+		{"ErrChecksum", Var, 0},
+		{"ErrDictionary", Var, 0},
+		{"ErrHeader", Var, 0},
+		{"HuffmanOnly", Const, 8},
+		{"NewReader", Func, 0},
+		{"NewReaderDict", Func, 0},
+		{"NewWriter", Func, 0},
+		{"NewWriterLevel", Func, 0},
+		{"NewWriterLevelDict", Func, 0},
+		{"NoCompression", Const, 0},
+		{"Resetter", Type, 4},
+		{"Writer", Type, 0},
+	},
+	"container/heap": {
+		{"Fix", Func, 2},
+		{"Init", Func, 0},
+		{"Interface", Type, 0},
+		{"Pop", Func, 0},
+		{"Push", Func, 0},
+		{"Remove", Func, 0},
+	},
+	"container/list": {
+		{"(*Element).Next", Method, 0},
+		{"(*Element).Prev", Method, 0},
+		{"(*List).Back", Method, 0},
+		{"(*List).Front", Method, 0},
+		{"(*List).Init", Method, 0},
+		{"(*List).InsertAfter", Method, 0},
+		{"(*List).InsertBefore", Method, 0},
+		{"(*List).Len", Method, 0},
+		{"(*List).MoveAfter", Method, 2},
+		{"(*List).MoveBefore", Method, 2},
+		{"(*List).MoveToBack", Method, 0},
+		{"(*List).MoveToFront", Method, 0},
+		{"(*List).PushBack", Method, 0},
+		{"(*List).PushBackList", Method, 0},
+		{"(*List).PushFront", Method, 0},
+		{"(*List).PushFrontList", Method, 0},
+		{"(*List).Remove", Method, 0},
+		{"Element", Type, 0},
+		{"Element.Value", Field, 0},
+		{"List", Type, 0},
+		{"New", Func, 0},
+	},
+	"container/ring": {
+		{"(*Ring).Do", Method, 0},
+		{"(*Ring).Len", Method, 0},
+		{"(*Ring).Link", Method, 0},
+		{"(*Ring).Move", Method, 0},
+		{"(*Ring).Next", Method, 0},
+		{"(*Ring).Prev", Method, 0},
+		{"(*Ring).Unlink", Method, 0},
+		{"New", Func, 0},
+		{"Ring", Type, 0},
+		{"Ring.Value", Field, 0},
+	},
+	"context": {
+		{"AfterFunc", Func, 21},
+		{"Background", Func, 7},
+		{"CancelCauseFunc", Type, 20},
+		{"CancelFunc", Type, 7},
+		{"Canceled", Var, 7},
+		{"Cause", Func, 20},
+		{"Context", Type, 7},
+		{"DeadlineExceeded", Var, 7},
+		{"TODO", Func, 7},
+		{"WithCancel", Func, 7},
+		{"WithCancelCause", Func, 20},
+		{"WithDeadline", Func, 7},
+		{"WithDeadlineCause", Func, 21},
+		{"WithTimeout", Func, 7},
+		{"WithTimeoutCause", Func, 21},
+		{"WithValue", Func, 7},
+		{"WithoutCancel", Func, 21},
+	},
+	"crypto": {
+		{"(Hash).Available", Method, 0},
+		{"(Hash).HashFunc", Method, 4},
+		{"(Hash).New", Method, 0},
+		{"(Hash).Size", Method, 0},
+		{"(Hash).String", Method, 15},
+		{"BLAKE2b_256", Const, 9},
+		{"BLAKE2b_384", Const, 9},
+		{"BLAKE2b_512", Const, 9},
+		{"BLAKE2s_256", Const, 9},
+		{"Decrypter", Type, 5},
+		{"DecrypterOpts", Type, 5},
+		{"Hash", Type, 0},
+		{"MD4", Const, 0},
+		{"MD5", Const, 0},
+		{"MD5SHA1", Const, 0},
+		{"PrivateKey", Type, 0},
+		{"PublicKey", Type, 2},
+		{"RIPEMD160", Const, 0},
+		{"RegisterHash", Func, 0},
+		{"SHA1", Const, 0},
+		{"SHA224", Const, 0},
+		{"SHA256", Const, 0},
+		{"SHA384", Const, 0},
+		{"SHA3_224", Const, 4},
+		{"SHA3_256", Const, 4},
+		{"SHA3_384", Const, 4},
+		{"SHA3_512", Const, 4},
+		{"SHA512", Const, 0},
+		{"SHA512_224", Const, 5},
+		{"SHA512_256", Const, 5},
+		{"Signer", Type, 4},
+		{"SignerOpts", Type, 4},
+	},
+	"crypto/aes": {
+		{"(KeySizeError).Error", Method, 0},
+		{"BlockSize", Const, 0},
+		{"KeySizeError", Type, 0},
+		{"NewCipher", Func, 0},
+	},
+	"crypto/cipher": {
+		{"(StreamReader).Read", Method, 0},
+		{"(StreamWriter).Close", Method, 0},
+		{"(StreamWriter).Write", Method, 0},
+		{"AEAD", Type, 2},
+		{"Block", Type, 0},
+		{"BlockMode", Type, 0},
+		{"NewCBCDecrypter", Func, 0},
+		{"NewCBCEncrypter", Func, 0},
+		{"NewCFBDecrypter", Func, 0},
+		{"NewCFBEncrypter", Func, 0},
+		{"NewCTR", Func, 0},
+		{"NewGCM", Func, 2},
+		{"NewGCMWithNonceSize", Func, 5},
+		{"NewGCMWithTagSize", Func, 11},
+		{"NewOFB", Func, 0},
+		{"Stream", Type, 0},
+		{"StreamReader", Type, 0},
+		{"StreamReader.R", Field, 0},
+		{"StreamReader.S", Field, 0},
+		{"StreamWriter", Type, 0},
+		{"StreamWriter.Err", Field, 0},
+		{"StreamWriter.S", Field, 0},
+		{"StreamWriter.W", Field, 0},
+	},
+	"crypto/des": {
+		{"(KeySizeError).Error", Method, 0},
+		{"BlockSize", Const, 0},
+		{"KeySizeError", Type, 0},
+		{"NewCipher", Func, 0},
+		{"NewTripleDESCipher", Func, 0},
+	},
+	"crypto/dsa": {
+		{"ErrInvalidPublicKey", Var, 0},
+		{"GenerateKey", Func, 0},
+		{"GenerateParameters", Func, 0},
+		{"L1024N160", Const, 0},
+		{"L2048N224", Const, 0},
+		{"L2048N256", Const, 0},
+		{"L3072N256", Const, 0},
+		{"ParameterSizes", Type, 0},
+		{"Parameters", Type, 0},
+		{"Parameters.G", Field, 0},
+		{"Parameters.P", Field, 0},
+		{"Parameters.Q", Field, 0},
+		{"PrivateKey", Type, 0},
+		{"PrivateKey.PublicKey", Field, 0},
+		{"PrivateKey.X", Field, 0},
+		{"PublicKey", Type, 0},
+		{"PublicKey.Parameters", Field, 0},
+		{"PublicKey.Y", Field, 0},
+		{"Sign", Func, 0},
+		{"Verify", Func, 0},
+	},
+	"crypto/ecdh": {
+		{"(*PrivateKey).Bytes", Method, 20},
+		{"(*PrivateKey).Curve", Method, 20},
+		{"(*PrivateKey).ECDH", Method, 20},
+		{"(*PrivateKey).Equal", Method, 20},
+		{"(*PrivateKey).Public", Method, 20},
+		{"(*PrivateKey).PublicKey", Method, 20},
+		{"(*PublicKey).Bytes", Method, 20},
+		{"(*PublicKey).Curve", Method, 20},
+		{"(*PublicKey).Equal", Method, 20},
+		{"Curve", Type, 20},
+		{"P256", Func, 20},
+		{"P384", Func, 20},
+		{"P521", Func, 20},
+		{"PrivateKey", Type, 20},
+		{"PublicKey", Type, 20},
+		{"X25519", Func, 20},
+	},
+	"crypto/ecdsa": {
+		{"(*PrivateKey).ECDH", Method, 20},
+		{"(*PrivateKey).Equal", Method, 15},
+		{"(*PrivateKey).Public", Method, 4},
+		{"(*PrivateKey).Sign", Method, 4},
+		{"(*PublicKey).ECDH", Method, 20},
+		{"(*PublicKey).Equal", Method, 15},
+		{"(PrivateKey).Add", Method, 0},
+		{"(PrivateKey).Double", Method, 0},
+		{"(PrivateKey).IsOnCurve", Method, 0},
+		{"(PrivateKey).Params", Method, 0},
+		{"(PrivateKey).ScalarBaseMult", Method, 0},
+		{"(PrivateKey).ScalarMult", Method, 0},
+		{"(PublicKey).Add", Method, 0},
+		{"(PublicKey).Double", Method, 0},
+		{"(PublicKey).IsOnCurve", Method, 0},
+		{"(PublicKey).Params", Method, 0},
+		{"(PublicKey).ScalarBaseMult", Method, 0},
+		{"(PublicKey).ScalarMult", Method, 0},
+		{"GenerateKey", Func, 0},
+		{"PrivateKey", Type, 0},
+		{"PrivateKey.D", Field, 0},
+		{"PrivateKey.PublicKey", Field, 0},
+		{"PublicKey", Type, 0},
+		{"PublicKey.Curve", Field, 0},
+		{"PublicKey.X", Field, 0},
+		{"PublicKey.Y", Field, 0},
+		{"Sign", Func, 0},
+		{"SignASN1", Func, 15},
+		{"Verify", Func, 0},
+		{"VerifyASN1", Func, 15},
+	},
+	"crypto/ed25519": {
+		{"(*Options).HashFunc", Method, 20},
+		{"(PrivateKey).Equal", Method, 15},
+		{"(PrivateKey).Public", Method, 13},
+		{"(PrivateKey).Seed", Method, 13},
+		{"(PrivateKey).Sign", Method, 13},
+		{"(PublicKey).Equal", Method, 15},
+		{"GenerateKey", Func, 13},
+		{"NewKeyFromSeed", Func, 13},
+		{"Options", Type, 20},
+		{"Options.Context", Field, 20},
+		{"Options.Hash", Field, 20},
+		{"PrivateKey", Type, 13},
+		{"PrivateKeySize", Const, 13},
+		{"PublicKey", Type, 13},
+		{"PublicKeySize", Const, 13},
+		{"SeedSize", Const, 13},
+		{"Sign", Func, 13},
+		{"SignatureSize", Const, 13},
+		{"Verify", Func, 13},
+		{"VerifyWithOptions", Func, 20},
+	},
+	"crypto/elliptic": {
+		{"(*CurveParams).Add", Method, 0},
+		{"(*CurveParams).Double", Method, 0},
+		{"(*CurveParams).IsOnCurve", Method, 0},
+		{"(*CurveParams).Params", Method, 0},
+		{"(*CurveParams).ScalarBaseMult", Method, 0},
+		{"(*CurveParams).ScalarMult", Method, 0},
+		{"Curve", Type, 0},
+		{"CurveParams", Type, 0},
+		{"CurveParams.B", Field, 0},
+		{"CurveParams.BitSize", Field, 0},
+		{"CurveParams.Gx", Field, 0},
+		{"CurveParams.Gy", Field, 0},
+		{"CurveParams.N", Field, 0},
+		{"CurveParams.Name", Field, 5},
+		{"CurveParams.P", Field, 0},
+		{"GenerateKey", Func, 0},
+		{"Marshal", Func, 0},
+		{"MarshalCompressed", Func, 15},
+		{"P224", Func, 0},
+		{"P256", Func, 0},
+		{"P384", Func, 0},
+		{"P521", Func, 0},
+		{"Unmarshal", Func, 0},
+		{"UnmarshalCompressed", Func, 15},
+	},
+	"crypto/hmac": {
+		{"Equal", Func, 1},
+		{"New", Func, 0},
+	},
+	"crypto/md5": {
+		{"BlockSize", Const, 0},
+		{"New", Func, 0},
+		{"Size", Const, 0},
+		{"Sum", Func, 2},
+	},
+	"crypto/rand": {
+		{"Int", Func, 0},
+		{"Prime", Func, 0},
+		{"Read", Func, 0},
+		{"Reader", Var, 0},
+	},
+	"crypto/rc4": {
+		{"(*Cipher).Reset", Method, 0},
+		{"(*Cipher).XORKeyStream", Method, 0},
+		{"(KeySizeError).Error", Method, 0},
+		{"Cipher", Type, 0},
+		{"KeySizeError", Type, 0},
+		{"NewCipher", Func, 0},
+	},
+	"crypto/rsa": {
+		{"(*PSSOptions).HashFunc", Method, 4},
+		{"(*PrivateKey).Decrypt", Method, 5},
+		{"(*PrivateKey).Equal", Method, 15},
+		{"(*PrivateKey).Precompute", Method, 0},
+		{"(*PrivateKey).Public", Method, 4},
+		{"(*PrivateKey).Sign", Method, 4},
+		{"(*PrivateKey).Size", Method, 11},
+		{"(*PrivateKey).Validate", Method, 0},
+		{"(*PublicKey).Equal", Method, 15},
+		{"(*PublicKey).Size", Method, 11},
+		{"CRTValue", Type, 0},
+		{"CRTValue.Coeff", Field, 0},
+		{"CRTValue.Exp", Field, 0},
+		{"CRTValue.R", Field, 0},
+		{"DecryptOAEP", Func, 0},
+		{"DecryptPKCS1v15", Func, 0},
+		{"DecryptPKCS1v15SessionKey", Func, 0},
+		{"EncryptOAEP", Func, 0},
+		{"EncryptPKCS1v15", Func, 0},
+		{"ErrDecryption", Var, 0},
+		{"ErrMessageTooLong", Var, 0},
+		{"ErrVerification", Var, 0},
+		{"GenerateKey", Func, 0},
+		{"GenerateMultiPrimeKey", Func, 0},
+		{"OAEPOptions", Type, 5},
+		{"OAEPOptions.Hash", Field, 5},
+		{"OAEPOptions.Label", Field, 5},
+		{"OAEPOptions.MGFHash", Field, 20},
+		{"PKCS1v15DecryptOptions", Type, 5},
+		{"PKCS1v15DecryptOptions.SessionKeyLen", Field, 5},
+		{"PSSOptions", Type, 2},
+		{"PSSOptions.Hash", Field, 4},
+		{"PSSOptions.SaltLength", Field, 2},
+		{"PSSSaltLengthAuto", Const, 2},
+		{"PSSSaltLengthEqualsHash", Const, 2},
+		{"PrecomputedValues", Type, 0},
+		{"PrecomputedValues.CRTValues", Field, 0},
+		{"PrecomputedValues.Dp", Field, 0},
+		{"PrecomputedValues.Dq", Field, 0},
+		{"PrecomputedValues.Qinv", Field, 0},
+		{"PrivateKey", Type, 0},
+		{"PrivateKey.D", Field, 0},
+		{"PrivateKey.Precomputed", Field, 0},
+		{"PrivateKey.Primes", Field, 0},
+		{"PrivateKey.PublicKey", Field, 0},
+		{"PublicKey", Type, 0},
+		{"PublicKey.E", Field, 0},
+		{"PublicKey.N", Field, 0},
+		{"SignPKCS1v15", Func, 0},
+		{"SignPSS", Func, 2},
+		{"VerifyPKCS1v15", Func, 0},
+		{"VerifyPSS", Func, 2},
+	},
+	"crypto/sha1": {
+		{"BlockSize", Const, 0},
+		{"New", Func, 0},
+		{"Size", Const, 0},
+		{"Sum", Func, 2},
+	},
+	"crypto/sha256": {
+		{"BlockSize", Const, 0},
+		{"New", Func, 0},
+		{"New224", Func, 0},
+		{"Size", Const, 0},
+		{"Size224", Const, 0},
+		{"Sum224", Func, 2},
+		{"Sum256", Func, 2},
+	},
+	"crypto/sha512": {
+		{"BlockSize", Const, 0},
+		{"New", Func, 0},
+		{"New384", Func, 0},
+		{"New512_224", Func, 5},
+		{"New512_256", Func, 5},
+		{"Size", Const, 0},
+		{"Size224", Const, 5},
+		{"Size256", Const, 5},
+		{"Size384", Const, 0},
+		{"Sum384", Func, 2},
+		{"Sum512", Func, 2},
+		{"Sum512_224", Func, 5},
+		{"Sum512_256", Func, 5},
+	},
+	"crypto/subtle": {
+		{"ConstantTimeByteEq", Func, 0},
+		{"ConstantTimeCompare", Func, 0},
+		{"ConstantTimeCopy", Func, 0},
+		{"ConstantTimeEq", Func, 0},
+		{"ConstantTimeLessOrEq", Func, 2},
+		{"ConstantTimeSelect", Func, 0},
+		{"XORBytes", Func, 20},
+	},
+	"crypto/tls": {
+		{"(*CertificateRequestInfo).Context", Method, 17},
+		{"(*CertificateRequestInfo).SupportsCertificate", Method, 14},
+		{"(*CertificateVerificationError).Error", Method, 20},
+		{"(*CertificateVerificationError).Unwrap", Method, 20},
+		{"(*ClientHelloInfo).Context", Method, 17},
+		{"(*ClientHelloInfo).SupportsCertificate", Method, 14},
+		{"(*ClientSessionState).ResumptionState", Method, 21},
+		{"(*Config).BuildNameToCertificate", Method, 0},
+		{"(*Config).Clone", Method, 8},
+		{"(*Config).DecryptTicket", Method, 21},
+		{"(*Config).EncryptTicket", Method, 21},
+		{"(*Config).SetSessionTicketKeys", Method, 5},
+		{"(*Conn).Close", Method, 0},
+		{"(*Conn).CloseWrite", Method, 8},
+		{"(*Conn).ConnectionState", Method, 0},
+		{"(*Conn).Handshake", Method, 0},
+		{"(*Conn).HandshakeContext", Method, 17},
+		{"(*Conn).LocalAddr", Method, 0},
+		{"(*Conn).NetConn", Method, 18},
+		{"(*Conn).OCSPResponse", Method, 0},
+		{"(*Conn).Read", Method, 0},
+		{"(*Conn).RemoteAddr", Method, 0},
+		{"(*Conn).SetDeadline", Method, 0},
+		{"(*Conn).SetReadDeadline", Method, 0},
+		{"(*Conn).SetWriteDeadline", Method, 0},
+		{"(*Conn).VerifyHostname", Method, 0},
+		{"(*Conn).Write", Method, 0},
+		{"(*ConnectionState).ExportKeyingMaterial", Method, 11},
+		{"(*Dialer).Dial", Method, 15},
+		{"(*Dialer).DialContext", Method, 15},
+		{"(*QUICConn).Close", Method, 21},
+		{"(*QUICConn).ConnectionState", Method, 21},
+		{"(*QUICConn).HandleData", Method, 21},
+		{"(*QUICConn).NextEvent", Method, 21},
+		{"(*QUICConn).SendSessionTicket", Method, 21},
+		{"(*QUICConn).SetTransportParameters", Method, 21},
+		{"(*QUICConn).Start", Method, 21},
+		{"(*SessionState).Bytes", Method, 21},
+		{"(AlertError).Error", Method, 21},
+		{"(ClientAuthType).String", Method, 15},
+		{"(CurveID).String", Method, 15},
+		{"(QUICEncryptionLevel).String", Method, 21},
+		{"(RecordHeaderError).Error", Method, 6},
+		{"(SignatureScheme).String", Method, 15},
+		{"AlertError", Type, 21},
+		{"Certificate", Type, 0},
+		{"Certificate.Certificate", Field, 0},
+		{"Certificate.Leaf", Field, 0},
+		{"Certificate.OCSPStaple", Field, 0},
+		{"Certificate.PrivateKey", Field, 0},
+		{"Certificate.SignedCertificateTimestamps", Field, 5},
+		{"Certificate.SupportedSignatureAlgorithms", Field, 14},
+		{"CertificateRequestInfo", Type, 8},
+		{"CertificateRequestInfo.AcceptableCAs", Field, 8},
+		{"CertificateRequestInfo.SignatureSchemes", Field, 8},
+		{"CertificateRequestInfo.Version", Field, 14},
+		{"CertificateVerificationError", Type, 20},
+		{"CertificateVerificationError.Err", Field, 20},
+		{"CertificateVerificationError.UnverifiedCertificates", Field, 20},
+		{"CipherSuite", Type, 14},
+		{"CipherSuite.ID", Field, 14},
+		{"CipherSuite.Insecure", Field, 14},
+		{"CipherSuite.Name", Field, 14},
+		{"CipherSuite.SupportedVersions", Field, 14},
+		{"CipherSuiteName", Func, 14},
+		{"CipherSuites", Func, 14},
+		{"Client", Func, 0},
+		{"ClientAuthType", Type, 0},
+		{"ClientHelloInfo", Type, 4},
+		{"ClientHelloInfo.CipherSuites", Field, 4},
+		{"ClientHelloInfo.Conn", Field, 8},
+		{"ClientHelloInfo.ServerName", Field, 4},
+		{"ClientHelloInfo.SignatureSchemes", Field, 8},
+		{"ClientHelloInfo.SupportedCurves", Field, 4},
+		{"ClientHelloInfo.SupportedPoints", Field, 4},
+		{"ClientHelloInfo.SupportedProtos", Field, 8},
+		{"ClientHelloInfo.SupportedVersions", Field, 8},
+		{"ClientSessionCache", Type, 3},
+		{"ClientSessionState", Type, 3},
+		{"Config", Type, 0},
+		{"Config.Certificates", Field, 0},
+		{"Config.CipherSuites", Field, 0},
+		{"Config.ClientAuth", Field, 0},
+		{"Config.ClientCAs", Field, 0},
+		{"Config.ClientSessionCache", Field, 3},
+		{"Config.CurvePreferences", Field, 3},
+		{"Config.DynamicRecordSizingDisabled", Field, 7},
+		{"Config.GetCertificate", Field, 4},
+		{"Config.GetClientCertificate", Field, 8},
+		{"Config.GetConfigForClient", Field, 8},
+		{"Config.InsecureSkipVerify", Field, 0},
+		{"Config.KeyLogWriter", Field, 8},
+		{"Config.MaxVersion", Field, 2},
+		{"Config.MinVersion", Field, 2},
+		{"Config.NameToCertificate", Field, 0},
+		{"Config.NextProtos", Field, 0},
+		{"Config.PreferServerCipherSuites", Field, 1},
+		{"Config.Rand", Field, 0},
+		{"Config.Renegotiation", Field, 7},
+		{"Config.RootCAs", Field, 0},
+		{"Config.ServerName", Field, 0},
+		{"Config.SessionTicketKey", Field, 1},
+		{"Config.SessionTicketsDisabled", Field, 1},
+		{"Config.Time", Field, 0},
+		{"Config.UnwrapSession", Field, 21},
+		{"Config.VerifyConnection", Field, 15},
+		{"Config.VerifyPeerCertificate", Field, 8},
+		{"Config.WrapSession", Field, 21},
+		{"Conn", Type, 0},
+		{"ConnectionState", Type, 0},
+		{"ConnectionState.CipherSuite", Field, 0},
+		{"ConnectionState.DidResume", Field, 1},
+		{"ConnectionState.HandshakeComplete", Field, 0},
+		{"ConnectionState.NegotiatedProtocol", Field, 0},
+		{"ConnectionState.NegotiatedProtocolIsMutual", Field, 0},
+		{"ConnectionState.OCSPResponse", Field, 5},
+		{"ConnectionState.PeerCertificates", Field, 0},
+		{"ConnectionState.ServerName", Field, 0},
+		{"ConnectionState.SignedCertificateTimestamps", Field, 5},
+		{"ConnectionState.TLSUnique", Field, 4},
+		{"ConnectionState.VerifiedChains", Field, 0},
+		{"ConnectionState.Version", Field, 3},
+		{"CurveID", Type, 3},
+		{"CurveP256", Const, 3},
+		{"CurveP384", Const, 3},
+		{"CurveP521", Const, 3},
+		{"Dial", Func, 0},
+		{"DialWithDialer", Func, 3},
+		{"Dialer", Type, 15},
+		{"Dialer.Config", Field, 15},
+		{"Dialer.NetDialer", Field, 15},
+		{"ECDSAWithP256AndSHA256", Const, 8},
+		{"ECDSAWithP384AndSHA384", Const, 8},
+		{"ECDSAWithP521AndSHA512", Const, 8},
+		{"ECDSAWithSHA1", Const, 10},
+		{"Ed25519", Const, 13},
+		{"InsecureCipherSuites", Func, 14},
+		{"Listen", Func, 0},
+		{"LoadX509KeyPair", Func, 0},
+		{"NewLRUClientSessionCache", Func, 3},
+		{"NewListener", Func, 0},
+		{"NewResumptionState", Func, 21},
+		{"NoClientCert", Const, 0},
+		{"PKCS1WithSHA1", Const, 8},
+		{"PKCS1WithSHA256", Const, 8},
+		{"PKCS1WithSHA384", Const, 8},
+		{"PKCS1WithSHA512", Const, 8},
+		{"PSSWithSHA256", Const, 8},
+		{"PSSWithSHA384", Const, 8},
+		{"PSSWithSHA512", Const, 8},
+		{"ParseSessionState", Func, 21},
+		{"QUICClient", Func, 21},
+		{"QUICConfig", Type, 21},
+		{"QUICConfig.TLSConfig", Field, 21},
+		{"QUICConn", Type, 21},
+		{"QUICEncryptionLevel", Type, 21},
+		{"QUICEncryptionLevelApplication", Const, 21},
+		{"QUICEncryptionLevelEarly", Const, 21},
+		{"QUICEncryptionLevelHandshake", Const, 21},
+		{"QUICEncryptionLevelInitial", Const, 21},
+		{"QUICEvent", Type, 21},
+		{"QUICEvent.Data", Field, 21},
+		{"QUICEvent.Kind", Field, 21},
+		{"QUICEvent.Level", Field, 21},
+		{"QUICEvent.Suite", Field, 21},
+		{"QUICEventKind", Type, 21},
+		{"QUICHandshakeDone", Const, 21},
+		{"QUICNoEvent", Const, 21},
+		{"QUICRejectedEarlyData", Const, 21},
+		{"QUICServer", Func, 21},
+		{"QUICSessionTicketOptions", Type, 21},
+		{"QUICSessionTicketOptions.EarlyData", Field, 21},
+		{"QUICSetReadSecret", Const, 21},
+		{"QUICSetWriteSecret", Const, 21},
+		{"QUICTransportParameters", Const, 21},
+		{"QUICTransportParametersRequired", Const, 21},
+		{"QUICWriteData", Const, 21},
+		{"RecordHeaderError", Type, 6},
+		{"RecordHeaderError.Conn", Field, 12},
+		{"RecordHeaderError.Msg", Field, 6},
+		{"RecordHeaderError.RecordHeader", Field, 6},
+		{"RenegotiateFreelyAsClient", Const, 7},
+		{"RenegotiateNever", Const, 7},
+		{"RenegotiateOnceAsClient", Const, 7},
+		{"RenegotiationSupport", Type, 7},
+		{"RequestClientCert", Const, 0},
+		{"RequireAndVerifyClientCert", Const, 0},
+		{"RequireAnyClientCert", Const, 0},
+		{"Server", Func, 0},
+		{"SessionState", Type, 21},
+		{"SessionState.EarlyData", Field, 21},
+		{"SessionState.Extra", Field, 21},
+		{"SignatureScheme", Type, 8},
+		{"TLS_AES_128_GCM_SHA256", Const, 12},
+		{"TLS_AES_256_GCM_SHA384", Const, 12},
+		{"TLS_CHACHA20_POLY1305_SHA256", Const, 12},
+		{"TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA", Const, 2},
+		{"TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256", Const, 8},
+		{"TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256", Const, 2},
+		{"TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA", Const, 2},
+		{"TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384", Const, 5},
+		{"TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305", Const, 8},
+		{"TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256", Const, 14},
+		{"TLS_ECDHE_ECDSA_WITH_RC4_128_SHA", Const, 2},
+		{"TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA", Const, 0},
+		{"TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA", Const, 0},
+		{"TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256", Const, 8},
+		{"TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256", Const, 2},
+		{"TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA", Const, 1},
+		{"TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384", Const, 5},
+		{"TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305", Const, 8},
+		{"TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256", Const, 14},
+		{"TLS_ECDHE_RSA_WITH_RC4_128_SHA", Const, 0},
+		{"TLS_FALLBACK_SCSV", Const, 4},
+		{"TLS_RSA_WITH_3DES_EDE_CBC_SHA", Const, 0},
+		{"TLS_RSA_WITH_AES_128_CBC_SHA", Const, 0},
+		{"TLS_RSA_WITH_AES_128_CBC_SHA256", Const, 8},
+		{"TLS_RSA_WITH_AES_128_GCM_SHA256", Const, 6},
+		{"TLS_RSA_WITH_AES_256_CBC_SHA", Const, 1},
+		{"TLS_RSA_WITH_AES_256_GCM_SHA384", Const, 6},
+		{"TLS_RSA_WITH_RC4_128_SHA", Const, 0},
+		{"VerifyClientCertIfGiven", Const, 0},
+		{"VersionName", Func, 21},
+		{"VersionSSL30", Const, 2},
+		{"VersionTLS10", Const, 2},
+		{"VersionTLS11", Const, 2},
+		{"VersionTLS12", Const, 2},
+		{"VersionTLS13", Const, 12},
+		{"X25519", Const, 8},
+		{"X509KeyPair", Func, 0},
+	},
+	"crypto/x509": {
+		{"(*CertPool).AddCert", Method, 0},
+		{"(*CertPool).AddCertWithConstraint", Method, 22},
+		{"(*CertPool).AppendCertsFromPEM", Method, 0},
+		{"(*CertPool).Clone", Method, 19},
+		{"(*CertPool).Equal", Method, 19},
+		{"(*CertPool).Subjects", Method, 0},
+		{"(*Certificate).CheckCRLSignature", Method, 0},
+		{"(*Certificate).CheckSignature", Method, 0},
+		{"(*Certificate).CheckSignatureFrom", Method, 0},
+		{"(*Certificate).CreateCRL", Method, 0},
+		{"(*Certificate).Equal", Method, 0},
+		{"(*Certificate).Verify", Method, 0},
+		{"(*Certificate).VerifyHostname", Method, 0},
+		{"(*CertificateRequest).CheckSignature", Method, 5},
+		{"(*RevocationList).CheckSignatureFrom", Method, 19},
+		{"(CertificateInvalidError).Error", Method, 0},
+		{"(ConstraintViolationError).Error", Method, 0},
+		{"(HostnameError).Error", Method, 0},
+		{"(InsecureAlgorithmError).Error", Method, 6},
+		{"(OID).Equal", Method, 22},
+		{"(OID).EqualASN1OID", Method, 22},
+		{"(OID).String", Method, 22},
+		{"(PublicKeyAlgorithm).String", Method, 10},
+		{"(SignatureAlgorithm).String", Method, 6},
+		{"(SystemRootsError).Error", Method, 1},
+		{"(SystemRootsError).Unwrap", Method, 16},
+		{"(UnhandledCriticalExtension).Error", Method, 0},
+		{"(UnknownAuthorityError).Error", Method, 0},
+		{"CANotAuthorizedForExtKeyUsage", Const, 10},
+		{"CANotAuthorizedForThisName", Const, 0},
+		{"CertPool", Type, 0},
+		{"Certificate", Type, 0},
+		{"Certificate.AuthorityKeyId", Field, 0},
+		{"Certificate.BasicConstraintsValid", Field, 0},
+		{"Certificate.CRLDistributionPoints", Field, 2},
+		{"Certificate.DNSNames", Field, 0},
+		{"Certificate.EmailAddresses", Field, 0},
+		{"Certificate.ExcludedDNSDomains", Field, 9},
+		{"Certificate.ExcludedEmailAddresses", Field, 10},
+		{"Certificate.ExcludedIPRanges", Field, 10},
+		{"Certificate.ExcludedURIDomains", Field, 10},
+		{"Certificate.ExtKeyUsage", Field, 0},
+		{"Certificate.Extensions", Field, 2},
+		{"Certificate.ExtraExtensions", Field, 2},
+		{"Certificate.IPAddresses", Field, 1},
+		{"Certificate.IsCA", Field, 0},
+		{"Certificate.Issuer", Field, 0},
+		{"Certificate.IssuingCertificateURL", Field, 2},
+		{"Certificate.KeyUsage", Field, 0},
+		{"Certificate.MaxPathLen", Field, 0},
+		{"Certificate.MaxPathLenZero", Field, 4},
+		{"Certificate.NotAfter", Field, 0},
+		{"Certificate.NotBefore", Field, 0},
+		{"Certificate.OCSPServer", Field, 2},
+		{"Certificate.PermittedDNSDomains", Field, 0},
+		{"Certificate.PermittedDNSDomainsCritical", Field, 0},
+		{"Certificate.PermittedEmailAddresses", Field, 10},
+		{"Certificate.PermittedIPRanges", Field, 10},
+		{"Certificate.PermittedURIDomains", Field, 10},
+		{"Certificate.Policies", Field, 22},
+		{"Certificate.PolicyIdentifiers", Field, 0},
+		{"Certificate.PublicKey", Field, 0},
+		{"Certificate.PublicKeyAlgorithm", Field, 0},
+		{"Certificate.Raw", Field, 0},
+		{"Certificate.RawIssuer", Field, 0},
+		{"Certificate.RawSubject", Field, 0},
+		{"Certificate.RawSubjectPublicKeyInfo", Field, 0},
+		{"Certificate.RawTBSCertificate", Field, 0},
+		{"Certificate.SerialNumber", Field, 0},
+		{"Certificate.Signature", Field, 0},
+		{"Certificate.SignatureAlgorithm", Field, 0},
+		{"Certificate.Subject", Field, 0},
+		{"Certificate.SubjectKeyId", Field, 0},
+		{"Certificate.URIs", Field, 10},
+		{"Certificate.UnhandledCriticalExtensions", Field, 5},
+		{"Certificate.UnknownExtKeyUsage", Field, 0},
+		{"Certificate.Version", Field, 0},
+		{"CertificateInvalidError", Type, 0},
+		{"CertificateInvalidError.Cert", Field, 0},
+		{"CertificateInvalidError.Detail", Field, 10},
+		{"CertificateInvalidError.Reason", Field, 0},
+		{"CertificateRequest", Type, 3},
+		{"CertificateRequest.Attributes", Field, 3},
+		{"CertificateRequest.DNSNames", Field, 3},
+		{"CertificateRequest.EmailAddresses", Field, 3},
+		{"CertificateRequest.Extensions", Field, 3},
+		{"CertificateRequest.ExtraExtensions", Field, 3},
+		{"CertificateRequest.IPAddresses", Field, 3},
+		{"CertificateRequest.PublicKey", Field, 3},
+		{"CertificateRequest.PublicKeyAlgorithm", Field, 3},
+		{"CertificateRequest.Raw", Field, 3},
+		{"CertificateRequest.RawSubject", Field, 3},
+		{"CertificateRequest.RawSubjectPublicKeyInfo", Field, 3},
+		{"CertificateRequest.RawTBSCertificateRequest", Field, 3},
+		{"CertificateRequest.Signature", Field, 3},
+		{"CertificateRequest.SignatureAlgorithm", Field, 3},
+		{"CertificateRequest.Subject", Field, 3},
+		{"CertificateRequest.URIs", Field, 10},
+		{"CertificateRequest.Version", Field, 3},
+		{"ConstraintViolationError", Type, 0},
+		{"CreateCertificate", Func, 0},
+		{"CreateCertificateRequest", Func, 3},
+		{"CreateRevocationList", Func, 15},
+		{"DSA", Const, 0},
+		{"DSAWithSHA1", Const, 0},
+		{"DSAWithSHA256", Const, 0},
+		{"DecryptPEMBlock", Func, 1},
+		{"ECDSA", Const, 1},
+		{"ECDSAWithSHA1", Const, 1},
+		{"ECDSAWithSHA256", Const, 1},
+		{"ECDSAWithSHA384", Const, 1},
+		{"ECDSAWithSHA512", Const, 1},
+		{"Ed25519", Const, 13},
+		{"EncryptPEMBlock", Func, 1},
+		{"ErrUnsupportedAlgorithm", Var, 0},
+		{"Expired", Const, 0},
+		{"ExtKeyUsage", Type, 0},
+		{"ExtKeyUsageAny", Const, 0},
+		{"ExtKeyUsageClientAuth", Const, 0},
+		{"ExtKeyUsageCodeSigning", Const, 0},
+		{"ExtKeyUsageEmailProtection", Const, 0},
+		{"ExtKeyUsageIPSECEndSystem", Const, 1},
+		{"ExtKeyUsageIPSECTunnel", Const, 1},
+		{"ExtKeyUsageIPSECUser", Const, 1},
+		{"ExtKeyUsageMicrosoftCommercialCodeSigning", Const, 10},
+		{"ExtKeyUsageMicrosoftKernelCodeSigning", Const, 10},
+		{"ExtKeyUsageMicrosoftServerGatedCrypto", Const, 1},
+		{"ExtKeyUsageNetscapeServerGatedCrypto", Const, 1},
+		{"ExtKeyUsageOCSPSigning", Const, 0},
+		{"ExtKeyUsageServerAuth", Const, 0},
+		{"ExtKeyUsageTimeStamping", Const, 0},
+		{"HostnameError", Type, 0},
+		{"HostnameError.Certificate", Field, 0},
+		{"HostnameError.Host", Field, 0},
+		{"IncompatibleUsage", Const, 1},
+		{"IncorrectPasswordError", Var, 1},
+		{"InsecureAlgorithmError", Type, 6},
+		{"InvalidReason", Type, 0},
+		{"IsEncryptedPEMBlock", Func, 1},
+		{"KeyUsage", Type, 0},
+		{"KeyUsageCRLSign", Const, 0},
+		{"KeyUsageCertSign", Const, 0},
+		{"KeyUsageContentCommitment", Const, 0},
+		{"KeyUsageDataEncipherment", Const, 0},
+		{"KeyUsageDecipherOnly", Const, 0},
+		{"KeyUsageDigitalSignature", Const, 0},
+		{"KeyUsageEncipherOnly", Const, 0},
+		{"KeyUsageKeyAgreement", Const, 0},
+		{"KeyUsageKeyEncipherment", Const, 0},
+		{"MD2WithRSA", Const, 0},
+		{"MD5WithRSA", Const, 0},
+		{"MarshalECPrivateKey", Func, 2},
+		{"MarshalPKCS1PrivateKey", Func, 0},
+		{"MarshalPKCS1PublicKey", Func, 10},
+		{"MarshalPKCS8PrivateKey", Func, 10},
+		{"MarshalPKIXPublicKey", Func, 0},
+		{"NameConstraintsWithoutSANs", Const, 10},
+		{"NameMismatch", Const, 8},
+		{"NewCertPool", Func, 0},
+		{"NotAuthorizedToSign", Const, 0},
+		{"OID", Type, 22},
+		{"OIDFromInts", Func, 22},
+		{"PEMCipher", Type, 1},
+		{"PEMCipher3DES", Const, 1},
+		{"PEMCipherAES128", Const, 1},
+		{"PEMCipherAES192", Const, 1},
+		{"PEMCipherAES256", Const, 1},
+		{"PEMCipherDES", Const, 1},
+		{"ParseCRL", Func, 0},
+		{"ParseCertificate", Func, 0},
+		{"ParseCertificateRequest", Func, 3},
+		{"ParseCertificates", Func, 0},
+		{"ParseDERCRL", Func, 0},
+		{"ParseECPrivateKey", Func, 1},
+		{"ParsePKCS1PrivateKey", Func, 0},
+		{"ParsePKCS1PublicKey", Func, 10},
+		{"ParsePKCS8PrivateKey", Func, 0},
+		{"ParsePKIXPublicKey", Func, 0},
+		{"ParseRevocationList", Func, 19},
+		{"PublicKeyAlgorithm", Type, 0},
+		{"PureEd25519", Const, 13},
+		{"RSA", Const, 0},
+		{"RevocationList", Type, 15},
+		{"RevocationList.AuthorityKeyId", Field, 19},
+		{"RevocationList.Extensions", Field, 19},
+		{"RevocationList.ExtraExtensions", Field, 15},
+		{"RevocationList.Issuer", Field, 19},
+		{"RevocationList.NextUpdate", Field, 15},
+		{"RevocationList.Number", Field, 15},
+		{"RevocationList.Raw", Field, 19},
+		{"RevocationList.RawIssuer", Field, 19},
+		{"RevocationList.RawTBSRevocationList", Field, 19},
+		{"RevocationList.RevokedCertificateEntries", Field, 21},
+		{"RevocationList.RevokedCertificates", Field, 15},
+		{"RevocationList.Signature", Field, 19},
+		{"RevocationList.SignatureAlgorithm", Field, 15},
+		{"RevocationList.ThisUpdate", Field, 15},
+		{"RevocationListEntry", Type, 21},
+		{"RevocationListEntry.Extensions", Field, 21},
+		{"RevocationListEntry.ExtraExtensions", Field, 21},
+		{"RevocationListEntry.Raw", Field, 21},
+		{"RevocationListEntry.ReasonCode", Field, 21},
+		{"RevocationListEntry.RevocationTime", Field, 21},
+		{"RevocationListEntry.SerialNumber", Field, 21},
+		{"SHA1WithRSA", Const, 0},
+		{"SHA256WithRSA", Const, 0},
+		{"SHA256WithRSAPSS", Const, 8},
+		{"SHA384WithRSA", Const, 0},
+		{"SHA384WithRSAPSS", Const, 8},
+		{"SHA512WithRSA", Const, 0},
+		{"SHA512WithRSAPSS", Const, 8},
+		{"SetFallbackRoots", Func, 20},
+		{"SignatureAlgorithm", Type, 0},
+		{"SystemCertPool", Func, 7},
+		{"SystemRootsError", Type, 1},
+		{"SystemRootsError.Err", Field, 7},
+		{"TooManyConstraints", Const, 10},
+		{"TooManyIntermediates", Const, 0},
+		{"UnconstrainedName", Const, 10},
+		{"UnhandledCriticalExtension", Type, 0},
+		{"UnknownAuthorityError", Type, 0},
+		{"UnknownAuthorityError.Cert", Field, 8},
+		{"UnknownPublicKeyAlgorithm", Const, 0},
+		{"UnknownSignatureAlgorithm", Const, 0},
+		{"VerifyOptions", Type, 0},
+		{"VerifyOptions.CurrentTime", Field, 0},
+		{"VerifyOptions.DNSName", Field, 0},
+		{"VerifyOptions.Intermediates", Field, 0},
+		{"VerifyOptions.KeyUsages", Field, 1},
+		{"VerifyOptions.MaxConstraintComparisions", Field, 10},
+		{"VerifyOptions.Roots", Field, 0},
+	},
+	"crypto/x509/pkix": {
+		{"(*CertificateList).HasExpired", Method, 0},
+		{"(*Name).FillFromRDNSequence", Method, 0},
+		{"(Name).String", Method, 10},
+		{"(Name).ToRDNSequence", Method, 0},
+		{"(RDNSequence).String", Method, 10},
+		{"AlgorithmIdentifier", Type, 0},
+		{"AlgorithmIdentifier.Algorithm", Field, 0},
+		{"AlgorithmIdentifier.Parameters", Field, 0},
+		{"AttributeTypeAndValue", Type, 0},
+		{"AttributeTypeAndValue.Type", Field, 0},
+		{"AttributeTypeAndValue.Value", Field, 0},
+		{"AttributeTypeAndValueSET", Type, 3},
+		{"AttributeTypeAndValueSET.Type", Field, 3},
+		{"AttributeTypeAndValueSET.Value", Field, 3},
+		{"CertificateList", Type, 0},
+		{"CertificateList.SignatureAlgorithm", Field, 0},
+		{"CertificateList.SignatureValue", Field, 0},
+		{"CertificateList.TBSCertList", Field, 0},
+		{"Extension", Type, 0},
+		{"Extension.Critical", Field, 0},
+		{"Extension.Id", Field, 0},
+		{"Extension.Value", Field, 0},
+		{"Name", Type, 0},
+		{"Name.CommonName", Field, 0},
+		{"Name.Country", Field, 0},
+		{"Name.ExtraNames", Field, 5},
+		{"Name.Locality", Field, 0},
+		{"Name.Names", Field, 0},
+		{"Name.Organization", Field, 0},
+		{"Name.OrganizationalUnit", Field, 0},
+		{"Name.PostalCode", Field, 0},
+		{"Name.Province", Field, 0},
+		{"Name.SerialNumber", Field, 0},
+		{"Name.StreetAddress", Field, 0},
+		{"RDNSequence", Type, 0},
+		{"RelativeDistinguishedNameSET", Type, 0},
+		{"RevokedCertificate", Type, 0},
+		{"RevokedCertificate.Extensions", Field, 0},
+		{"RevokedCertificate.RevocationTime", Field, 0},
+		{"RevokedCertificate.SerialNumber", Field, 0},
+		{"TBSCertificateList", Type, 0},
+		{"TBSCertificateList.Extensions", Field, 0},
+		{"TBSCertificateList.Issuer", Field, 0},
+		{"TBSCertificateList.NextUpdate", Field, 0},
+		{"TBSCertificateList.Raw", Field, 0},
+		{"TBSCertificateList.RevokedCertificates", Field, 0},
+		{"TBSCertificateList.Signature", Field, 0},
+		{"TBSCertificateList.ThisUpdate", Field, 0},
+		{"TBSCertificateList.Version", Field, 0},
+	},
+	"database/sql": {
+		{"(*ColumnType).DatabaseTypeName", Method, 8},
+		{"(*ColumnType).DecimalSize", Method, 8},
+		{"(*ColumnType).Length", Method, 8},
+		{"(*ColumnType).Name", Method, 8},
+		{"(*ColumnType).Nullable", Method, 8},
+		{"(*ColumnType).ScanType", Method, 8},
+		{"(*Conn).BeginTx", Method, 9},
+		{"(*Conn).Close", Method, 9},
+		{"(*Conn).ExecContext", Method, 9},
+		{"(*Conn).PingContext", Method, 9},
+		{"(*Conn).PrepareContext", Method, 9},
+		{"(*Conn).QueryContext", Method, 9},
+		{"(*Conn).QueryRowContext", Method, 9},
+		{"(*Conn).Raw", Method, 13},
+		{"(*DB).Begin", Method, 0},
+		{"(*DB).BeginTx", Method, 8},
+		{"(*DB).Close", Method, 0},
+		{"(*DB).Conn", Method, 9},
+		{"(*DB).Driver", Method, 0},
+		{"(*DB).Exec", Method, 0},
+		{"(*DB).ExecContext", Method, 8},
+		{"(*DB).Ping", Method, 1},
+		{"(*DB).PingContext", Method, 8},
+		{"(*DB).Prepare", Method, 0},
+		{"(*DB).PrepareContext", Method, 8},
+		{"(*DB).Query", Method, 0},
+		{"(*DB).QueryContext", Method, 8},
+		{"(*DB).QueryRow", Method, 0},
+		{"(*DB).QueryRowContext", Method, 8},
+		{"(*DB).SetConnMaxIdleTime", Method, 15},
+		{"(*DB).SetConnMaxLifetime", Method, 6},
+		{"(*DB).SetMaxIdleConns", Method, 1},
+		{"(*DB).SetMaxOpenConns", Method, 2},
+		{"(*DB).Stats", Method, 5},
+		{"(*Null).Scan", Method, 22},
+		{"(*NullBool).Scan", Method, 0},
+		{"(*NullByte).Scan", Method, 17},
+		{"(*NullFloat64).Scan", Method, 0},
+		{"(*NullInt16).Scan", Method, 17},
+		{"(*NullInt32).Scan", Method, 13},
+		{"(*NullInt64).Scan", Method, 0},
+		{"(*NullString).Scan", Method, 0},
+		{"(*NullTime).Scan", Method, 13},
+		{"(*Row).Err", Method, 15},
+		{"(*Row).Scan", Method, 0},
+		{"(*Rows).Close", Method, 0},
+		{"(*Rows).ColumnTypes", Method, 8},
+		{"(*Rows).Columns", Method, 0},
+		{"(*Rows).Err", Method, 0},
+		{"(*Rows).Next", Method, 0},
+		{"(*Rows).NextResultSet", Method, 8},
+		{"(*Rows).Scan", Method, 0},
+		{"(*Stmt).Close", Method, 0},
+		{"(*Stmt).Exec", Method, 0},
+		{"(*Stmt).ExecContext", Method, 8},
+		{"(*Stmt).Query", Method, 0},
+		{"(*Stmt).QueryContext", Method, 8},
+		{"(*Stmt).QueryRow", Method, 0},
+		{"(*Stmt).QueryRowContext", Method, 8},
+		{"(*Tx).Commit", Method, 0},
+		{"(*Tx).Exec", Method, 0},
+		{"(*Tx).ExecContext", Method, 8},
+		{"(*Tx).Prepare", Method, 0},
+		{"(*Tx).PrepareContext", Method, 8},
+		{"(*Tx).Query", Method, 0},
+		{"(*Tx).QueryContext", Method, 8},
+		{"(*Tx).QueryRow", Method, 0},
+		{"(*Tx).QueryRowContext", Method, 8},
+		{"(*Tx).Rollback", Method, 0},
+		{"(*Tx).Stmt", Method, 0},
+		{"(*Tx).StmtContext", Method, 8},
+		{"(IsolationLevel).String", Method, 11},
+		{"(Null).Value", Method, 22},
+		{"(NullBool).Value", Method, 0},
+		{"(NullByte).Value", Method, 17},
+		{"(NullFloat64).Value", Method, 0},
+		{"(NullInt16).Value", Method, 17},
+		{"(NullInt32).Value", Method, 13},
+		{"(NullInt64).Value", Method, 0},
+		{"(NullString).Value", Method, 0},
+		{"(NullTime).Value", Method, 13},
+		{"ColumnType", Type, 8},
+		{"Conn", Type, 9},
+		{"DB", Type, 0},
+		{"DBStats", Type, 5},
+		{"DBStats.Idle", Field, 11},
+		{"DBStats.InUse", Field, 11},
+		{"DBStats.MaxIdleClosed", Field, 11},
+		{"DBStats.MaxIdleTimeClosed", Field, 15},
+		{"DBStats.MaxLifetimeClosed", Field, 11},
+		{"DBStats.MaxOpenConnections", Field, 11},
+		{"DBStats.OpenConnections", Field, 5},
+		{"DBStats.WaitCount", Field, 11},
+		{"DBStats.WaitDuration", Field, 11},
+		{"Drivers", Func, 4},
+		{"ErrConnDone", Var, 9},
+		{"ErrNoRows", Var, 0},
+		{"ErrTxDone", Var, 0},
+		{"IsolationLevel", Type, 8},
+		{"LevelDefault", Const, 8},
+		{"LevelLinearizable", Const, 8},
+		{"LevelReadCommitted", Const, 8},
+		{"LevelReadUncommitted", Const, 8},
+		{"LevelRepeatableRead", Const, 8},
+		{"LevelSerializable", Const, 8},
+		{"LevelSnapshot", Const, 8},
+		{"LevelWriteCommitted", Const, 8},
+		{"Named", Func, 8},
+		{"NamedArg", Type, 8},
+		{"NamedArg.Name", Field, 8},
+		{"NamedArg.Value", Field, 8},
+		{"Null", Type, 22},
+		{"Null.V", Field, 22},
+		{"Null.Valid", Field, 22},
+		{"NullBool", Type, 0},
+		{"NullBool.Bool", Field, 0},
+		{"NullBool.Valid", Field, 0},
+		{"NullByte", Type, 17},
+		{"NullByte.Byte", Field, 17},
+		{"NullByte.Valid", Field, 17},
+		{"NullFloat64", Type, 0},
+		{"NullFloat64.Float64", Field, 0},
+		{"NullFloat64.Valid", Field, 0},
+		{"NullInt16", Type, 17},
+		{"NullInt16.Int16", Field, 17},
+		{"NullInt16.Valid", Field, 17},
+		{"NullInt32", Type, 13},
+		{"NullInt32.Int32", Field, 13},
+		{"NullInt32.Valid", Field, 13},
+		{"NullInt64", Type, 0},
+		{"NullInt64.Int64", Field, 0},
+		{"NullInt64.Valid", Field, 0},
+		{"NullString", Type, 0},
+		{"NullString.String", Field, 0},
+		{"NullString.Valid", Field, 0},
+		{"NullTime", Type, 13},
+		{"NullTime.Time", Field, 13},
+		{"NullTime.Valid", Field, 13},
+		{"Open", Func, 0},
+		{"OpenDB", Func, 10},
+		{"Out", Type, 9},
+		{"Out.Dest", Field, 9},
+		{"Out.In", Field, 9},
+		{"RawBytes", Type, 0},
+		{"Register", Func, 0},
+		{"Result", Type, 0},
+		{"Row", Type, 0},
+		{"Rows", Type, 0},
+		{"Scanner", Type, 0},
+		{"Stmt", Type, 0},
+		{"Tx", Type, 0},
+		{"TxOptions", Type, 8},
+		{"TxOptions.Isolation", Field, 8},
+		{"TxOptions.ReadOnly", Field, 8},
+	},
+	"database/sql/driver": {
+		{"(NotNull).ConvertValue", Method, 0},
+		{"(Null).ConvertValue", Method, 0},
+		{"(RowsAffected).LastInsertId", Method, 0},
+		{"(RowsAffected).RowsAffected", Method, 0},
+		{"Bool", Var, 0},
+		{"ColumnConverter", Type, 0},
+		{"Conn", Type, 0},
+		{"ConnBeginTx", Type, 8},
+		{"ConnPrepareContext", Type, 8},
+		{"Connector", Type, 10},
+		{"DefaultParameterConverter", Var, 0},
+		{"Driver", Type, 0},
+		{"DriverContext", Type, 10},
+		{"ErrBadConn", Var, 0},
+		{"ErrRemoveArgument", Var, 9},
+		{"ErrSkip", Var, 0},
+		{"Execer", Type, 0},
+		{"ExecerContext", Type, 8},
+		{"Int32", Var, 0},
+		{"IsScanValue", Func, 0},
+		{"IsValue", Func, 0},
+		{"IsolationLevel", Type, 8},
+		{"NamedValue", Type, 8},
+		{"NamedValue.Name", Field, 8},
+		{"NamedValue.Ordinal", Field, 8},
+		{"NamedValue.Value", Field, 8},
+		{"NamedValueChecker", Type, 9},
+		{"NotNull", Type, 0},
+		{"NotNull.Converter", Field, 0},
+		{"Null", Type, 0},
+		{"Null.Converter", Field, 0},
+		{"Pinger", Type, 8},
+		{"Queryer", Type, 1},
+		{"QueryerContext", Type, 8},
+		{"Result", Type, 0},
+		{"ResultNoRows", Var, 0},
+		{"Rows", Type, 0},
+		{"RowsAffected", Type, 0},
+		{"RowsColumnTypeDatabaseTypeName", Type, 8},
+		{"RowsColumnTypeLength", Type, 8},
+		{"RowsColumnTypeNullable", Type, 8},
+		{"RowsColumnTypePrecisionScale", Type, 8},
+		{"RowsColumnTypeScanType", Type, 8},
+		{"RowsNextResultSet", Type, 8},
+		{"SessionResetter", Type, 10},
+		{"Stmt", Type, 0},
+		{"StmtExecContext", Type, 8},
+		{"StmtQueryContext", Type, 8},
+		{"String", Var, 0},
+		{"Tx", Type, 0},
+		{"TxOptions", Type, 8},
+		{"TxOptions.Isolation", Field, 8},
+		{"TxOptions.ReadOnly", Field, 8},
+		{"Validator", Type, 15},
+		{"Value", Type, 0},
+		{"ValueConverter", Type, 0},
+		{"Valuer", Type, 0},
+	},
+	"debug/buildinfo": {
+		{"BuildInfo", Type, 18},
+		{"Read", Func, 18},
+		{"ReadFile", Func, 18},
+	},
+	"debug/dwarf": {
+		{"(*AddrType).Basic", Method, 0},
+		{"(*AddrType).Common", Method, 0},
+		{"(*AddrType).Size", Method, 0},
+		{"(*AddrType).String", Method, 0},
+		{"(*ArrayType).Common", Method, 0},
+		{"(*ArrayType).Size", Method, 0},
+		{"(*ArrayType).String", Method, 0},
+		{"(*BasicType).Basic", Method, 0},
+		{"(*BasicType).Common", Method, 0},
+		{"(*BasicType).Size", Method, 0},
+		{"(*BasicType).String", Method, 0},
+		{"(*BoolType).Basic", Method, 0},
+		{"(*BoolType).Common", Method, 0},
+		{"(*BoolType).Size", Method, 0},
+		{"(*BoolType).String", Method, 0},
+		{"(*CharType).Basic", Method, 0},
+		{"(*CharType).Common", Method, 0},
+		{"(*CharType).Size", Method, 0},
+		{"(*CharType).String", Method, 0},
+		{"(*CommonType).Common", Method, 0},
+		{"(*CommonType).Size", Method, 0},
+		{"(*ComplexType).Basic", Method, 0},
+		{"(*ComplexType).Common", Method, 0},
+		{"(*ComplexType).Size", Method, 0},
+		{"(*ComplexType).String", Method, 0},
+		{"(*Data).AddSection", Method, 14},
+		{"(*Data).AddTypes", Method, 3},
+		{"(*Data).LineReader", Method, 5},
+		{"(*Data).Ranges", Method, 7},
+		{"(*Data).Reader", Method, 0},
+		{"(*Data).Type", Method, 0},
+		{"(*DotDotDotType).Common", Method, 0},
+		{"(*DotDotDotType).Size", Method, 0},
+		{"(*DotDotDotType).String", Method, 0},
+		{"(*Entry).AttrField", Method, 5},
+		{"(*Entry).Val", Method, 0},
+		{"(*EnumType).Common", Method, 0},
+		{"(*EnumType).Size", Method, 0},
+		{"(*EnumType).String", Method, 0},
+		{"(*FloatType).Basic", Method, 0},
+		{"(*FloatType).Common", Method, 0},
+		{"(*FloatType).Size", Method, 0},
+		{"(*FloatType).String", Method, 0},
+		{"(*FuncType).Common", Method, 0},
+		{"(*FuncType).Size", Method, 0},
+		{"(*FuncType).String", Method, 0},
+		{"(*IntType).Basic", Method, 0},
+		{"(*IntType).Common", Method, 0},
+		{"(*IntType).Size", Method, 0},
+		{"(*IntType).String", Method, 0},
+		{"(*LineReader).Files", Method, 14},
+		{"(*LineReader).Next", Method, 5},
+		{"(*LineReader).Reset", Method, 5},
+		{"(*LineReader).Seek", Method, 5},
+		{"(*LineReader).SeekPC", Method, 5},
+		{"(*LineReader).Tell", Method, 5},
+		{"(*PtrType).Common", Method, 0},
+		{"(*PtrType).Size", Method, 0},
+		{"(*PtrType).String", Method, 0},
+		{"(*QualType).Common", Method, 0},
+		{"(*QualType).Size", Method, 0},
+		{"(*QualType).String", Method, 0},
+		{"(*Reader).AddressSize", Method, 5},
+		{"(*Reader).ByteOrder", Method, 14},
+		{"(*Reader).Next", Method, 0},
+		{"(*Reader).Seek", Method, 0},
+		{"(*Reader).SeekPC", Method, 7},
+		{"(*Reader).SkipChildren", Method, 0},
+		{"(*StructType).Common", Method, 0},
+		{"(*StructType).Defn", Method, 0},
+		{"(*StructType).Size", Method, 0},
+		{"(*StructType).String", Method, 0},
+		{"(*TypedefType).Common", Method, 0},
+		{"(*TypedefType).Size", Method, 0},
+		{"(*TypedefType).String", Method, 0},
+		{"(*UcharType).Basic", Method, 0},
+		{"(*UcharType).Common", Method, 0},
+		{"(*UcharType).Size", Method, 0},
+		{"(*UcharType).String", Method, 0},
+		{"(*UintType).Basic", Method, 0},
+		{"(*UintType).Common", Method, 0},
+		{"(*UintType).Size", Method, 0},
+		{"(*UintType).String", Method, 0},
+		{"(*UnspecifiedType).Basic", Method, 4},
+		{"(*UnspecifiedType).Common", Method, 4},
+		{"(*UnspecifiedType).Size", Method, 4},
+		{"(*UnspecifiedType).String", Method, 4},
+		{"(*UnsupportedType).Common", Method, 13},
+		{"(*UnsupportedType).Size", Method, 13},
+		{"(*UnsupportedType).String", Method, 13},
+		{"(*VoidType).Common", Method, 0},
+		{"(*VoidType).Size", Method, 0},
+		{"(*VoidType).String", Method, 0},
+		{"(Attr).GoString", Method, 0},
+		{"(Attr).String", Method, 0},
+		{"(Class).GoString", Method, 5},
+		{"(Class).String", Method, 5},
+		{"(DecodeError).Error", Method, 0},
+		{"(Tag).GoString", Method, 0},
+		{"(Tag).String", Method, 0},
+		{"AddrType", Type, 0},
+		{"AddrType.BasicType", Field, 0},
+		{"ArrayType", Type, 0},
+		{"ArrayType.CommonType", Field, 0},
+		{"ArrayType.Count", Field, 0},
+		{"ArrayType.StrideBitSize", Field, 0},
+		{"ArrayType.Type", Field, 0},
+		{"Attr", Type, 0},
+		{"AttrAbstractOrigin", Const, 0},
+		{"AttrAccessibility", Const, 0},
+		{"AttrAddrBase", Const, 14},
+		{"AttrAddrClass", Const, 0},
+		{"AttrAlignment", Const, 14},
+		{"AttrAllocated", Const, 0},
+		{"AttrArtificial", Const, 0},
+		{"AttrAssociated", Const, 0},
+		{"AttrBaseTypes", Const, 0},
+		{"AttrBinaryScale", Const, 14},
+		{"AttrBitOffset", Const, 0},
+		{"AttrBitSize", Const, 0},
+		{"AttrByteSize", Const, 0},
+		{"AttrCallAllCalls", Const, 14},
+		{"AttrCallAllSourceCalls", Const, 14},
+		{"AttrCallAllTailCalls", Const, 14},
+		{"AttrCallColumn", Const, 0},
+		{"AttrCallDataLocation", Const, 14},
+		{"AttrCallDataValue", Const, 14},
+		{"AttrCallFile", Const, 0},
+		{"AttrCallLine", Const, 0},
+		{"AttrCallOrigin", Const, 14},
+		{"AttrCallPC", Const, 14},
+		{"AttrCallParameter", Const, 14},
+		{"AttrCallReturnPC", Const, 14},
+		{"AttrCallTailCall", Const, 14},
+		{"AttrCallTarget", Const, 14},
+		{"AttrCallTargetClobbered", Const, 14},
+		{"AttrCallValue", Const, 14},
+		{"AttrCalling", Const, 0},
+		{"AttrCommonRef", Const, 0},
+		{"AttrCompDir", Const, 0},
+		{"AttrConstExpr", Const, 14},
+		{"AttrConstValue", Const, 0},
+		{"AttrContainingType", Const, 0},
+		{"AttrCount", Const, 0},
+		{"AttrDataBitOffset", Const, 14},
+		{"AttrDataLocation", Const, 0},
+		{"AttrDataMemberLoc", Const, 0},
+		{"AttrDecimalScale", Const, 14},
+		{"AttrDecimalSign", Const, 14},
+		{"AttrDeclColumn", Const, 0},
+		{"AttrDeclFile", Const, 0},
+		{"AttrDeclLine", Const, 0},
+		{"AttrDeclaration", Const, 0},
+		{"AttrDefaultValue", Const, 0},
+		{"AttrDefaulted", Const, 14},
+		{"AttrDeleted", Const, 14},
+		{"AttrDescription", Const, 0},
+		{"AttrDigitCount", Const, 14},
+		{"AttrDiscr", Const, 0},
+		{"AttrDiscrList", Const, 0},
+		{"AttrDiscrValue", Const, 0},
+		{"AttrDwoName", Const, 14},
+		{"AttrElemental", Const, 14},
+		{"AttrEncoding", Const, 0},
+		{"AttrEndianity", Const, 14},
+		{"AttrEntrypc", Const, 0},
+		{"AttrEnumClass", Const, 14},
+		{"AttrExplicit", Const, 14},
+		{"AttrExportSymbols", Const, 14},
+		{"AttrExtension", Const, 0},
+		{"AttrExternal", Const, 0},
+		{"AttrFrameBase", Const, 0},
+		{"AttrFriend", Const, 0},
+		{"AttrHighpc", Const, 0},
+		{"AttrIdentifierCase", Const, 0},
+		{"AttrImport", Const, 0},
+		{"AttrInline", Const, 0},
+		{"AttrIsOptional", Const, 0},
+		{"AttrLanguage", Const, 0},
+		{"AttrLinkageName", Const, 14},
+		{"AttrLocation", Const, 0},
+		{"AttrLoclistsBase", Const, 14},
+		{"AttrLowerBound", Const, 0},
+		{"AttrLowpc", Const, 0},
+		{"AttrMacroInfo", Const, 0},
+		{"AttrMacros", Const, 14},
+		{"AttrMainSubprogram", Const, 14},
+		{"AttrMutable", Const, 14},
+		{"AttrName", Const, 0},
+		{"AttrNamelistItem", Const, 0},
+		{"AttrNoreturn", Const, 14},
+		{"AttrObjectPointer", Const, 14},
+		{"AttrOrdering", Const, 0},
+		{"AttrPictureString", Const, 14},
+		{"AttrPriority", Const, 0},
+		{"AttrProducer", Const, 0},
+		{"AttrPrototyped", Const, 0},
+		{"AttrPure", Const, 14},
+		{"AttrRanges", Const, 0},
+		{"AttrRank", Const, 14},
+		{"AttrRecursive", Const, 14},
+		{"AttrReference", Const, 14},
+		{"AttrReturnAddr", Const, 0},
+		{"AttrRnglistsBase", Const, 14},
+		{"AttrRvalueReference", Const, 14},
+		{"AttrSegment", Const, 0},
+		{"AttrSibling", Const, 0},
+		{"AttrSignature", Const, 14},
+		{"AttrSmall", Const, 14},
+		{"AttrSpecification", Const, 0},
+		{"AttrStartScope", Const, 0},
+		{"AttrStaticLink", Const, 0},
+		{"AttrStmtList", Const, 0},
+		{"AttrStrOffsetsBase", Const, 14},
+		{"AttrStride", Const, 0},
+		{"AttrStrideSize", Const, 0},
+		{"AttrStringLength", Const, 0},
+		{"AttrStringLengthBitSize", Const, 14},
+		{"AttrStringLengthByteSize", Const, 14},
+		{"AttrThreadsScaled", Const, 14},
+		{"AttrTrampoline", Const, 0},
+		{"AttrType", Const, 0},
+		{"AttrUpperBound", Const, 0},
+		{"AttrUseLocation", Const, 0},
+		{"AttrUseUTF8", Const, 0},
+		{"AttrVarParam", Const, 0},
+		{"AttrVirtuality", Const, 0},
+		{"AttrVisibility", Const, 0},
+		{"AttrVtableElemLoc", Const, 0},
+		{"BasicType", Type, 0},
+		{"BasicType.BitOffset", Field, 0},
+		{"BasicType.BitSize", Field, 0},
+		{"BasicType.CommonType", Field, 0},
+		{"BasicType.DataBitOffset", Field, 18},
+		{"BoolType", Type, 0},
+		{"BoolType.BasicType", Field, 0},
+		{"CharType", Type, 0},
+		{"CharType.BasicType", Field, 0},
+		{"Class", Type, 5},
+		{"ClassAddrPtr", Const, 14},
+		{"ClassAddress", Const, 5},
+		{"ClassBlock", Const, 5},
+		{"ClassConstant", Const, 5},
+		{"ClassExprLoc", Const, 5},
+		{"ClassFlag", Const, 5},
+		{"ClassLinePtr", Const, 5},
+		{"ClassLocList", Const, 14},
+		{"ClassLocListPtr", Const, 5},
+		{"ClassMacPtr", Const, 5},
+		{"ClassRangeListPtr", Const, 5},
+		{"ClassReference", Const, 5},
+		{"ClassReferenceAlt", Const, 5},
+		{"ClassReferenceSig", Const, 5},
+		{"ClassRngList", Const, 14},
+		{"ClassRngListsPtr", Const, 14},
+		{"ClassStrOffsetsPtr", Const, 14},
+		{"ClassString", Const, 5},
+		{"ClassStringAlt", Const, 5},
+		{"ClassUnknown", Const, 6},
+		{"CommonType", Type, 0},
+		{"CommonType.ByteSize", Field, 0},
+		{"CommonType.Name", Field, 0},
+		{"ComplexType", Type, 0},
+		{"ComplexType.BasicType", Field, 0},
+		{"Data", Type, 0},
+		{"DecodeError", Type, 0},
+		{"DecodeError.Err", Field, 0},
+		{"DecodeError.Name", Field, 0},
+		{"DecodeError.Offset", Field, 0},
+		{"DotDotDotType", Type, 0},
+		{"DotDotDotType.CommonType", Field, 0},
+		{"Entry", Type, 0},
+		{"Entry.Children", Field, 0},
+		{"Entry.Field", Field, 0},
+		{"Entry.Offset", Field, 0},
+		{"Entry.Tag", Field, 0},
+		{"EnumType", Type, 0},
+		{"EnumType.CommonType", Field, 0},
+		{"EnumType.EnumName", Field, 0},
+		{"EnumType.Val", Field, 0},
+		{"EnumValue", Type, 0},
+		{"EnumValue.Name", Field, 0},
+		{"EnumValue.Val", Field, 0},
+		{"ErrUnknownPC", Var, 5},
+		{"Field", Type, 0},
+		{"Field.Attr", Field, 0},
+		{"Field.Class", Field, 5},
+		{"Field.Val", Field, 0},
+		{"FloatType", Type, 0},
+		{"FloatType.BasicType", Field, 0},
+		{"FuncType", Type, 0},
+		{"FuncType.CommonType", Field, 0},
+		{"FuncType.ParamType", Field, 0},
+		{"FuncType.ReturnType", Field, 0},
+		{"IntType", Type, 0},
+		{"IntType.BasicType", Field, 0},
+		{"LineEntry", Type, 5},
+		{"LineEntry.Address", Field, 5},
+		{"LineEntry.BasicBlock", Field, 5},
+		{"LineEntry.Column", Field, 5},
+		{"LineEntry.Discriminator", Field, 5},
+		{"LineEntry.EndSequence", Field, 5},
+		{"LineEntry.EpilogueBegin", Field, 5},
+		{"LineEntry.File", Field, 5},
+		{"LineEntry.ISA", Field, 5},
+		{"LineEntry.IsStmt", Field, 5},
+		{"LineEntry.Line", Field, 5},
+		{"LineEntry.OpIndex", Field, 5},
+		{"LineEntry.PrologueEnd", Field, 5},
+		{"LineFile", Type, 5},
+		{"LineFile.Length", Field, 5},
+		{"LineFile.Mtime", Field, 5},
+		{"LineFile.Name", Field, 5},
+		{"LineReader", Type, 5},
+		{"LineReaderPos", Type, 5},
+		{"New", Func, 0},
+		{"Offset", Type, 0},
+		{"PtrType", Type, 0},
+		{"PtrType.CommonType", Field, 0},
+		{"PtrType.Type", Field, 0},
+		{"QualType", Type, 0},
+		{"QualType.CommonType", Field, 0},
+		{"QualType.Qual", Field, 0},
+		{"QualType.Type", Field, 0},
+		{"Reader", Type, 0},
+		{"StructField", Type, 0},
+		{"StructField.BitOffset", Field, 0},
+		{"StructField.BitSize", Field, 0},
+		{"StructField.ByteOffset", Field, 0},
+		{"StructField.ByteSize", Field, 0},
+		{"StructField.DataBitOffset", Field, 18},
+		{"StructField.Name", Field, 0},
+		{"StructField.Type", Field, 0},
+		{"StructType", Type, 0},
+		{"StructType.CommonType", Field, 0},
+		{"StructType.Field", Field, 0},
+		{"StructType.Incomplete", Field, 0},
+		{"StructType.Kind", Field, 0},
+		{"StructType.StructName", Field, 0},
+		{"Tag", Type, 0},
+		{"TagAccessDeclaration", Const, 0},
+		{"TagArrayType", Const, 0},
+		{"TagAtomicType", Const, 14},
+		{"TagBaseType", Const, 0},
+		{"TagCallSite", Const, 14},
+		{"TagCallSiteParameter", Const, 14},
+		{"TagCatchDwarfBlock", Const, 0},
+		{"TagClassType", Const, 0},
+		{"TagCoarrayType", Const, 14},
+		{"TagCommonDwarfBlock", Const, 0},
+		{"TagCommonInclusion", Const, 0},
+		{"TagCompileUnit", Const, 0},
+		{"TagCondition", Const, 3},
+		{"TagConstType", Const, 0},
+		{"TagConstant", Const, 0},
+		{"TagDwarfProcedure", Const, 0},
+		{"TagDynamicType", Const, 14},
+		{"TagEntryPoint", Const, 0},
+		{"TagEnumerationType", Const, 0},
+		{"TagEnumerator", Const, 0},
+		{"TagFileType", Const, 0},
+		{"TagFormalParameter", Const, 0},
+		{"TagFriend", Const, 0},
+		{"TagGenericSubrange", Const, 14},
+		{"TagImmutableType", Const, 14},
+		{"TagImportedDeclaration", Const, 0},
+		{"TagImportedModule", Const, 0},
+		{"TagImportedUnit", Const, 0},
+		{"TagInheritance", Const, 0},
+		{"TagInlinedSubroutine", Const, 0},
+		{"TagInterfaceType", Const, 0},
+		{"TagLabel", Const, 0},
+		{"TagLexDwarfBlock", Const, 0},
+		{"TagMember", Const, 0},
+		{"TagModule", Const, 0},
+		{"TagMutableType", Const, 0},
+		{"TagNamelist", Const, 0},
+		{"TagNamelistItem", Const, 0},
+		{"TagNamespace", Const, 0},
+		{"TagPackedType", Const, 0},
+		{"TagPartialUnit", Const, 0},
+		{"TagPointerType", Const, 0},
+		{"TagPtrToMemberType", Const, 0},
+		{"TagReferenceType", Const, 0},
+		{"TagRestrictType", Const, 0},
+		{"TagRvalueReferenceType", Const, 3},
+		{"TagSetType", Const, 0},
+		{"TagSharedType", Const, 3},
+		{"TagSkeletonUnit", Const, 14},
+		{"TagStringType", Const, 0},
+		{"TagStructType", Const, 0},
+		{"TagSubprogram", Const, 0},
+		{"TagSubrangeType", Const, 0},
+		{"TagSubroutineType", Const, 0},
+		{"TagTemplateAlias", Const, 3},
+		{"TagTemplateTypeParameter", Const, 0},
+		{"TagTemplateValueParameter", Const, 0},
+		{"TagThrownType", Const, 0},
+		{"TagTryDwarfBlock", Const, 0},
+		{"TagTypeUnit", Const, 3},
+		{"TagTypedef", Const, 0},
+		{"TagUnionType", Const, 0},
+		{"TagUnspecifiedParameters", Const, 0},
+		{"TagUnspecifiedType", Const, 0},
+		{"TagVariable", Const, 0},
+		{"TagVariant", Const, 0},
+		{"TagVariantPart", Const, 0},
+		{"TagVolatileType", Const, 0},
+		{"TagWithStmt", Const, 0},
+		{"Type", Type, 0},
+		{"TypedefType", Type, 0},
+		{"TypedefType.CommonType", Field, 0},
+		{"TypedefType.Type", Field, 0},
+		{"UcharType", Type, 0},
+		{"UcharType.BasicType", Field, 0},
+		{"UintType", Type, 0},
+		{"UintType.BasicType", Field, 0},
+		{"UnspecifiedType", Type, 4},
+		{"UnspecifiedType.BasicType", Field, 4},
+		{"UnsupportedType", Type, 13},
+		{"UnsupportedType.CommonType", Field, 13},
+		{"UnsupportedType.Tag", Field, 13},
+		{"VoidType", Type, 0},
+		{"VoidType.CommonType", Field, 0},
+	},
+	"debug/elf": {
+		{"(*File).Close", Method, 0},
+		{"(*File).DWARF", Method, 0},
+		{"(*File).DynString", Method, 1},
+		{"(*File).DynValue", Method, 21},
+		{"(*File).DynamicSymbols", Method, 4},
+		{"(*File).ImportedLibraries", Method, 0},
+		{"(*File).ImportedSymbols", Method, 0},
+		{"(*File).Section", Method, 0},
+		{"(*File).SectionByType", Method, 0},
+		{"(*File).Symbols", Method, 0},
+		{"(*FormatError).Error", Method, 0},
+		{"(*Prog).Open", Method, 0},
+		{"(*Section).Data", Method, 0},
+		{"(*Section).Open", Method, 0},
+		{"(Class).GoString", Method, 0},
+		{"(Class).String", Method, 0},
+		{"(CompressionType).GoString", Method, 6},
+		{"(CompressionType).String", Method, 6},
+		{"(Data).GoString", Method, 0},
+		{"(Data).String", Method, 0},
+		{"(DynFlag).GoString", Method, 0},
+		{"(DynFlag).String", Method, 0},
+		{"(DynFlag1).GoString", Method, 21},
+		{"(DynFlag1).String", Method, 21},
+		{"(DynTag).GoString", Method, 0},
+		{"(DynTag).String", Method, 0},
+		{"(Machine).GoString", Method, 0},
+		{"(Machine).String", Method, 0},
+		{"(NType).GoString", Method, 0},
+		{"(NType).String", Method, 0},
+		{"(OSABI).GoString", Method, 0},
+		{"(OSABI).String", Method, 0},
+		{"(Prog).ReadAt", Method, 0},
+		{"(ProgFlag).GoString", Method, 0},
+		{"(ProgFlag).String", Method, 0},
+		{"(ProgType).GoString", Method, 0},
+		{"(ProgType).String", Method, 0},
+		{"(R_386).GoString", Method, 0},
+		{"(R_386).String", Method, 0},
+		{"(R_390).GoString", Method, 7},
+		{"(R_390).String", Method, 7},
+		{"(R_AARCH64).GoString", Method, 4},
+		{"(R_AARCH64).String", Method, 4},
+		{"(R_ALPHA).GoString", Method, 0},
+		{"(R_ALPHA).String", Method, 0},
+		{"(R_ARM).GoString", Method, 0},
+		{"(R_ARM).String", Method, 0},
+		{"(R_LARCH).GoString", Method, 19},
+		{"(R_LARCH).String", Method, 19},
+		{"(R_MIPS).GoString", Method, 6},
+		{"(R_MIPS).String", Method, 6},
+		{"(R_PPC).GoString", Method, 0},
+		{"(R_PPC).String", Method, 0},
+		{"(R_PPC64).GoString", Method, 5},
+		{"(R_PPC64).String", Method, 5},
+		{"(R_RISCV).GoString", Method, 11},
+		{"(R_RISCV).String", Method, 11},
+		{"(R_SPARC).GoString", Method, 0},
+		{"(R_SPARC).String", Method, 0},
+		{"(R_X86_64).GoString", Method, 0},
+		{"(R_X86_64).String", Method, 0},
+		{"(Section).ReadAt", Method, 0},
+		{"(SectionFlag).GoString", Method, 0},
+		{"(SectionFlag).String", Method, 0},
+		{"(SectionIndex).GoString", Method, 0},
+		{"(SectionIndex).String", Method, 0},
+		{"(SectionType).GoString", Method, 0},
+		{"(SectionType).String", Method, 0},
+		{"(SymBind).GoString", Method, 0},
+		{"(SymBind).String", Method, 0},
+		{"(SymType).GoString", Method, 0},
+		{"(SymType).String", Method, 0},
+		{"(SymVis).GoString", Method, 0},
+		{"(SymVis).String", Method, 0},
+		{"(Type).GoString", Method, 0},
+		{"(Type).String", Method, 0},
+		{"(Version).GoString", Method, 0},
+		{"(Version).String", Method, 0},
+		{"ARM_MAGIC_TRAMP_NUMBER", Const, 0},
+		{"COMPRESS_HIOS", Const, 6},
+		{"COMPRESS_HIPROC", Const, 6},
+		{"COMPRESS_LOOS", Const, 6},
+		{"COMPRESS_LOPROC", Const, 6},
+		{"COMPRESS_ZLIB", Const, 6},
+		{"COMPRESS_ZSTD", Const, 21},
+		{"Chdr32", Type, 6},
+		{"Chdr32.Addralign", Field, 6},
+		{"Chdr32.Size", Field, 6},
+		{"Chdr32.Type", Field, 6},
+		{"Chdr64", Type, 6},
+		{"Chdr64.Addralign", Field, 6},
+		{"Chdr64.Size", Field, 6},
+		{"Chdr64.Type", Field, 6},
+		{"Class", Type, 0},
+		{"CompressionType", Type, 6},
+		{"DF_1_CONFALT", Const, 21},
+		{"DF_1_DIRECT", Const, 21},
+		{"DF_1_DISPRELDNE", Const, 21},
+		{"DF_1_DISPRELPND", Const, 21},
+		{"DF_1_EDITED", Const, 21},
+		{"DF_1_ENDFILTEE", Const, 21},
+		{"DF_1_GLOBAL", Const, 21},
+		{"DF_1_GLOBAUDIT", Const, 21},
+		{"DF_1_GROUP", Const, 21},
+		{"DF_1_IGNMULDEF", Const, 21},
+		{"DF_1_INITFIRST", Const, 21},
+		{"DF_1_INTERPOSE", Const, 21},
+		{"DF_1_KMOD", Const, 21},
+		{"DF_1_LOADFLTR", Const, 21},
+		{"DF_1_NOCOMMON", Const, 21},
+		{"DF_1_NODEFLIB", Const, 21},
+		{"DF_1_NODELETE", Const, 21},
+		{"DF_1_NODIRECT", Const, 21},
+		{"DF_1_NODUMP", Const, 21},
+		{"DF_1_NOHDR", Const, 21},
+		{"DF_1_NOKSYMS", Const, 21},
+		{"DF_1_NOOPEN", Const, 21},
+		{"DF_1_NORELOC", Const, 21},
+		{"DF_1_NOW", Const, 21},
+		{"DF_1_ORIGIN", Const, 21},
+		{"DF_1_PIE", Const, 21},
+		{"DF_1_SINGLETON", Const, 21},
+		{"DF_1_STUB", Const, 21},
+		{"DF_1_SYMINTPOSE", Const, 21},
+		{"DF_1_TRANS", Const, 21},
+		{"DF_1_WEAKFILTER", Const, 21},
+		{"DF_BIND_NOW", Const, 0},
+		{"DF_ORIGIN", Const, 0},
+		{"DF_STATIC_TLS", Const, 0},
+		{"DF_SYMBOLIC", Const, 0},
+		{"DF_TEXTREL", Const, 0},
+		{"DT_ADDRRNGHI", Const, 16},
+		{"DT_ADDRRNGLO", Const, 16},
+		{"DT_AUDIT", Const, 16},
+		{"DT_AUXILIARY", Const, 16},
+		{"DT_BIND_NOW", Const, 0},
+		{"DT_CHECKSUM", Const, 16},
+		{"DT_CONFIG", Const, 16},
+		{"DT_DEBUG", Const, 0},
+		{"DT_DEPAUDIT", Const, 16},
+		{"DT_ENCODING", Const, 0},
+		{"DT_FEATURE", Const, 16},
+		{"DT_FILTER", Const, 16},
+		{"DT_FINI", Const, 0},
+		{"DT_FINI_ARRAY", Const, 0},
+		{"DT_FINI_ARRAYSZ", Const, 0},
+		{"DT_FLAGS", Const, 0},
+		{"DT_FLAGS_1", Const, 16},
+		{"DT_GNU_CONFLICT", Const, 16},
+		{"DT_GNU_CONFLICTSZ", Const, 16},
+		{"DT_GNU_HASH", Const, 16},
+		{"DT_GNU_LIBLIST", Const, 16},
+		{"DT_GNU_LIBLISTSZ", Const, 16},
+		{"DT_GNU_PRELINKED", Const, 16},
+		{"DT_HASH", Const, 0},
+		{"DT_HIOS", Const, 0},
+		{"DT_HIPROC", Const, 0},
+		{"DT_INIT", Const, 0},
+		{"DT_INIT_ARRAY", Const, 0},
+		{"DT_INIT_ARRAYSZ", Const, 0},
+		{"DT_JMPREL", Const, 0},
+		{"DT_LOOS", Const, 0},
+		{"DT_LOPROC", Const, 0},
+		{"DT_MIPS_AUX_DYNAMIC", Const, 16},
+		{"DT_MIPS_BASE_ADDRESS", Const, 16},
+		{"DT_MIPS_COMPACT_SIZE", Const, 16},
+		{"DT_MIPS_CONFLICT", Const, 16},
+		{"DT_MIPS_CONFLICTNO", Const, 16},
+		{"DT_MIPS_CXX_FLAGS", Const, 16},
+		{"DT_MIPS_DELTA_CLASS", Const, 16},
+		{"DT_MIPS_DELTA_CLASSSYM", Const, 16},
+		{"DT_MIPS_DELTA_CLASSSYM_NO", Const, 16},
+		{"DT_MIPS_DELTA_CLASS_NO", Const, 16},
+		{"DT_MIPS_DELTA_INSTANCE", Const, 16},
+		{"DT_MIPS_DELTA_INSTANCE_NO", Const, 16},
+		{"DT_MIPS_DELTA_RELOC", Const, 16},
+		{"DT_MIPS_DELTA_RELOC_NO", Const, 16},
+		{"DT_MIPS_DELTA_SYM", Const, 16},
+		{"DT_MIPS_DELTA_SYM_NO", Const, 16},
+		{"DT_MIPS_DYNSTR_ALIGN", Const, 16},
+		{"DT_MIPS_FLAGS", Const, 16},
+		{"DT_MIPS_GOTSYM", Const, 16},
+		{"DT_MIPS_GP_VALUE", Const, 16},
+		{"DT_MIPS_HIDDEN_GOTIDX", Const, 16},
+		{"DT_MIPS_HIPAGENO", Const, 16},
+		{"DT_MIPS_ICHECKSUM", Const, 16},
+		{"DT_MIPS_INTERFACE", Const, 16},
+		{"DT_MIPS_INTERFACE_SIZE", Const, 16},
+		{"DT_MIPS_IVERSION", Const, 16},
+		{"DT_MIPS_LIBLIST", Const, 16},
+		{"DT_MIPS_LIBLISTNO", Const, 16},
+		{"DT_MIPS_LOCALPAGE_GOTIDX", Const, 16},
+		{"DT_MIPS_LOCAL_GOTIDX", Const, 16},
+		{"DT_MIPS_LOCAL_GOTNO", Const, 16},
+		{"DT_MIPS_MSYM", Const, 16},
+		{"DT_MIPS_OPTIONS", Const, 16},
+		{"DT_MIPS_PERF_SUFFIX", Const, 16},
+		{"DT_MIPS_PIXIE_INIT", Const, 16},
+		{"DT_MIPS_PLTGOT", Const, 16},
+		{"DT_MIPS_PROTECTED_GOTIDX", Const, 16},
+		{"DT_MIPS_RLD_MAP", Const, 16},
+		{"DT_MIPS_RLD_MAP_REL", Const, 16},
+		{"DT_MIPS_RLD_TEXT_RESOLVE_ADDR", Const, 16},
+		{"DT_MIPS_RLD_VERSION", Const, 16},
+		{"DT_MIPS_RWPLT", Const, 16},
+		{"DT_MIPS_SYMBOL_LIB", Const, 16},
+		{"DT_MIPS_SYMTABNO", Const, 16},
+		{"DT_MIPS_TIME_STAMP", Const, 16},
+		{"DT_MIPS_UNREFEXTNO", Const, 16},
+		{"DT_MOVEENT", Const, 16},
+		{"DT_MOVESZ", Const, 16},
+		{"DT_MOVETAB", Const, 16},
+		{"DT_NEEDED", Const, 0},
+		{"DT_NULL", Const, 0},
+		{"DT_PLTGOT", Const, 0},
+		{"DT_PLTPAD", Const, 16},
+		{"DT_PLTPADSZ", Const, 16},
+		{"DT_PLTREL", Const, 0},
+		{"DT_PLTRELSZ", Const, 0},
+		{"DT_POSFLAG_1", Const, 16},
+		{"DT_PPC64_GLINK", Const, 16},
+		{"DT_PPC64_OPD", Const, 16},
+		{"DT_PPC64_OPDSZ", Const, 16},
+		{"DT_PPC64_OPT", Const, 16},
+		{"DT_PPC_GOT", Const, 16},
+		{"DT_PPC_OPT", Const, 16},
+		{"DT_PREINIT_ARRAY", Const, 0},
+		{"DT_PREINIT_ARRAYSZ", Const, 0},
+		{"DT_REL", Const, 0},
+		{"DT_RELA", Const, 0},
+		{"DT_RELACOUNT", Const, 16},
+		{"DT_RELAENT", Const, 0},
+		{"DT_RELASZ", Const, 0},
+		{"DT_RELCOUNT", Const, 16},
+		{"DT_RELENT", Const, 0},
+		{"DT_RELSZ", Const, 0},
+		{"DT_RPATH", Const, 0},
+		{"DT_RUNPATH", Const, 0},
+		{"DT_SONAME", Const, 0},
+		{"DT_SPARC_REGISTER", Const, 16},
+		{"DT_STRSZ", Const, 0},
+		{"DT_STRTAB", Const, 0},
+		{"DT_SYMBOLIC", Const, 0},
+		{"DT_SYMENT", Const, 0},
+		{"DT_SYMINENT", Const, 16},
+		{"DT_SYMINFO", Const, 16},
+		{"DT_SYMINSZ", Const, 16},
+		{"DT_SYMTAB", Const, 0},
+		{"DT_SYMTAB_SHNDX", Const, 16},
+		{"DT_TEXTREL", Const, 0},
+		{"DT_TLSDESC_GOT", Const, 16},
+		{"DT_TLSDESC_PLT", Const, 16},
+		{"DT_USED", Const, 16},
+		{"DT_VALRNGHI", Const, 16},
+		{"DT_VALRNGLO", Const, 16},
+		{"DT_VERDEF", Const, 16},
+		{"DT_VERDEFNUM", Const, 16},
+		{"DT_VERNEED", Const, 0},
+		{"DT_VERNEEDNUM", Const, 0},
+		{"DT_VERSYM", Const, 0},
+		{"Data", Type, 0},
+		{"Dyn32", Type, 0},
+		{"Dyn32.Tag", Field, 0},
+		{"Dyn32.Val", Field, 0},
+		{"Dyn64", Type, 0},
+		{"Dyn64.Tag", Field, 0},
+		{"Dyn64.Val", Field, 0},
+		{"DynFlag", Type, 0},
+		{"DynFlag1", Type, 21},
+		{"DynTag", Type, 0},
+		{"EI_ABIVERSION", Const, 0},
+		{"EI_CLASS", Const, 0},
+		{"EI_DATA", Const, 0},
+		{"EI_NIDENT", Const, 0},
+		{"EI_OSABI", Const, 0},
+		{"EI_PAD", Const, 0},
+		{"EI_VERSION", Const, 0},
+		{"ELFCLASS32", Const, 0},
+		{"ELFCLASS64", Const, 0},
+		{"ELFCLASSNONE", Const, 0},
+		{"ELFDATA2LSB", Const, 0},
+		{"ELFDATA2MSB", Const, 0},
+		{"ELFDATANONE", Const, 0},
+		{"ELFMAG", Const, 0},
+		{"ELFOSABI_86OPEN", Const, 0},
+		{"ELFOSABI_AIX", Const, 0},
+		{"ELFOSABI_ARM", Const, 0},
+		{"ELFOSABI_AROS", Const, 11},
+		{"ELFOSABI_CLOUDABI", Const, 11},
+		{"ELFOSABI_FENIXOS", Const, 11},
+		{"ELFOSABI_FREEBSD", Const, 0},
+		{"ELFOSABI_HPUX", Const, 0},
+		{"ELFOSABI_HURD", Const, 0},
+		{"ELFOSABI_IRIX", Const, 0},
+		{"ELFOSABI_LINUX", Const, 0},
+		{"ELFOSABI_MODESTO", Const, 0},
+		{"ELFOSABI_NETBSD", Const, 0},
+		{"ELFOSABI_NONE", Const, 0},
+		{"ELFOSABI_NSK", Const, 0},
+		{"ELFOSABI_OPENBSD", Const, 0},
+		{"ELFOSABI_OPENVMS", Const, 0},
+		{"ELFOSABI_SOLARIS", Const, 0},
+		{"ELFOSABI_STANDALONE", Const, 0},
+		{"ELFOSABI_TRU64", Const, 0},
+		{"EM_386", Const, 0},
+		{"EM_486", Const, 0},
+		{"EM_56800EX", Const, 11},
+		{"EM_68HC05", Const, 11},
+		{"EM_68HC08", Const, 11},
+		{"EM_68HC11", Const, 11},
+		{"EM_68HC12", Const, 0},
+		{"EM_68HC16", Const, 11},
+		{"EM_68K", Const, 0},
+		{"EM_78KOR", Const, 11},
+		{"EM_8051", Const, 11},
+		{"EM_860", Const, 0},
+		{"EM_88K", Const, 0},
+		{"EM_960", Const, 0},
+		{"EM_AARCH64", Const, 4},
+		{"EM_ALPHA", Const, 0},
+		{"EM_ALPHA_STD", Const, 0},
+		{"EM_ALTERA_NIOS2", Const, 11},
+		{"EM_AMDGPU", Const, 11},
+		{"EM_ARC", Const, 0},
+		{"EM_ARCA", Const, 11},
+		{"EM_ARC_COMPACT", Const, 11},
+		{"EM_ARC_COMPACT2", Const, 11},
+		{"EM_ARM", Const, 0},
+		{"EM_AVR", Const, 11},
+		{"EM_AVR32", Const, 11},
+		{"EM_BA1", Const, 11},
+		{"EM_BA2", Const, 11},
+		{"EM_BLACKFIN", Const, 11},
+		{"EM_BPF", Const, 11},
+		{"EM_C166", Const, 11},
+		{"EM_CDP", Const, 11},
+		{"EM_CE", Const, 11},
+		{"EM_CLOUDSHIELD", Const, 11},
+		{"EM_COGE", Const, 11},
+		{"EM_COLDFIRE", Const, 0},
+		{"EM_COOL", Const, 11},
+		{"EM_COREA_1ST", Const, 11},
+		{"EM_COREA_2ND", Const, 11},
+		{"EM_CR", Const, 11},
+		{"EM_CR16", Const, 11},
+		{"EM_CRAYNV2", Const, 11},
+		{"EM_CRIS", Const, 11},
+		{"EM_CRX", Const, 11},
+		{"EM_CSR_KALIMBA", Const, 11},
+		{"EM_CUDA", Const, 11},
+		{"EM_CYPRESS_M8C", Const, 11},
+		{"EM_D10V", Const, 11},
+		{"EM_D30V", Const, 11},
+		{"EM_DSP24", Const, 11},
+		{"EM_DSPIC30F", Const, 11},
+		{"EM_DXP", Const, 11},
+		{"EM_ECOG1", Const, 11},
+		{"EM_ECOG16", Const, 11},
+		{"EM_ECOG1X", Const, 11},
+		{"EM_ECOG2", Const, 11},
+		{"EM_ETPU", Const, 11},
+		{"EM_EXCESS", Const, 11},
+		{"EM_F2MC16", Const, 11},
+		{"EM_FIREPATH", Const, 11},
+		{"EM_FR20", Const, 0},
+		{"EM_FR30", Const, 11},
+		{"EM_FT32", Const, 11},
+		{"EM_FX66", Const, 11},
+		{"EM_H8S", Const, 0},
+		{"EM_H8_300", Const, 0},
+		{"EM_H8_300H", Const, 0},
+		{"EM_H8_500", Const, 0},
+		{"EM_HUANY", Const, 11},
+		{"EM_IA_64", Const, 0},
+		{"EM_INTEL205", Const, 11},
+		{"EM_INTEL206", Const, 11},
+		{"EM_INTEL207", Const, 11},
+		{"EM_INTEL208", Const, 11},
+		{"EM_INTEL209", Const, 11},
+		{"EM_IP2K", Const, 11},
+		{"EM_JAVELIN", Const, 11},
+		{"EM_K10M", Const, 11},
+		{"EM_KM32", Const, 11},
+		{"EM_KMX16", Const, 11},
+		{"EM_KMX32", Const, 11},
+		{"EM_KMX8", Const, 11},
+		{"EM_KVARC", Const, 11},
+		{"EM_L10M", Const, 11},
+		{"EM_LANAI", Const, 11},
+		{"EM_LATTICEMICO32", Const, 11},
+		{"EM_LOONGARCH", Const, 19},
+		{"EM_M16C", Const, 11},
+		{"EM_M32", Const, 0},
+		{"EM_M32C", Const, 11},
+		{"EM_M32R", Const, 11},
+		{"EM_MANIK", Const, 11},
+		{"EM_MAX", Const, 11},
+		{"EM_MAXQ30", Const, 11},
+		{"EM_MCHP_PIC", Const, 11},
+		{"EM_MCST_ELBRUS", Const, 11},
+		{"EM_ME16", Const, 0},
+		{"EM_METAG", Const, 11},
+		{"EM_MICROBLAZE", Const, 11},
+		{"EM_MIPS", Const, 0},
+		{"EM_MIPS_RS3_LE", Const, 0},
+		{"EM_MIPS_RS4_BE", Const, 0},
+		{"EM_MIPS_X", Const, 0},
+		{"EM_MMA", Const, 0},
+		{"EM_MMDSP_PLUS", Const, 11},
+		{"EM_MMIX", Const, 11},
+		{"EM_MN10200", Const, 11},
+		{"EM_MN10300", Const, 11},
+		{"EM_MOXIE", Const, 11},
+		{"EM_MSP430", Const, 11},
+		{"EM_NCPU", Const, 0},
+		{"EM_NDR1", Const, 0},
+		{"EM_NDS32", Const, 11},
+		{"EM_NONE", Const, 0},
+		{"EM_NORC", Const, 11},
+		{"EM_NS32K", Const, 11},
+		{"EM_OPEN8", Const, 11},
+		{"EM_OPENRISC", Const, 11},
+		{"EM_PARISC", Const, 0},
+		{"EM_PCP", Const, 0},
+		{"EM_PDP10", Const, 11},
+		{"EM_PDP11", Const, 11},
+		{"EM_PDSP", Const, 11},
+		{"EM_PJ", Const, 11},
+		{"EM_PPC", Const, 0},
+		{"EM_PPC64", Const, 0},
+		{"EM_PRISM", Const, 11},
+		{"EM_QDSP6", Const, 11},
+		{"EM_R32C", Const, 11},
+		{"EM_RCE", Const, 0},
+		{"EM_RH32", Const, 0},
+		{"EM_RISCV", Const, 11},
+		{"EM_RL78", Const, 11},
+		{"EM_RS08", Const, 11},
+		{"EM_RX", Const, 11},
+		{"EM_S370", Const, 0},
+		{"EM_S390", Const, 0},
+		{"EM_SCORE7", Const, 11},
+		{"EM_SEP", Const, 11},
+		{"EM_SE_C17", Const, 11},
+		{"EM_SE_C33", Const, 11},
+		{"EM_SH", Const, 0},
+		{"EM_SHARC", Const, 11},
+		{"EM_SLE9X", Const, 11},
+		{"EM_SNP1K", Const, 11},
+		{"EM_SPARC", Const, 0},
+		{"EM_SPARC32PLUS", Const, 0},
+		{"EM_SPARCV9", Const, 0},
+		{"EM_ST100", Const, 0},
+		{"EM_ST19", Const, 11},
+		{"EM_ST200", Const, 11},
+		{"EM_ST7", Const, 11},
+		{"EM_ST9PLUS", Const, 11},
+		{"EM_STARCORE", Const, 0},
+		{"EM_STM8", Const, 11},
+		{"EM_STXP7X", Const, 11},
+		{"EM_SVX", Const, 11},
+		{"EM_TILE64", Const, 11},
+		{"EM_TILEGX", Const, 11},
+		{"EM_TILEPRO", Const, 11},
+		{"EM_TINYJ", Const, 0},
+		{"EM_TI_ARP32", Const, 11},
+		{"EM_TI_C2000", Const, 11},
+		{"EM_TI_C5500", Const, 11},
+		{"EM_TI_C6000", Const, 11},
+		{"EM_TI_PRU", Const, 11},
+		{"EM_TMM_GPP", Const, 11},
+		{"EM_TPC", Const, 11},
+		{"EM_TRICORE", Const, 0},
+		{"EM_TRIMEDIA", Const, 11},
+		{"EM_TSK3000", Const, 11},
+		{"EM_UNICORE", Const, 11},
+		{"EM_V800", Const, 0},
+		{"EM_V850", Const, 11},
+		{"EM_VAX", Const, 11},
+		{"EM_VIDEOCORE", Const, 11},
+		{"EM_VIDEOCORE3", Const, 11},
+		{"EM_VIDEOCORE5", Const, 11},
+		{"EM_VISIUM", Const, 11},
+		{"EM_VPP500", Const, 0},
+		{"EM_X86_64", Const, 0},
+		{"EM_XCORE", Const, 11},
+		{"EM_XGATE", Const, 11},
+		{"EM_XIMO16", Const, 11},
+		{"EM_XTENSA", Const, 11},
+		{"EM_Z80", Const, 11},
+		{"EM_ZSP", Const, 11},
+		{"ET_CORE", Const, 0},
+		{"ET_DYN", Const, 0},
+		{"ET_EXEC", Const, 0},
+		{"ET_HIOS", Const, 0},
+		{"ET_HIPROC", Const, 0},
+		{"ET_LOOS", Const, 0},
+		{"ET_LOPROC", Const, 0},
+		{"ET_NONE", Const, 0},
+		{"ET_REL", Const, 0},
+		{"EV_CURRENT", Const, 0},
+		{"EV_NONE", Const, 0},
+		{"ErrNoSymbols", Var, 4},
+		{"File", Type, 0},
+		{"File.FileHeader", Field, 0},
+		{"File.Progs", Field, 0},
+		{"File.Sections", Field, 0},
+		{"FileHeader", Type, 0},
+		{"FileHeader.ABIVersion", Field, 0},
+		{"FileHeader.ByteOrder", Field, 0},
+		{"FileHeader.Class", Field, 0},
+		{"FileHeader.Data", Field, 0},
+		{"FileHeader.Entry", Field, 1},
+		{"FileHeader.Machine", Field, 0},
+		{"FileHeader.OSABI", Field, 0},
+		{"FileHeader.Type", Field, 0},
+		{"FileHeader.Version", Field, 0},
+		{"FormatError", Type, 0},
+		{"Header32", Type, 0},
+		{"Header32.Ehsize", Field, 0},
+		{"Header32.Entry", Field, 0},
+		{"Header32.Flags", Field, 0},
+		{"Header32.Ident", Field, 0},
+		{"Header32.Machine", Field, 0},
+		{"Header32.Phentsize", Field, 0},
+		{"Header32.Phnum", Field, 0},
+		{"Header32.Phoff", Field, 0},
+		{"Header32.Shentsize", Field, 0},
+		{"Header32.Shnum", Field, 0},
+		{"Header32.Shoff", Field, 0},
+		{"Header32.Shstrndx", Field, 0},
+		{"Header32.Type", Field, 0},
+		{"Header32.Version", Field, 0},
+		{"Header64", Type, 0},
+		{"Header64.Ehsize", Field, 0},
+		{"Header64.Entry", Field, 0},
+		{"Header64.Flags", Field, 0},
+		{"Header64.Ident", Field, 0},
+		{"Header64.Machine", Field, 0},
+		{"Header64.Phentsize", Field, 0},
+		{"Header64.Phnum", Field, 0},
+		{"Header64.Phoff", Field, 0},
+		{"Header64.Shentsize", Field, 0},
+		{"Header64.Shnum", Field, 0},
+		{"Header64.Shoff", Field, 0},
+		{"Header64.Shstrndx", Field, 0},
+		{"Header64.Type", Field, 0},
+		{"Header64.Version", Field, 0},
+		{"ImportedSymbol", Type, 0},
+		{"ImportedSymbol.Library", Field, 0},
+		{"ImportedSymbol.Name", Field, 0},
+		{"ImportedSymbol.Version", Field, 0},
+		{"Machine", Type, 0},
+		{"NT_FPREGSET", Const, 0},
+		{"NT_PRPSINFO", Const, 0},
+		{"NT_PRSTATUS", Const, 0},
+		{"NType", Type, 0},
+		{"NewFile", Func, 0},
+		{"OSABI", Type, 0},
+		{"Open", Func, 0},
+		{"PF_MASKOS", Const, 0},
+		{"PF_MASKPROC", Const, 0},
+		{"PF_R", Const, 0},
+		{"PF_W", Const, 0},
+		{"PF_X", Const, 0},
+		{"PT_AARCH64_ARCHEXT", Const, 16},
+		{"PT_AARCH64_UNWIND", Const, 16},
+		{"PT_ARM_ARCHEXT", Const, 16},
+		{"PT_ARM_EXIDX", Const, 16},
+		{"PT_DYNAMIC", Const, 0},
+		{"PT_GNU_EH_FRAME", Const, 16},
+		{"PT_GNU_MBIND_HI", Const, 16},
+		{"PT_GNU_MBIND_LO", Const, 16},
+		{"PT_GNU_PROPERTY", Const, 16},
+		{"PT_GNU_RELRO", Const, 16},
+		{"PT_GNU_STACK", Const, 16},
+		{"PT_HIOS", Const, 0},
+		{"PT_HIPROC", Const, 0},
+		{"PT_INTERP", Const, 0},
+		{"PT_LOAD", Const, 0},
+		{"PT_LOOS", Const, 0},
+		{"PT_LOPROC", Const, 0},
+		{"PT_MIPS_ABIFLAGS", Const, 16},
+		{"PT_MIPS_OPTIONS", Const, 16},
+		{"PT_MIPS_REGINFO", Const, 16},
+		{"PT_MIPS_RTPROC", Const, 16},
+		{"PT_NOTE", Const, 0},
+		{"PT_NULL", Const, 0},
+		{"PT_OPENBSD_BOOTDATA", Const, 16},
+		{"PT_OPENBSD_RANDOMIZE", Const, 16},
+		{"PT_OPENBSD_WXNEEDED", Const, 16},
+		{"PT_PAX_FLAGS", Const, 16},
+		{"PT_PHDR", Const, 0},
+		{"PT_S390_PGSTE", Const, 16},
+		{"PT_SHLIB", Const, 0},
+		{"PT_SUNWSTACK", Const, 16},
+		{"PT_SUNW_EH_FRAME", Const, 16},
+		{"PT_TLS", Const, 0},
+		{"Prog", Type, 0},
+		{"Prog.ProgHeader", Field, 0},
+		{"Prog.ReaderAt", Field, 0},
+		{"Prog32", Type, 0},
+		{"Prog32.Align", Field, 0},
+		{"Prog32.Filesz", Field, 0},
+		{"Prog32.Flags", Field, 0},
+		{"Prog32.Memsz", Field, 0},
+		{"Prog32.Off", Field, 0},
+		{"Prog32.Paddr", Field, 0},
+		{"Prog32.Type", Field, 0},
+		{"Prog32.Vaddr", Field, 0},
+		{"Prog64", Type, 0},
+		{"Prog64.Align", Field, 0},
+		{"Prog64.Filesz", Field, 0},
+		{"Prog64.Flags", Field, 0},
+		{"Prog64.Memsz", Field, 0},
+		{"Prog64.Off", Field, 0},
+		{"Prog64.Paddr", Field, 0},
+		{"Prog64.Type", Field, 0},
+		{"Prog64.Vaddr", Field, 0},
+		{"ProgFlag", Type, 0},
+		{"ProgHeader", Type, 0},
+		{"ProgHeader.Align", Field, 0},
+		{"ProgHeader.Filesz", Field, 0},
+		{"ProgHeader.Flags", Field, 0},
+		{"ProgHeader.Memsz", Field, 0},
+		{"ProgHeader.Off", Field, 0},
+		{"ProgHeader.Paddr", Field, 0},
+		{"ProgHeader.Type", Field, 0},
+		{"ProgHeader.Vaddr", Field, 0},
+		{"ProgType", Type, 0},
+		{"R_386", Type, 0},
+		{"R_386_16", Const, 10},
+		{"R_386_32", Const, 0},
+		{"R_386_32PLT", Const, 10},
+		{"R_386_8", Const, 10},
+		{"R_386_COPY", Const, 0},
+		{"R_386_GLOB_DAT", Const, 0},
+		{"R_386_GOT32", Const, 0},
+		{"R_386_GOT32X", Const, 10},
+		{"R_386_GOTOFF", Const, 0},
+		{"R_386_GOTPC", Const, 0},
+		{"R_386_IRELATIVE", Const, 10},
+		{"R_386_JMP_SLOT", Const, 0},
+		{"R_386_NONE", Const, 0},
+		{"R_386_PC16", Const, 10},
+		{"R_386_PC32", Const, 0},
+		{"R_386_PC8", Const, 10},
+		{"R_386_PLT32", Const, 0},
+		{"R_386_RELATIVE", Const, 0},
+		{"R_386_SIZE32", Const, 10},
+		{"R_386_TLS_DESC", Const, 10},
+		{"R_386_TLS_DESC_CALL", Const, 10},
+		{"R_386_TLS_DTPMOD32", Const, 0},
+		{"R_386_TLS_DTPOFF32", Const, 0},
+		{"R_386_TLS_GD", Const, 0},
+		{"R_386_TLS_GD_32", Const, 0},
+		{"R_386_TLS_GD_CALL", Const, 0},
+		{"R_386_TLS_GD_POP", Const, 0},
+		{"R_386_TLS_GD_PUSH", Const, 0},
+		{"R_386_TLS_GOTDESC", Const, 10},
+		{"R_386_TLS_GOTIE", Const, 0},
+		{"R_386_TLS_IE", Const, 0},
+		{"R_386_TLS_IE_32", Const, 0},
+		{"R_386_TLS_LDM", Const, 0},
+		{"R_386_TLS_LDM_32", Const, 0},
+		{"R_386_TLS_LDM_CALL", Const, 0},
+		{"R_386_TLS_LDM_POP", Const, 0},
+		{"R_386_TLS_LDM_PUSH", Const, 0},
+		{"R_386_TLS_LDO_32", Const, 0},
+		{"R_386_TLS_LE", Const, 0},
+		{"R_386_TLS_LE_32", Const, 0},
+		{"R_386_TLS_TPOFF", Const, 0},
+		{"R_386_TLS_TPOFF32", Const, 0},
+		{"R_390", Type, 7},
+		{"R_390_12", Const, 7},
+		{"R_390_16", Const, 7},
+		{"R_390_20", Const, 7},
+		{"R_390_32", Const, 7},
+		{"R_390_64", Const, 7},
+		{"R_390_8", Const, 7},
+		{"R_390_COPY", Const, 7},
+		{"R_390_GLOB_DAT", Const, 7},
+		{"R_390_GOT12", Const, 7},
+		{"R_390_GOT16", Const, 7},
+		{"R_390_GOT20", Const, 7},
+		{"R_390_GOT32", Const, 7},
+		{"R_390_GOT64", Const, 7},
+		{"R_390_GOTENT", Const, 7},
+		{"R_390_GOTOFF", Const, 7},
+		{"R_390_GOTOFF16", Const, 7},
+		{"R_390_GOTOFF64", Const, 7},
+		{"R_390_GOTPC", Const, 7},
+		{"R_390_GOTPCDBL", Const, 7},
+		{"R_390_GOTPLT12", Const, 7},
+		{"R_390_GOTPLT16", Const, 7},
+		{"R_390_GOTPLT20", Const, 7},
+		{"R_390_GOTPLT32", Const, 7},
+		{"R_390_GOTPLT64", Const, 7},
+		{"R_390_GOTPLTENT", Const, 7},
+		{"R_390_GOTPLTOFF16", Const, 7},
+		{"R_390_GOTPLTOFF32", Const, 7},
+		{"R_390_GOTPLTOFF64", Const, 7},
+		{"R_390_JMP_SLOT", Const, 7},
+		{"R_390_NONE", Const, 7},
+		{"R_390_PC16", Const, 7},
+		{"R_390_PC16DBL", Const, 7},
+		{"R_390_PC32", Const, 7},
+		{"R_390_PC32DBL", Const, 7},
+		{"R_390_PC64", Const, 7},
+		{"R_390_PLT16DBL", Const, 7},
+		{"R_390_PLT32", Const, 7},
+		{"R_390_PLT32DBL", Const, 7},
+		{"R_390_PLT64", Const, 7},
+		{"R_390_RELATIVE", Const, 7},
+		{"R_390_TLS_DTPMOD", Const, 7},
+		{"R_390_TLS_DTPOFF", Const, 7},
+		{"R_390_TLS_GD32", Const, 7},
+		{"R_390_TLS_GD64", Const, 7},
+		{"R_390_TLS_GDCALL", Const, 7},
+		{"R_390_TLS_GOTIE12", Const, 7},
+		{"R_390_TLS_GOTIE20", Const, 7},
+		{"R_390_TLS_GOTIE32", Const, 7},
+		{"R_390_TLS_GOTIE64", Const, 7},
+		{"R_390_TLS_IE32", Const, 7},
+		{"R_390_TLS_IE64", Const, 7},
+		{"R_390_TLS_IEENT", Const, 7},
+		{"R_390_TLS_LDCALL", Const, 7},
+		{"R_390_TLS_LDM32", Const, 7},
+		{"R_390_TLS_LDM64", Const, 7},
+		{"R_390_TLS_LDO32", Const, 7},
+		{"R_390_TLS_LDO64", Const, 7},
+		{"R_390_TLS_LE32", Const, 7},
+		{"R_390_TLS_LE64", Const, 7},
+		{"R_390_TLS_LOAD", Const, 7},
+		{"R_390_TLS_TPOFF", Const, 7},
+		{"R_AARCH64", Type, 4},
+		{"R_AARCH64_ABS16", Const, 4},
+		{"R_AARCH64_ABS32", Const, 4},
+		{"R_AARCH64_ABS64", Const, 4},
+		{"R_AARCH64_ADD_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_ADR_GOT_PAGE", Const, 4},
+		{"R_AARCH64_ADR_PREL_LO21", Const, 4},
+		{"R_AARCH64_ADR_PREL_PG_HI21", Const, 4},
+		{"R_AARCH64_ADR_PREL_PG_HI21_NC", Const, 4},
+		{"R_AARCH64_CALL26", Const, 4},
+		{"R_AARCH64_CONDBR19", Const, 4},
+		{"R_AARCH64_COPY", Const, 4},
+		{"R_AARCH64_GLOB_DAT", Const, 4},
+		{"R_AARCH64_GOT_LD_PREL19", Const, 4},
+		{"R_AARCH64_IRELATIVE", Const, 4},
+		{"R_AARCH64_JUMP26", Const, 4},
+		{"R_AARCH64_JUMP_SLOT", Const, 4},
+		{"R_AARCH64_LD64_GOTOFF_LO15", Const, 10},
+		{"R_AARCH64_LD64_GOTPAGE_LO15", Const, 10},
+		{"R_AARCH64_LD64_GOT_LO12_NC", Const, 4},
+		{"R_AARCH64_LDST128_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_LDST16_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_LDST32_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_LDST64_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_LDST8_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_LD_PREL_LO19", Const, 4},
+		{"R_AARCH64_MOVW_SABS_G0", Const, 4},
+		{"R_AARCH64_MOVW_SABS_G1", Const, 4},
+		{"R_AARCH64_MOVW_SABS_G2", Const, 4},
+		{"R_AARCH64_MOVW_UABS_G0", Const, 4},
+		{"R_AARCH64_MOVW_UABS_G0_NC", Const, 4},
+		{"R_AARCH64_MOVW_UABS_G1", Const, 4},
+		{"R_AARCH64_MOVW_UABS_G1_NC", Const, 4},
+		{"R_AARCH64_MOVW_UABS_G2", Const, 4},
+		{"R_AARCH64_MOVW_UABS_G2_NC", Const, 4},
+		{"R_AARCH64_MOVW_UABS_G3", Const, 4},
+		{"R_AARCH64_NONE", Const, 4},
+		{"R_AARCH64_NULL", Const, 4},
+		{"R_AARCH64_P32_ABS16", Const, 4},
+		{"R_AARCH64_P32_ABS32", Const, 4},
+		{"R_AARCH64_P32_ADD_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_ADR_GOT_PAGE", Const, 4},
+		{"R_AARCH64_P32_ADR_PREL_LO21", Const, 4},
+		{"R_AARCH64_P32_ADR_PREL_PG_HI21", Const, 4},
+		{"R_AARCH64_P32_CALL26", Const, 4},
+		{"R_AARCH64_P32_CONDBR19", Const, 4},
+		{"R_AARCH64_P32_COPY", Const, 4},
+		{"R_AARCH64_P32_GLOB_DAT", Const, 4},
+		{"R_AARCH64_P32_GOT_LD_PREL19", Const, 4},
+		{"R_AARCH64_P32_IRELATIVE", Const, 4},
+		{"R_AARCH64_P32_JUMP26", Const, 4},
+		{"R_AARCH64_P32_JUMP_SLOT", Const, 4},
+		{"R_AARCH64_P32_LD32_GOT_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_LDST128_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_LDST16_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_LDST32_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_LDST64_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_LDST8_ABS_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_LD_PREL_LO19", Const, 4},
+		{"R_AARCH64_P32_MOVW_SABS_G0", Const, 4},
+		{"R_AARCH64_P32_MOVW_UABS_G0", Const, 4},
+		{"R_AARCH64_P32_MOVW_UABS_G0_NC", Const, 4},
+		{"R_AARCH64_P32_MOVW_UABS_G1", Const, 4},
+		{"R_AARCH64_P32_PREL16", Const, 4},
+		{"R_AARCH64_P32_PREL32", Const, 4},
+		{"R_AARCH64_P32_RELATIVE", Const, 4},
+		{"R_AARCH64_P32_TLSDESC", Const, 4},
+		{"R_AARCH64_P32_TLSDESC_ADD_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_TLSDESC_ADR_PAGE21", Const, 4},
+		{"R_AARCH64_P32_TLSDESC_ADR_PREL21", Const, 4},
+		{"R_AARCH64_P32_TLSDESC_CALL", Const, 4},
+		{"R_AARCH64_P32_TLSDESC_LD32_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_TLSDESC_LD_PREL19", Const, 4},
+		{"R_AARCH64_P32_TLSGD_ADD_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_TLSGD_ADR_PAGE21", Const, 4},
+		{"R_AARCH64_P32_TLSIE_ADR_GOTTPREL_PAGE21", Const, 4},
+		{"R_AARCH64_P32_TLSIE_LD32_GOTTPREL_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_TLSIE_LD_GOTTPREL_PREL19", Const, 4},
+		{"R_AARCH64_P32_TLSLE_ADD_TPREL_HI12", Const, 4},
+		{"R_AARCH64_P32_TLSLE_ADD_TPREL_LO12", Const, 4},
+		{"R_AARCH64_P32_TLSLE_ADD_TPREL_LO12_NC", Const, 4},
+		{"R_AARCH64_P32_TLSLE_MOVW_TPREL_G0", Const, 4},
+		{"R_AARCH64_P32_TLSLE_MOVW_TPREL_G0_NC", Const, 4},
+		{"R_AARCH64_P32_TLSLE_MOVW_TPREL_G1", Const, 4},
+		{"R_AARCH64_P32_TLS_DTPMOD", Const, 4},
+		{"R_AARCH64_P32_TLS_DTPREL", Const, 4},
+		{"R_AARCH64_P32_TLS_TPREL", Const, 4},
+		{"R_AARCH64_P32_TSTBR14", Const, 4},
+		{"R_AARCH64_PREL16", Const, 4},
+		{"R_AARCH64_PREL32", Const, 4},
+		{"R_AARCH64_PREL64", Const, 4},
+		{"R_AARCH64_RELATIVE", Const, 4},
+		{"R_AARCH64_TLSDESC", Const, 4},
+		{"R_AARCH64_TLSDESC_ADD", Const, 4},
+		{"R_AARCH64_TLSDESC_ADD_LO12_NC", Const, 4},
+		{"R_AARCH64_TLSDESC_ADR_PAGE21", Const, 4},
+		{"R_AARCH64_TLSDESC_ADR_PREL21", Const, 4},
+		{"R_AARCH64_TLSDESC_CALL", Const, 4},
+		{"R_AARCH64_TLSDESC_LD64_LO12_NC", Const, 4},
+		{"R_AARCH64_TLSDESC_LDR", Const, 4},
+		{"R_AARCH64_TLSDESC_LD_PREL19", Const, 4},
+		{"R_AARCH64_TLSDESC_OFF_G0_NC", Const, 4},
+		{"R_AARCH64_TLSDESC_OFF_G1", Const, 4},
+		{"R_AARCH64_TLSGD_ADD_LO12_NC", Const, 4},
+		{"R_AARCH64_TLSGD_ADR_PAGE21", Const, 4},
+		{"R_AARCH64_TLSGD_ADR_PREL21", Const, 10},
+		{"R_AARCH64_TLSGD_MOVW_G0_NC", Const, 10},
+		{"R_AARCH64_TLSGD_MOVW_G1", Const, 10},
+		{"R_AARCH64_TLSIE_ADR_GOTTPREL_PAGE21", Const, 4},
+		{"R_AARCH64_TLSIE_LD64_GOTTPREL_LO12_NC", Const, 4},
+		{"R_AARCH64_TLSIE_LD_GOTTPREL_PREL19", Const, 4},
+		{"R_AARCH64_TLSIE_MOVW_GOTTPREL_G0_NC", Const, 4},
+		{"R_AARCH64_TLSIE_MOVW_GOTTPREL_G1", Const, 4},
+		{"R_AARCH64_TLSLD_ADR_PAGE21", Const, 10},
+		{"R_AARCH64_TLSLD_ADR_PREL21", Const, 10},
+		{"R_AARCH64_TLSLD_LDST128_DTPREL_LO12", Const, 10},
+		{"R_AARCH64_TLSLD_LDST128_DTPREL_LO12_NC", Const, 10},
+		{"R_AARCH64_TLSLE_ADD_TPREL_HI12", Const, 4},
+		{"R_AARCH64_TLSLE_ADD_TPREL_LO12", Const, 4},
+		{"R_AARCH64_TLSLE_ADD_TPREL_LO12_NC", Const, 4},
+		{"R_AARCH64_TLSLE_LDST128_TPREL_LO12", Const, 10},
+		{"R_AARCH64_TLSLE_LDST128_TPREL_LO12_NC", Const, 10},
+		{"R_AARCH64_TLSLE_MOVW_TPREL_G0", Const, 4},
+		{"R_AARCH64_TLSLE_MOVW_TPREL_G0_NC", Const, 4},
+		{"R_AARCH64_TLSLE_MOVW_TPREL_G1", Const, 4},
+		{"R_AARCH64_TLSLE_MOVW_TPREL_G1_NC", Const, 4},
+		{"R_AARCH64_TLSLE_MOVW_TPREL_G2", Const, 4},
+		{"R_AARCH64_TLS_DTPMOD64", Const, 4},
+		{"R_AARCH64_TLS_DTPREL64", Const, 4},
+		{"R_AARCH64_TLS_TPREL64", Const, 4},
+		{"R_AARCH64_TSTBR14", Const, 4},
+		{"R_ALPHA", Type, 0},
+		{"R_ALPHA_BRADDR", Const, 0},
+		{"R_ALPHA_COPY", Const, 0},
+		{"R_ALPHA_GLOB_DAT", Const, 0},
+		{"R_ALPHA_GPDISP", Const, 0},
+		{"R_ALPHA_GPREL32", Const, 0},
+		{"R_ALPHA_GPRELHIGH", Const, 0},
+		{"R_ALPHA_GPRELLOW", Const, 0},
+		{"R_ALPHA_GPVALUE", Const, 0},
+		{"R_ALPHA_HINT", Const, 0},
+		{"R_ALPHA_IMMED_BR_HI32", Const, 0},
+		{"R_ALPHA_IMMED_GP_16", Const, 0},
+		{"R_ALPHA_IMMED_GP_HI32", Const, 0},
+		{"R_ALPHA_IMMED_LO32", Const, 0},
+		{"R_ALPHA_IMMED_SCN_HI32", Const, 0},
+		{"R_ALPHA_JMP_SLOT", Const, 0},
+		{"R_ALPHA_LITERAL", Const, 0},
+		{"R_ALPHA_LITUSE", Const, 0},
+		{"R_ALPHA_NONE", Const, 0},
+		{"R_ALPHA_OP_PRSHIFT", Const, 0},
+		{"R_ALPHA_OP_PSUB", Const, 0},
+		{"R_ALPHA_OP_PUSH", Const, 0},
+		{"R_ALPHA_OP_STORE", Const, 0},
+		{"R_ALPHA_REFLONG", Const, 0},
+		{"R_ALPHA_REFQUAD", Const, 0},
+		{"R_ALPHA_RELATIVE", Const, 0},
+		{"R_ALPHA_SREL16", Const, 0},
+		{"R_ALPHA_SREL32", Const, 0},
+		{"R_ALPHA_SREL64", Const, 0},
+		{"R_ARM", Type, 0},
+		{"R_ARM_ABS12", Const, 0},
+		{"R_ARM_ABS16", Const, 0},
+		{"R_ARM_ABS32", Const, 0},
+		{"R_ARM_ABS32_NOI", Const, 10},
+		{"R_ARM_ABS8", Const, 0},
+		{"R_ARM_ALU_PCREL_15_8", Const, 10},
+		{"R_ARM_ALU_PCREL_23_15", Const, 10},
+		{"R_ARM_ALU_PCREL_7_0", Const, 10},
+		{"R_ARM_ALU_PC_G0", Const, 10},
+		{"R_ARM_ALU_PC_G0_NC", Const, 10},
+		{"R_ARM_ALU_PC_G1", Const, 10},
+		{"R_ARM_ALU_PC_G1_NC", Const, 10},
+		{"R_ARM_ALU_PC_G2", Const, 10},
+		{"R_ARM_ALU_SBREL_19_12_NC", Const, 10},
+		{"R_ARM_ALU_SBREL_27_20_CK", Const, 10},
+		{"R_ARM_ALU_SB_G0", Const, 10},
+		{"R_ARM_ALU_SB_G0_NC", Const, 10},
+		{"R_ARM_ALU_SB_G1", Const, 10},
+		{"R_ARM_ALU_SB_G1_NC", Const, 10},
+		{"R_ARM_ALU_SB_G2", Const, 10},
+		{"R_ARM_AMP_VCALL9", Const, 0},
+		{"R_ARM_BASE_ABS", Const, 10},
+		{"R_ARM_CALL", Const, 10},
+		{"R_ARM_COPY", Const, 0},
+		{"R_ARM_GLOB_DAT", Const, 0},
+		{"R_ARM_GNU_VTENTRY", Const, 0},
+		{"R_ARM_GNU_VTINHERIT", Const, 0},
+		{"R_ARM_GOT32", Const, 0},
+		{"R_ARM_GOTOFF", Const, 0},
+		{"R_ARM_GOTOFF12", Const, 10},
+		{"R_ARM_GOTPC", Const, 0},
+		{"R_ARM_GOTRELAX", Const, 10},
+		{"R_ARM_GOT_ABS", Const, 10},
+		{"R_ARM_GOT_BREL12", Const, 10},
+		{"R_ARM_GOT_PREL", Const, 10},
+		{"R_ARM_IRELATIVE", Const, 10},
+		{"R_ARM_JUMP24", Const, 10},
+		{"R_ARM_JUMP_SLOT", Const, 0},
+		{"R_ARM_LDC_PC_G0", Const, 10},
+		{"R_ARM_LDC_PC_G1", Const, 10},
+		{"R_ARM_LDC_PC_G2", Const, 10},
+		{"R_ARM_LDC_SB_G0", Const, 10},
+		{"R_ARM_LDC_SB_G1", Const, 10},
+		{"R_ARM_LDC_SB_G2", Const, 10},
+		{"R_ARM_LDRS_PC_G0", Const, 10},
+		{"R_ARM_LDRS_PC_G1", Const, 10},
+		{"R_ARM_LDRS_PC_G2", Const, 10},
+		{"R_ARM_LDRS_SB_G0", Const, 10},
+		{"R_ARM_LDRS_SB_G1", Const, 10},
+		{"R_ARM_LDRS_SB_G2", Const, 10},
+		{"R_ARM_LDR_PC_G1", Const, 10},
+		{"R_ARM_LDR_PC_G2", Const, 10},
+		{"R_ARM_LDR_SBREL_11_10_NC", Const, 10},
+		{"R_ARM_LDR_SB_G0", Const, 10},
+		{"R_ARM_LDR_SB_G1", Const, 10},
+		{"R_ARM_LDR_SB_G2", Const, 10},
+		{"R_ARM_ME_TOO", Const, 10},
+		{"R_ARM_MOVT_ABS", Const, 10},
+		{"R_ARM_MOVT_BREL", Const, 10},
+		{"R_ARM_MOVT_PREL", Const, 10},
+		{"R_ARM_MOVW_ABS_NC", Const, 10},
+		{"R_ARM_MOVW_BREL", Const, 10},
+		{"R_ARM_MOVW_BREL_NC", Const, 10},
+		{"R_ARM_MOVW_PREL_NC", Const, 10},
+		{"R_ARM_NONE", Const, 0},
+		{"R_ARM_PC13", Const, 0},
+		{"R_ARM_PC24", Const, 0},
+		{"R_ARM_PLT32", Const, 0},
+		{"R_ARM_PLT32_ABS", Const, 10},
+		{"R_ARM_PREL31", Const, 10},
+		{"R_ARM_PRIVATE_0", Const, 10},
+		{"R_ARM_PRIVATE_1", Const, 10},
+		{"R_ARM_PRIVATE_10", Const, 10},
+		{"R_ARM_PRIVATE_11", Const, 10},
+		{"R_ARM_PRIVATE_12", Const, 10},
+		{"R_ARM_PRIVATE_13", Const, 10},
+		{"R_ARM_PRIVATE_14", Const, 10},
+		{"R_ARM_PRIVATE_15", Const, 10},
+		{"R_ARM_PRIVATE_2", Const, 10},
+		{"R_ARM_PRIVATE_3", Const, 10},
+		{"R_ARM_PRIVATE_4", Const, 10},
+		{"R_ARM_PRIVATE_5", Const, 10},
+		{"R_ARM_PRIVATE_6", Const, 10},
+		{"R_ARM_PRIVATE_7", Const, 10},
+		{"R_ARM_PRIVATE_8", Const, 10},
+		{"R_ARM_PRIVATE_9", Const, 10},
+		{"R_ARM_RABS32", Const, 0},
+		{"R_ARM_RBASE", Const, 0},
+		{"R_ARM_REL32", Const, 0},
+		{"R_ARM_REL32_NOI", Const, 10},
+		{"R_ARM_RELATIVE", Const, 0},
+		{"R_ARM_RPC24", Const, 0},
+		{"R_ARM_RREL32", Const, 0},
+		{"R_ARM_RSBREL32", Const, 0},
+		{"R_ARM_RXPC25", Const, 10},
+		{"R_ARM_SBREL31", Const, 10},
+		{"R_ARM_SBREL32", Const, 0},
+		{"R_ARM_SWI24", Const, 0},
+		{"R_ARM_TARGET1", Const, 10},
+		{"R_ARM_TARGET2", Const, 10},
+		{"R_ARM_THM_ABS5", Const, 0},
+		{"R_ARM_THM_ALU_ABS_G0_NC", Const, 10},
+		{"R_ARM_THM_ALU_ABS_G1_NC", Const, 10},
+		{"R_ARM_THM_ALU_ABS_G2_NC", Const, 10},
+		{"R_ARM_THM_ALU_ABS_G3", Const, 10},
+		{"R_ARM_THM_ALU_PREL_11_0", Const, 10},
+		{"R_ARM_THM_GOT_BREL12", Const, 10},
+		{"R_ARM_THM_JUMP11", Const, 10},
+		{"R_ARM_THM_JUMP19", Const, 10},
+		{"R_ARM_THM_JUMP24", Const, 10},
+		{"R_ARM_THM_JUMP6", Const, 10},
+		{"R_ARM_THM_JUMP8", Const, 10},
+		{"R_ARM_THM_MOVT_ABS", Const, 10},
+		{"R_ARM_THM_MOVT_BREL", Const, 10},
+		{"R_ARM_THM_MOVT_PREL", Const, 10},
+		{"R_ARM_THM_MOVW_ABS_NC", Const, 10},
+		{"R_ARM_THM_MOVW_BREL", Const, 10},
+		{"R_ARM_THM_MOVW_BREL_NC", Const, 10},
+		{"R_ARM_THM_MOVW_PREL_NC", Const, 10},
+		{"R_ARM_THM_PC12", Const, 10},
+		{"R_ARM_THM_PC22", Const, 0},
+		{"R_ARM_THM_PC8", Const, 0},
+		{"R_ARM_THM_RPC22", Const, 0},
+		{"R_ARM_THM_SWI8", Const, 0},
+		{"R_ARM_THM_TLS_CALL", Const, 10},
+		{"R_ARM_THM_TLS_DESCSEQ16", Const, 10},
+		{"R_ARM_THM_TLS_DESCSEQ32", Const, 10},
+		{"R_ARM_THM_XPC22", Const, 0},
+		{"R_ARM_TLS_CALL", Const, 10},
+		{"R_ARM_TLS_DESCSEQ", Const, 10},
+		{"R_ARM_TLS_DTPMOD32", Const, 10},
+		{"R_ARM_TLS_DTPOFF32", Const, 10},
+		{"R_ARM_TLS_GD32", Const, 10},
+		{"R_ARM_TLS_GOTDESC", Const, 10},
+		{"R_ARM_TLS_IE12GP", Const, 10},
+		{"R_ARM_TLS_IE32", Const, 10},
+		{"R_ARM_TLS_LDM32", Const, 10},
+		{"R_ARM_TLS_LDO12", Const, 10},
+		{"R_ARM_TLS_LDO32", Const, 10},
+		{"R_ARM_TLS_LE12", Const, 10},
+		{"R_ARM_TLS_LE32", Const, 10},
+		{"R_ARM_TLS_TPOFF32", Const, 10},
+		{"R_ARM_V4BX", Const, 10},
+		{"R_ARM_XPC25", Const, 0},
+		{"R_INFO", Func, 0},
+		{"R_INFO32", Func, 0},
+		{"R_LARCH", Type, 19},
+		{"R_LARCH_32", Const, 19},
+		{"R_LARCH_32_PCREL", Const, 20},
+		{"R_LARCH_64", Const, 19},
+		{"R_LARCH_64_PCREL", Const, 22},
+		{"R_LARCH_ABS64_HI12", Const, 20},
+		{"R_LARCH_ABS64_LO20", Const, 20},
+		{"R_LARCH_ABS_HI20", Const, 20},
+		{"R_LARCH_ABS_LO12", Const, 20},
+		{"R_LARCH_ADD16", Const, 19},
+		{"R_LARCH_ADD24", Const, 19},
+		{"R_LARCH_ADD32", Const, 19},
+		{"R_LARCH_ADD6", Const, 22},
+		{"R_LARCH_ADD64", Const, 19},
+		{"R_LARCH_ADD8", Const, 19},
+		{"R_LARCH_ADD_ULEB128", Const, 22},
+		{"R_LARCH_ALIGN", Const, 22},
+		{"R_LARCH_B16", Const, 20},
+		{"R_LARCH_B21", Const, 20},
+		{"R_LARCH_B26", Const, 20},
+		{"R_LARCH_CFA", Const, 22},
+		{"R_LARCH_COPY", Const, 19},
+		{"R_LARCH_DELETE", Const, 22},
+		{"R_LARCH_GNU_VTENTRY", Const, 20},
+		{"R_LARCH_GNU_VTINHERIT", Const, 20},
+		{"R_LARCH_GOT64_HI12", Const, 20},
+		{"R_LARCH_GOT64_LO20", Const, 20},
+		{"R_LARCH_GOT64_PC_HI12", Const, 20},
+		{"R_LARCH_GOT64_PC_LO20", Const, 20},
+		{"R_LARCH_GOT_HI20", Const, 20},
+		{"R_LARCH_GOT_LO12", Const, 20},
+		{"R_LARCH_GOT_PC_HI20", Const, 20},
+		{"R_LARCH_GOT_PC_LO12", Const, 20},
+		{"R_LARCH_IRELATIVE", Const, 19},
+		{"R_LARCH_JUMP_SLOT", Const, 19},
+		{"R_LARCH_MARK_LA", Const, 19},
+		{"R_LARCH_MARK_PCREL", Const, 19},
+		{"R_LARCH_NONE", Const, 19},
+		{"R_LARCH_PCALA64_HI12", Const, 20},
+		{"R_LARCH_PCALA64_LO20", Const, 20},
+		{"R_LARCH_PCALA_HI20", Const, 20},
+		{"R_LARCH_PCALA_LO12", Const, 20},
+		{"R_LARCH_PCREL20_S2", Const, 22},
+		{"R_LARCH_RELATIVE", Const, 19},
+		{"R_LARCH_RELAX", Const, 20},
+		{"R_LARCH_SOP_ADD", Const, 19},
+		{"R_LARCH_SOP_AND", Const, 19},
+		{"R_LARCH_SOP_ASSERT", Const, 19},
+		{"R_LARCH_SOP_IF_ELSE", Const, 19},
+		{"R_LARCH_SOP_NOT", Const, 19},
+		{"R_LARCH_SOP_POP_32_S_0_10_10_16_S2", Const, 19},
+		{"R_LARCH_SOP_POP_32_S_0_5_10_16_S2", Const, 19},
+		{"R_LARCH_SOP_POP_32_S_10_12", Const, 19},
+		{"R_LARCH_SOP_POP_32_S_10_16", Const, 19},
+		{"R_LARCH_SOP_POP_32_S_10_16_S2", Const, 19},
+		{"R_LARCH_SOP_POP_32_S_10_5", Const, 19},
+		{"R_LARCH_SOP_POP_32_S_5_20", Const, 19},
+		{"R_LARCH_SOP_POP_32_U", Const, 19},
+		{"R_LARCH_SOP_POP_32_U_10_12", Const, 19},
+		{"R_LARCH_SOP_PUSH_ABSOLUTE", Const, 19},
+		{"R_LARCH_SOP_PUSH_DUP", Const, 19},
+		{"R_LARCH_SOP_PUSH_GPREL", Const, 19},
+		{"R_LARCH_SOP_PUSH_PCREL", Const, 19},
+		{"R_LARCH_SOP_PUSH_PLT_PCREL", Const, 19},
+		{"R_LARCH_SOP_PUSH_TLS_GD", Const, 19},
+		{"R_LARCH_SOP_PUSH_TLS_GOT", Const, 19},
+		{"R_LARCH_SOP_PUSH_TLS_TPREL", Const, 19},
+		{"R_LARCH_SOP_SL", Const, 19},
+		{"R_LARCH_SOP_SR", Const, 19},
+		{"R_LARCH_SOP_SUB", Const, 19},
+		{"R_LARCH_SUB16", Const, 19},
+		{"R_LARCH_SUB24", Const, 19},
+		{"R_LARCH_SUB32", Const, 19},
+		{"R_LARCH_SUB6", Const, 22},
+		{"R_LARCH_SUB64", Const, 19},
+		{"R_LARCH_SUB8", Const, 19},
+		{"R_LARCH_SUB_ULEB128", Const, 22},
+		{"R_LARCH_TLS_DTPMOD32", Const, 19},
+		{"R_LARCH_TLS_DTPMOD64", Const, 19},
+		{"R_LARCH_TLS_DTPREL32", Const, 19},
+		{"R_LARCH_TLS_DTPREL64", Const, 19},
+		{"R_LARCH_TLS_GD_HI20", Const, 20},
+		{"R_LARCH_TLS_GD_PC_HI20", Const, 20},
+		{"R_LARCH_TLS_IE64_HI12", Const, 20},
+		{"R_LARCH_TLS_IE64_LO20", Const, 20},
+		{"R_LARCH_TLS_IE64_PC_HI12", Const, 20},
+		{"R_LARCH_TLS_IE64_PC_LO20", Const, 20},
+		{"R_LARCH_TLS_IE_HI20", Const, 20},
+		{"R_LARCH_TLS_IE_LO12", Const, 20},
+		{"R_LARCH_TLS_IE_PC_HI20", Const, 20},
+		{"R_LARCH_TLS_IE_PC_LO12", Const, 20},
+		{"R_LARCH_TLS_LD_HI20", Const, 20},
+		{"R_LARCH_TLS_LD_PC_HI20", Const, 20},
+		{"R_LARCH_TLS_LE64_HI12", Const, 20},
+		{"R_LARCH_TLS_LE64_LO20", Const, 20},
+		{"R_LARCH_TLS_LE_HI20", Const, 20},
+		{"R_LARCH_TLS_LE_LO12", Const, 20},
+		{"R_LARCH_TLS_TPREL32", Const, 19},
+		{"R_LARCH_TLS_TPREL64", Const, 19},
+		{"R_MIPS", Type, 6},
+		{"R_MIPS_16", Const, 6},
+		{"R_MIPS_26", Const, 6},
+		{"R_MIPS_32", Const, 6},
+		{"R_MIPS_64", Const, 6},
+		{"R_MIPS_ADD_IMMEDIATE", Const, 6},
+		{"R_MIPS_CALL16", Const, 6},
+		{"R_MIPS_CALL_HI16", Const, 6},
+		{"R_MIPS_CALL_LO16", Const, 6},
+		{"R_MIPS_DELETE", Const, 6},
+		{"R_MIPS_GOT16", Const, 6},
+		{"R_MIPS_GOT_DISP", Const, 6},
+		{"R_MIPS_GOT_HI16", Const, 6},
+		{"R_MIPS_GOT_LO16", Const, 6},
+		{"R_MIPS_GOT_OFST", Const, 6},
+		{"R_MIPS_GOT_PAGE", Const, 6},
+		{"R_MIPS_GPREL16", Const, 6},
+		{"R_MIPS_GPREL32", Const, 6},
+		{"R_MIPS_HI16", Const, 6},
+		{"R_MIPS_HIGHER", Const, 6},
+		{"R_MIPS_HIGHEST", Const, 6},
+		{"R_MIPS_INSERT_A", Const, 6},
+		{"R_MIPS_INSERT_B", Const, 6},
+		{"R_MIPS_JALR", Const, 6},
+		{"R_MIPS_LITERAL", Const, 6},
+		{"R_MIPS_LO16", Const, 6},
+		{"R_MIPS_NONE", Const, 6},
+		{"R_MIPS_PC16", Const, 6},
+		{"R_MIPS_PC32", Const, 22},
+		{"R_MIPS_PJUMP", Const, 6},
+		{"R_MIPS_REL16", Const, 6},
+		{"R_MIPS_REL32", Const, 6},
+		{"R_MIPS_RELGOT", Const, 6},
+		{"R_MIPS_SCN_DISP", Const, 6},
+		{"R_MIPS_SHIFT5", Const, 6},
+		{"R_MIPS_SHIFT6", Const, 6},
+		{"R_MIPS_SUB", Const, 6},
+		{"R_MIPS_TLS_DTPMOD32", Const, 6},
+		{"R_MIPS_TLS_DTPMOD64", Const, 6},
+		{"R_MIPS_TLS_DTPREL32", Const, 6},
+		{"R_MIPS_TLS_DTPREL64", Const, 6},
+		{"R_MIPS_TLS_DTPREL_HI16", Const, 6},
+		{"R_MIPS_TLS_DTPREL_LO16", Const, 6},
+		{"R_MIPS_TLS_GD", Const, 6},
+		{"R_MIPS_TLS_GOTTPREL", Const, 6},
+		{"R_MIPS_TLS_LDM", Const, 6},
+		{"R_MIPS_TLS_TPREL32", Const, 6},
+		{"R_MIPS_TLS_TPREL64", Const, 6},
+		{"R_MIPS_TLS_TPREL_HI16", Const, 6},
+		{"R_MIPS_TLS_TPREL_LO16", Const, 6},
+		{"R_PPC", Type, 0},
+		{"R_PPC64", Type, 5},
+		{"R_PPC64_ADDR14", Const, 5},
+		{"R_PPC64_ADDR14_BRNTAKEN", Const, 5},
+		{"R_PPC64_ADDR14_BRTAKEN", Const, 5},
+		{"R_PPC64_ADDR16", Const, 5},
+		{"R_PPC64_ADDR16_DS", Const, 5},
+		{"R_PPC64_ADDR16_HA", Const, 5},
+		{"R_PPC64_ADDR16_HI", Const, 5},
+		{"R_PPC64_ADDR16_HIGH", Const, 10},
+		{"R_PPC64_ADDR16_HIGHA", Const, 10},
+		{"R_PPC64_ADDR16_HIGHER", Const, 5},
+		{"R_PPC64_ADDR16_HIGHER34", Const, 20},
+		{"R_PPC64_ADDR16_HIGHERA", Const, 5},
+		{"R_PPC64_ADDR16_HIGHERA34", Const, 20},
+		{"R_PPC64_ADDR16_HIGHEST", Const, 5},
+		{"R_PPC64_ADDR16_HIGHEST34", Const, 20},
+		{"R_PPC64_ADDR16_HIGHESTA", Const, 5},
+		{"R_PPC64_ADDR16_HIGHESTA34", Const, 20},
+		{"R_PPC64_ADDR16_LO", Const, 5},
+		{"R_PPC64_ADDR16_LO_DS", Const, 5},
+		{"R_PPC64_ADDR24", Const, 5},
+		{"R_PPC64_ADDR32", Const, 5},
+		{"R_PPC64_ADDR64", Const, 5},
+		{"R_PPC64_ADDR64_LOCAL", Const, 10},
+		{"R_PPC64_COPY", Const, 20},
+		{"R_PPC64_D28", Const, 20},
+		{"R_PPC64_D34", Const, 20},
+		{"R_PPC64_D34_HA30", Const, 20},
+		{"R_PPC64_D34_HI30", Const, 20},
+		{"R_PPC64_D34_LO", Const, 20},
+		{"R_PPC64_DTPMOD64", Const, 5},
+		{"R_PPC64_DTPREL16", Const, 5},
+		{"R_PPC64_DTPREL16_DS", Const, 5},
+		{"R_PPC64_DTPREL16_HA", Const, 5},
+		{"R_PPC64_DTPREL16_HI", Const, 5},
+		{"R_PPC64_DTPREL16_HIGH", Const, 10},
+		{"R_PPC64_DTPREL16_HIGHA", Const, 10},
+		{"R_PPC64_DTPREL16_HIGHER", Const, 5},
+		{"R_PPC64_DTPREL16_HIGHERA", Const, 5},
+		{"R_PPC64_DTPREL16_HIGHEST", Const, 5},
+		{"R_PPC64_DTPREL16_HIGHESTA", Const, 5},
+		{"R_PPC64_DTPREL16_LO", Const, 5},
+		{"R_PPC64_DTPREL16_LO_DS", Const, 5},
+		{"R_PPC64_DTPREL34", Const, 20},
+		{"R_PPC64_DTPREL64", Const, 5},
+		{"R_PPC64_ENTRY", Const, 10},
+		{"R_PPC64_GLOB_DAT", Const, 20},
+		{"R_PPC64_GNU_VTENTRY", Const, 20},
+		{"R_PPC64_GNU_VTINHERIT", Const, 20},
+		{"R_PPC64_GOT16", Const, 5},
+		{"R_PPC64_GOT16_DS", Const, 5},
+		{"R_PPC64_GOT16_HA", Const, 5},
+		{"R_PPC64_GOT16_HI", Const, 5},
+		{"R_PPC64_GOT16_LO", Const, 5},
+		{"R_PPC64_GOT16_LO_DS", Const, 5},
+		{"R_PPC64_GOT_DTPREL16_DS", Const, 5},
+		{"R_PPC64_GOT_DTPREL16_HA", Const, 5},
+		{"R_PPC64_GOT_DTPREL16_HI", Const, 5},
+		{"R_PPC64_GOT_DTPREL16_LO_DS", Const, 5},
+		{"R_PPC64_GOT_DTPREL_PCREL34", Const, 20},
+		{"R_PPC64_GOT_PCREL34", Const, 20},
+		{"R_PPC64_GOT_TLSGD16", Const, 5},
+		{"R_PPC64_GOT_TLSGD16_HA", Const, 5},
+		{"R_PPC64_GOT_TLSGD16_HI", Const, 5},
+		{"R_PPC64_GOT_TLSGD16_LO", Const, 5},
+		{"R_PPC64_GOT_TLSGD_PCREL34", Const, 20},
+		{"R_PPC64_GOT_TLSLD16", Const, 5},
+		{"R_PPC64_GOT_TLSLD16_HA", Const, 5},
+		{"R_PPC64_GOT_TLSLD16_HI", Const, 5},
+		{"R_PPC64_GOT_TLSLD16_LO", Const, 5},
+		{"R_PPC64_GOT_TLSLD_PCREL34", Const, 20},
+		{"R_PPC64_GOT_TPREL16_DS", Const, 5},
+		{"R_PPC64_GOT_TPREL16_HA", Const, 5},
+		{"R_PPC64_GOT_TPREL16_HI", Const, 5},
+		{"R_PPC64_GOT_TPREL16_LO_DS", Const, 5},
+		{"R_PPC64_GOT_TPREL_PCREL34", Const, 20},
+		{"R_PPC64_IRELATIVE", Const, 10},
+		{"R_PPC64_JMP_IREL", Const, 10},
+		{"R_PPC64_JMP_SLOT", Const, 5},
+		{"R_PPC64_NONE", Const, 5},
+		{"R_PPC64_PCREL28", Const, 20},
+		{"R_PPC64_PCREL34", Const, 20},
+		{"R_PPC64_PCREL_OPT", Const, 20},
+		{"R_PPC64_PLT16_HA", Const, 20},
+		{"R_PPC64_PLT16_HI", Const, 20},
+		{"R_PPC64_PLT16_LO", Const, 20},
+		{"R_PPC64_PLT16_LO_DS", Const, 10},
+		{"R_PPC64_PLT32", Const, 20},
+		{"R_PPC64_PLT64", Const, 20},
+		{"R_PPC64_PLTCALL", Const, 20},
+		{"R_PPC64_PLTCALL_NOTOC", Const, 20},
+		{"R_PPC64_PLTGOT16", Const, 10},
+		{"R_PPC64_PLTGOT16_DS", Const, 10},
+		{"R_PPC64_PLTGOT16_HA", Const, 10},
+		{"R_PPC64_PLTGOT16_HI", Const, 10},
+		{"R_PPC64_PLTGOT16_LO", Const, 10},
+		{"R_PPC64_PLTGOT_LO_DS", Const, 10},
+		{"R_PPC64_PLTREL32", Const, 20},
+		{"R_PPC64_PLTREL64", Const, 20},
+		{"R_PPC64_PLTSEQ", Const, 20},
+		{"R_PPC64_PLTSEQ_NOTOC", Const, 20},
+		{"R_PPC64_PLT_PCREL34", Const, 20},
+		{"R_PPC64_PLT_PCREL34_NOTOC", Const, 20},
+		{"R_PPC64_REL14", Const, 5},
+		{"R_PPC64_REL14_BRNTAKEN", Const, 5},
+		{"R_PPC64_REL14_BRTAKEN", Const, 5},
+		{"R_PPC64_REL16", Const, 5},
+		{"R_PPC64_REL16DX_HA", Const, 10},
+		{"R_PPC64_REL16_HA", Const, 5},
+		{"R_PPC64_REL16_HI", Const, 5},
+		{"R_PPC64_REL16_HIGH", Const, 20},
+		{"R_PPC64_REL16_HIGHA", Const, 20},
+		{"R_PPC64_REL16_HIGHER", Const, 20},
+		{"R_PPC64_REL16_HIGHER34", Const, 20},
+		{"R_PPC64_REL16_HIGHERA", Const, 20},
+		{"R_PPC64_REL16_HIGHERA34", Const, 20},
+		{"R_PPC64_REL16_HIGHEST", Const, 20},
+		{"R_PPC64_REL16_HIGHEST34", Const, 20},
+		{"R_PPC64_REL16_HIGHESTA", Const, 20},
+		{"R_PPC64_REL16_HIGHESTA34", Const, 20},
+		{"R_PPC64_REL16_LO", Const, 5},
+		{"R_PPC64_REL24", Const, 5},
+		{"R_PPC64_REL24_NOTOC", Const, 10},
+		{"R_PPC64_REL24_P9NOTOC", Const, 21},
+		{"R_PPC64_REL30", Const, 20},
+		{"R_PPC64_REL32", Const, 5},
+		{"R_PPC64_REL64", Const, 5},
+		{"R_PPC64_RELATIVE", Const, 18},
+		{"R_PPC64_SECTOFF", Const, 20},
+		{"R_PPC64_SECTOFF_DS", Const, 10},
+		{"R_PPC64_SECTOFF_HA", Const, 20},
+		{"R_PPC64_SECTOFF_HI", Const, 20},
+		{"R_PPC64_SECTOFF_LO", Const, 20},
+		{"R_PPC64_SECTOFF_LO_DS", Const, 10},
+		{"R_PPC64_TLS", Const, 5},
+		{"R_PPC64_TLSGD", Const, 5},
+		{"R_PPC64_TLSLD", Const, 5},
+		{"R_PPC64_TOC", Const, 5},
+		{"R_PPC64_TOC16", Const, 5},
+		{"R_PPC64_TOC16_DS", Const, 5},
+		{"R_PPC64_TOC16_HA", Const, 5},
+		{"R_PPC64_TOC16_HI", Const, 5},
+		{"R_PPC64_TOC16_LO", Const, 5},
+		{"R_PPC64_TOC16_LO_DS", Const, 5},
+		{"R_PPC64_TOCSAVE", Const, 10},
+		{"R_PPC64_TPREL16", Const, 5},
+		{"R_PPC64_TPREL16_DS", Const, 5},
+		{"R_PPC64_TPREL16_HA", Const, 5},
+		{"R_PPC64_TPREL16_HI", Const, 5},
+		{"R_PPC64_TPREL16_HIGH", Const, 10},
+		{"R_PPC64_TPREL16_HIGHA", Const, 10},
+		{"R_PPC64_TPREL16_HIGHER", Const, 5},
+		{"R_PPC64_TPREL16_HIGHERA", Const, 5},
+		{"R_PPC64_TPREL16_HIGHEST", Const, 5},
+		{"R_PPC64_TPREL16_HIGHESTA", Const, 5},
+		{"R_PPC64_TPREL16_LO", Const, 5},
+		{"R_PPC64_TPREL16_LO_DS", Const, 5},
+		{"R_PPC64_TPREL34", Const, 20},
+		{"R_PPC64_TPREL64", Const, 5},
+		{"R_PPC64_UADDR16", Const, 20},
+		{"R_PPC64_UADDR32", Const, 20},
+		{"R_PPC64_UADDR64", Const, 20},
+		{"R_PPC_ADDR14", Const, 0},
+		{"R_PPC_ADDR14_BRNTAKEN", Const, 0},
+		{"R_PPC_ADDR14_BRTAKEN", Const, 0},
+		{"R_PPC_ADDR16", Const, 0},
+		{"R_PPC_ADDR16_HA", Const, 0},
+		{"R_PPC_ADDR16_HI", Const, 0},
+		{"R_PPC_ADDR16_LO", Const, 0},
+		{"R_PPC_ADDR24", Const, 0},
+		{"R_PPC_ADDR32", Const, 0},
+		{"R_PPC_COPY", Const, 0},
+		{"R_PPC_DTPMOD32", Const, 0},
+		{"R_PPC_DTPREL16", Const, 0},
+		{"R_PPC_DTPREL16_HA", Const, 0},
+		{"R_PPC_DTPREL16_HI", Const, 0},
+		{"R_PPC_DTPREL16_LO", Const, 0},
+		{"R_PPC_DTPREL32", Const, 0},
+		{"R_PPC_EMB_BIT_FLD", Const, 0},
+		{"R_PPC_EMB_MRKREF", Const, 0},
+		{"R_PPC_EMB_NADDR16", Const, 0},
+		{"R_PPC_EMB_NADDR16_HA", Const, 0},
+		{"R_PPC_EMB_NADDR16_HI", Const, 0},
+		{"R_PPC_EMB_NADDR16_LO", Const, 0},
+		{"R_PPC_EMB_NADDR32", Const, 0},
+		{"R_PPC_EMB_RELSDA", Const, 0},
+		{"R_PPC_EMB_RELSEC16", Const, 0},
+		{"R_PPC_EMB_RELST_HA", Const, 0},
+		{"R_PPC_EMB_RELST_HI", Const, 0},
+		{"R_PPC_EMB_RELST_LO", Const, 0},
+		{"R_PPC_EMB_SDA21", Const, 0},
+		{"R_PPC_EMB_SDA2I16", Const, 0},
+		{"R_PPC_EMB_SDA2REL", Const, 0},
+		{"R_PPC_EMB_SDAI16", Const, 0},
+		{"R_PPC_GLOB_DAT", Const, 0},
+		{"R_PPC_GOT16", Const, 0},
+		{"R_PPC_GOT16_HA", Const, 0},
+		{"R_PPC_GOT16_HI", Const, 0},
+		{"R_PPC_GOT16_LO", Const, 0},
+		{"R_PPC_GOT_TLSGD16", Const, 0},
+		{"R_PPC_GOT_TLSGD16_HA", Const, 0},
+		{"R_PPC_GOT_TLSGD16_HI", Const, 0},
+		{"R_PPC_GOT_TLSGD16_LO", Const, 0},
+		{"R_PPC_GOT_TLSLD16", Const, 0},
+		{"R_PPC_GOT_TLSLD16_HA", Const, 0},
+		{"R_PPC_GOT_TLSLD16_HI", Const, 0},
+		{"R_PPC_GOT_TLSLD16_LO", Const, 0},
+		{"R_PPC_GOT_TPREL16", Const, 0},
+		{"R_PPC_GOT_TPREL16_HA", Const, 0},
+		{"R_PPC_GOT_TPREL16_HI", Const, 0},
+		{"R_PPC_GOT_TPREL16_LO", Const, 0},
+		{"R_PPC_JMP_SLOT", Const, 0},
+		{"R_PPC_LOCAL24PC", Const, 0},
+		{"R_PPC_NONE", Const, 0},
+		{"R_PPC_PLT16_HA", Const, 0},
+		{"R_PPC_PLT16_HI", Const, 0},
+		{"R_PPC_PLT16_LO", Const, 0},
+		{"R_PPC_PLT32", Const, 0},
+		{"R_PPC_PLTREL24", Const, 0},
+		{"R_PPC_PLTREL32", Const, 0},
+		{"R_PPC_REL14", Const, 0},
+		{"R_PPC_REL14_BRNTAKEN", Const, 0},
+		{"R_PPC_REL14_BRTAKEN", Const, 0},
+		{"R_PPC_REL24", Const, 0},
+		{"R_PPC_REL32", Const, 0},
+		{"R_PPC_RELATIVE", Const, 0},
+		{"R_PPC_SDAREL16", Const, 0},
+		{"R_PPC_SECTOFF", Const, 0},
+		{"R_PPC_SECTOFF_HA", Const, 0},
+		{"R_PPC_SECTOFF_HI", Const, 0},
+		{"R_PPC_SECTOFF_LO", Const, 0},
+		{"R_PPC_TLS", Const, 0},
+		{"R_PPC_TPREL16", Const, 0},
+		{"R_PPC_TPREL16_HA", Const, 0},
+		{"R_PPC_TPREL16_HI", Const, 0},
+		{"R_PPC_TPREL16_LO", Const, 0},
+		{"R_PPC_TPREL32", Const, 0},
+		{"R_PPC_UADDR16", Const, 0},
+		{"R_PPC_UADDR32", Const, 0},
+		{"R_RISCV", Type, 11},
+		{"R_RISCV_32", Const, 11},
+		{"R_RISCV_32_PCREL", Const, 12},
+		{"R_RISCV_64", Const, 11},
+		{"R_RISCV_ADD16", Const, 11},
+		{"R_RISCV_ADD32", Const, 11},
+		{"R_RISCV_ADD64", Const, 11},
+		{"R_RISCV_ADD8", Const, 11},
+		{"R_RISCV_ALIGN", Const, 11},
+		{"R_RISCV_BRANCH", Const, 11},
+		{"R_RISCV_CALL", Const, 11},
+		{"R_RISCV_CALL_PLT", Const, 11},
+		{"R_RISCV_COPY", Const, 11},
+		{"R_RISCV_GNU_VTENTRY", Const, 11},
+		{"R_RISCV_GNU_VTINHERIT", Const, 11},
+		{"R_RISCV_GOT_HI20", Const, 11},
+		{"R_RISCV_GPREL_I", Const, 11},
+		{"R_RISCV_GPREL_S", Const, 11},
+		{"R_RISCV_HI20", Const, 11},
+		{"R_RISCV_JAL", Const, 11},
+		{"R_RISCV_JUMP_SLOT", Const, 11},
+		{"R_RISCV_LO12_I", Const, 11},
+		{"R_RISCV_LO12_S", Const, 11},
+		{"R_RISCV_NONE", Const, 11},
+		{"R_RISCV_PCREL_HI20", Const, 11},
+		{"R_RISCV_PCREL_LO12_I", Const, 11},
+		{"R_RISCV_PCREL_LO12_S", Const, 11},
+		{"R_RISCV_RELATIVE", Const, 11},
+		{"R_RISCV_RELAX", Const, 11},
+		{"R_RISCV_RVC_BRANCH", Const, 11},
+		{"R_RISCV_RVC_JUMP", Const, 11},
+		{"R_RISCV_RVC_LUI", Const, 11},
+		{"R_RISCV_SET16", Const, 11},
+		{"R_RISCV_SET32", Const, 11},
+		{"R_RISCV_SET6", Const, 11},
+		{"R_RISCV_SET8", Const, 11},
+		{"R_RISCV_SUB16", Const, 11},
+		{"R_RISCV_SUB32", Const, 11},
+		{"R_RISCV_SUB6", Const, 11},
+		{"R_RISCV_SUB64", Const, 11},
+		{"R_RISCV_SUB8", Const, 11},
+		{"R_RISCV_TLS_DTPMOD32", Const, 11},
+		{"R_RISCV_TLS_DTPMOD64", Const, 11},
+		{"R_RISCV_TLS_DTPREL32", Const, 11},
+		{"R_RISCV_TLS_DTPREL64", Const, 11},
+		{"R_RISCV_TLS_GD_HI20", Const, 11},
+		{"R_RISCV_TLS_GOT_HI20", Const, 11},
+		{"R_RISCV_TLS_TPREL32", Const, 11},
+		{"R_RISCV_TLS_TPREL64", Const, 11},
+		{"R_RISCV_TPREL_ADD", Const, 11},
+		{"R_RISCV_TPREL_HI20", Const, 11},
+		{"R_RISCV_TPREL_I", Const, 11},
+		{"R_RISCV_TPREL_LO12_I", Const, 11},
+		{"R_RISCV_TPREL_LO12_S", Const, 11},
+		{"R_RISCV_TPREL_S", Const, 11},
+		{"R_SPARC", Type, 0},
+		{"R_SPARC_10", Const, 0},
+		{"R_SPARC_11", Const, 0},
+		{"R_SPARC_13", Const, 0},
+		{"R_SPARC_16", Const, 0},
+		{"R_SPARC_22", Const, 0},
+		{"R_SPARC_32", Const, 0},
+		{"R_SPARC_5", Const, 0},
+		{"R_SPARC_6", Const, 0},
+		{"R_SPARC_64", Const, 0},
+		{"R_SPARC_7", Const, 0},
+		{"R_SPARC_8", Const, 0},
+		{"R_SPARC_COPY", Const, 0},
+		{"R_SPARC_DISP16", Const, 0},
+		{"R_SPARC_DISP32", Const, 0},
+		{"R_SPARC_DISP64", Const, 0},
+		{"R_SPARC_DISP8", Const, 0},
+		{"R_SPARC_GLOB_DAT", Const, 0},
+		{"R_SPARC_GLOB_JMP", Const, 0},
+		{"R_SPARC_GOT10", Const, 0},
+		{"R_SPARC_GOT13", Const, 0},
+		{"R_SPARC_GOT22", Const, 0},
+		{"R_SPARC_H44", Const, 0},
+		{"R_SPARC_HH22", Const, 0},
+		{"R_SPARC_HI22", Const, 0},
+		{"R_SPARC_HIPLT22", Const, 0},
+		{"R_SPARC_HIX22", Const, 0},
+		{"R_SPARC_HM10", Const, 0},
+		{"R_SPARC_JMP_SLOT", Const, 0},
+		{"R_SPARC_L44", Const, 0},
+		{"R_SPARC_LM22", Const, 0},
+		{"R_SPARC_LO10", Const, 0},
+		{"R_SPARC_LOPLT10", Const, 0},
+		{"R_SPARC_LOX10", Const, 0},
+		{"R_SPARC_M44", Const, 0},
+		{"R_SPARC_NONE", Const, 0},
+		{"R_SPARC_OLO10", Const, 0},
+		{"R_SPARC_PC10", Const, 0},
+		{"R_SPARC_PC22", Const, 0},
+		{"R_SPARC_PCPLT10", Const, 0},
+		{"R_SPARC_PCPLT22", Const, 0},
+		{"R_SPARC_PCPLT32", Const, 0},
+		{"R_SPARC_PC_HH22", Const, 0},
+		{"R_SPARC_PC_HM10", Const, 0},
+		{"R_SPARC_PC_LM22", Const, 0},
+		{"R_SPARC_PLT32", Const, 0},
+		{"R_SPARC_PLT64", Const, 0},
+		{"R_SPARC_REGISTER", Const, 0},
+		{"R_SPARC_RELATIVE", Const, 0},
+		{"R_SPARC_UA16", Const, 0},
+		{"R_SPARC_UA32", Const, 0},
+		{"R_SPARC_UA64", Const, 0},
+		{"R_SPARC_WDISP16", Const, 0},
+		{"R_SPARC_WDISP19", Const, 0},
+		{"R_SPARC_WDISP22", Const, 0},
+		{"R_SPARC_WDISP30", Const, 0},
+		{"R_SPARC_WPLT30", Const, 0},
+		{"R_SYM32", Func, 0},
+		{"R_SYM64", Func, 0},
+		{"R_TYPE32", Func, 0},
+		{"R_TYPE64", Func, 0},
+		{"R_X86_64", Type, 0},
+		{"R_X86_64_16", Const, 0},
+		{"R_X86_64_32", Const, 0},
+		{"R_X86_64_32S", Const, 0},
+		{"R_X86_64_64", Const, 0},
+		{"R_X86_64_8", Const, 0},
+		{"R_X86_64_COPY", Const, 0},
+		{"R_X86_64_DTPMOD64", Const, 0},
+		{"R_X86_64_DTPOFF32", Const, 0},
+		{"R_X86_64_DTPOFF64", Const, 0},
+		{"R_X86_64_GLOB_DAT", Const, 0},
+		{"R_X86_64_GOT32", Const, 0},
+		{"R_X86_64_GOT64", Const, 10},
+		{"R_X86_64_GOTOFF64", Const, 10},
+		{"R_X86_64_GOTPC32", Const, 10},
+		{"R_X86_64_GOTPC32_TLSDESC", Const, 10},
+		{"R_X86_64_GOTPC64", Const, 10},
+		{"R_X86_64_GOTPCREL", Const, 0},
+		{"R_X86_64_GOTPCREL64", Const, 10},
+		{"R_X86_64_GOTPCRELX", Const, 10},
+		{"R_X86_64_GOTPLT64", Const, 10},
+		{"R_X86_64_GOTTPOFF", Const, 0},
+		{"R_X86_64_IRELATIVE", Const, 10},
+		{"R_X86_64_JMP_SLOT", Const, 0},
+		{"R_X86_64_NONE", Const, 0},
+		{"R_X86_64_PC16", Const, 0},
+		{"R_X86_64_PC32", Const, 0},
+		{"R_X86_64_PC32_BND", Const, 10},
+		{"R_X86_64_PC64", Const, 10},
+		{"R_X86_64_PC8", Const, 0},
+		{"R_X86_64_PLT32", Const, 0},
+		{"R_X86_64_PLT32_BND", Const, 10},
+		{"R_X86_64_PLTOFF64", Const, 10},
+		{"R_X86_64_RELATIVE", Const, 0},
+		{"R_X86_64_RELATIVE64", Const, 10},
+		{"R_X86_64_REX_GOTPCRELX", Const, 10},
+		{"R_X86_64_SIZE32", Const, 10},
+		{"R_X86_64_SIZE64", Const, 10},
+		{"R_X86_64_TLSDESC", Const, 10},
+		{"R_X86_64_TLSDESC_CALL", Const, 10},
+		{"R_X86_64_TLSGD", Const, 0},
+		{"R_X86_64_TLSLD", Const, 0},
+		{"R_X86_64_TPOFF32", Const, 0},
+		{"R_X86_64_TPOFF64", Const, 0},
+		{"Rel32", Type, 0},
+		{"Rel32.Info", Field, 0},
+		{"Rel32.Off", Field, 0},
+		{"Rel64", Type, 0},
+		{"Rel64.Info", Field, 0},
+		{"Rel64.Off", Field, 0},
+		{"Rela32", Type, 0},
+		{"Rela32.Addend", Field, 0},
+		{"Rela32.Info", Field, 0},
+		{"Rela32.Off", Field, 0},
+		{"Rela64", Type, 0},
+		{"Rela64.Addend", Field, 0},
+		{"Rela64.Info", Field, 0},
+		{"Rela64.Off", Field, 0},
+		{"SHF_ALLOC", Const, 0},
+		{"SHF_COMPRESSED", Const, 6},
+		{"SHF_EXECINSTR", Const, 0},
+		{"SHF_GROUP", Const, 0},
+		{"SHF_INFO_LINK", Const, 0},
+		{"SHF_LINK_ORDER", Const, 0},
+		{"SHF_MASKOS", Const, 0},
+		{"SHF_MASKPROC", Const, 0},
+		{"SHF_MERGE", Const, 0},
+		{"SHF_OS_NONCONFORMING", Const, 0},
+		{"SHF_STRINGS", Const, 0},
+		{"SHF_TLS", Const, 0},
+		{"SHF_WRITE", Const, 0},
+		{"SHN_ABS", Const, 0},
+		{"SHN_COMMON", Const, 0},
+		{"SHN_HIOS", Const, 0},
+		{"SHN_HIPROC", Const, 0},
+		{"SHN_HIRESERVE", Const, 0},
+		{"SHN_LOOS", Const, 0},
+		{"SHN_LOPROC", Const, 0},
+		{"SHN_LORESERVE", Const, 0},
+		{"SHN_UNDEF", Const, 0},
+		{"SHN_XINDEX", Const, 0},
+		{"SHT_DYNAMIC", Const, 0},
+		{"SHT_DYNSYM", Const, 0},
+		{"SHT_FINI_ARRAY", Const, 0},
+		{"SHT_GNU_ATTRIBUTES", Const, 0},
+		{"SHT_GNU_HASH", Const, 0},
+		{"SHT_GNU_LIBLIST", Const, 0},
+		{"SHT_GNU_VERDEF", Const, 0},
+		{"SHT_GNU_VERNEED", Const, 0},
+		{"SHT_GNU_VERSYM", Const, 0},
+		{"SHT_GROUP", Const, 0},
+		{"SHT_HASH", Const, 0},
+		{"SHT_HIOS", Const, 0},
+		{"SHT_HIPROC", Const, 0},
+		{"SHT_HIUSER", Const, 0},
+		{"SHT_INIT_ARRAY", Const, 0},
+		{"SHT_LOOS", Const, 0},
+		{"SHT_LOPROC", Const, 0},
+		{"SHT_LOUSER", Const, 0},
+		{"SHT_MIPS_ABIFLAGS", Const, 17},
+		{"SHT_NOBITS", Const, 0},
+		{"SHT_NOTE", Const, 0},
+		{"SHT_NULL", Const, 0},
+		{"SHT_PREINIT_ARRAY", Const, 0},
+		{"SHT_PROGBITS", Const, 0},
+		{"SHT_REL", Const, 0},
+		{"SHT_RELA", Const, 0},
+		{"SHT_SHLIB", Const, 0},
+		{"SHT_STRTAB", Const, 0},
+		{"SHT_SYMTAB", Const, 0},
+		{"SHT_SYMTAB_SHNDX", Const, 0},
+		{"STB_GLOBAL", Const, 0},
+		{"STB_HIOS", Const, 0},
+		{"STB_HIPROC", Const, 0},
+		{"STB_LOCAL", Const, 0},
+		{"STB_LOOS", Const, 0},
+		{"STB_LOPROC", Const, 0},
+		{"STB_WEAK", Const, 0},
+		{"STT_COMMON", Const, 0},
+		{"STT_FILE", Const, 0},
+		{"STT_FUNC", Const, 0},
+		{"STT_HIOS", Const, 0},
+		{"STT_HIPROC", Const, 0},
+		{"STT_LOOS", Const, 0},
+		{"STT_LOPROC", Const, 0},
+		{"STT_NOTYPE", Const, 0},
+		{"STT_OBJECT", Const, 0},
+		{"STT_SECTION", Const, 0},
+		{"STT_TLS", Const, 0},
+		{"STV_DEFAULT", Const, 0},
+		{"STV_HIDDEN", Const, 0},
+		{"STV_INTERNAL", Const, 0},
+		{"STV_PROTECTED", Const, 0},
+		{"ST_BIND", Func, 0},
+		{"ST_INFO", Func, 0},
+		{"ST_TYPE", Func, 0},
+		{"ST_VISIBILITY", Func, 0},
+		{"Section", Type, 0},
+		{"Section.ReaderAt", Field, 0},
+		{"Section.SectionHeader", Field, 0},
+		{"Section32", Type, 0},
+		{"Section32.Addr", Field, 0},
+		{"Section32.Addralign", Field, 0},
+		{"Section32.Entsize", Field, 0},
+		{"Section32.Flags", Field, 0},
+		{"Section32.Info", Field, 0},
+		{"Section32.Link", Field, 0},
+		{"Section32.Name", Field, 0},
+		{"Section32.Off", Field, 0},
+		{"Section32.Size", Field, 0},
+		{"Section32.Type", Field, 0},
+		{"Section64", Type, 0},
+		{"Section64.Addr", Field, 0},
+		{"Section64.Addralign", Field, 0},
+		{"Section64.Entsize", Field, 0},
+		{"Section64.Flags", Field, 0},
+		{"Section64.Info", Field, 0},
+		{"Section64.Link", Field, 0},
+		{"Section64.Name", Field, 0},
+		{"Section64.Off", Field, 0},
+		{"Section64.Size", Field, 0},
+		{"Section64.Type", Field, 0},
+		{"SectionFlag", Type, 0},
+		{"SectionHeader", Type, 0},
+		{"SectionHeader.Addr", Field, 0},
+		{"SectionHeader.Addralign", Field, 0},
+		{"SectionHeader.Entsize", Field, 0},
+		{"SectionHeader.FileSize", Field, 6},
+		{"SectionHeader.Flags", Field, 0},
+		{"SectionHeader.Info", Field, 0},
+		{"SectionHeader.Link", Field, 0},
+		{"SectionHeader.Name", Field, 0},
+		{"SectionHeader.Offset", Field, 0},
+		{"SectionHeader.Size", Field, 0},
+		{"SectionHeader.Type", Field, 0},
+		{"SectionIndex", Type, 0},
+		{"SectionType", Type, 0},
+		{"Sym32", Type, 0},
+		{"Sym32.Info", Field, 0},
+		{"Sym32.Name", Field, 0},
+		{"Sym32.Other", Field, 0},
+		{"Sym32.Shndx", Field, 0},
+		{"Sym32.Size", Field, 0},
+		{"Sym32.Value", Field, 0},
+		{"Sym32Size", Const, 0},
+		{"Sym64", Type, 0},
+		{"Sym64.Info", Field, 0},
+		{"Sym64.Name", Field, 0},
+		{"Sym64.Other", Field, 0},
+		{"Sym64.Shndx", Field, 0},
+		{"Sym64.Size", Field, 0},
+		{"Sym64.Value", Field, 0},
+		{"Sym64Size", Const, 0},
+		{"SymBind", Type, 0},
+		{"SymType", Type, 0},
+		{"SymVis", Type, 0},
+		{"Symbol", Type, 0},
+		{"Symbol.Info", Field, 0},
+		{"Symbol.Library", Field, 13},
+		{"Symbol.Name", Field, 0},
+		{"Symbol.Other", Field, 0},
+		{"Symbol.Section", Field, 0},
+		{"Symbol.Size", Field, 0},
+		{"Symbol.Value", Field, 0},
+		{"Symbol.Version", Field, 13},
+		{"Type", Type, 0},
+		{"Version", Type, 0},
+	},
+	"debug/gosym": {
+		{"(*DecodingError).Error", Method, 0},
+		{"(*LineTable).LineToPC", Method, 0},
+		{"(*LineTable).PCToLine", Method, 0},
+		{"(*Sym).BaseName", Method, 0},
+		{"(*Sym).PackageName", Method, 0},
+		{"(*Sym).ReceiverName", Method, 0},
+		{"(*Sym).Static", Method, 0},
+		{"(*Table).LineToPC", Method, 0},
+		{"(*Table).LookupFunc", Method, 0},
+		{"(*Table).LookupSym", Method, 0},
+		{"(*Table).PCToFunc", Method, 0},
+		{"(*Table).PCToLine", Method, 0},
+		{"(*Table).SymByAddr", Method, 0},
+		{"(*UnknownLineError).Error", Method, 0},
+		{"(Func).BaseName", Method, 0},
+		{"(Func).PackageName", Method, 0},
+		{"(Func).ReceiverName", Method, 0},
+		{"(Func).Static", Method, 0},
+		{"(UnknownFileError).Error", Method, 0},
+		{"DecodingError", Type, 0},
+		{"Func", Type, 0},
+		{"Func.End", Field, 0},
+		{"Func.Entry", Field, 0},
+		{"Func.FrameSize", Field, 0},
+		{"Func.LineTable", Field, 0},
+		{"Func.Locals", Field, 0},
+		{"Func.Obj", Field, 0},
+		{"Func.Params", Field, 0},
+		{"Func.Sym", Field, 0},
+		{"LineTable", Type, 0},
+		{"LineTable.Data", Field, 0},
+		{"LineTable.Line", Field, 0},
+		{"LineTable.PC", Field, 0},
+		{"NewLineTable", Func, 0},
+		{"NewTable", Func, 0},
+		{"Obj", Type, 0},
+		{"Obj.Funcs", Field, 0},
+		{"Obj.Paths", Field, 0},
+		{"Sym", Type, 0},
+		{"Sym.Func", Field, 0},
+		{"Sym.GoType", Field, 0},
+		{"Sym.Name", Field, 0},
+		{"Sym.Type", Field, 0},
+		{"Sym.Value", Field, 0},
+		{"Table", Type, 0},
+		{"Table.Files", Field, 0},
+		{"Table.Funcs", Field, 0},
+		{"Table.Objs", Field, 0},
+		{"Table.Syms", Field, 0},
+		{"UnknownFileError", Type, 0},
+		{"UnknownLineError", Type, 0},
+		{"UnknownLineError.File", Field, 0},
+		{"UnknownLineError.Line", Field, 0},
+	},
+	"debug/macho": {
+		{"(*FatFile).Close", Method, 3},
+		{"(*File).Close", Method, 0},
+		{"(*File).DWARF", Method, 0},
+		{"(*File).ImportedLibraries", Method, 0},
+		{"(*File).ImportedSymbols", Method, 0},
+		{"(*File).Section", Method, 0},
+		{"(*File).Segment", Method, 0},
+		{"(*FormatError).Error", Method, 0},
+		{"(*Section).Data", Method, 0},
+		{"(*Section).Open", Method, 0},
+		{"(*Segment).Data", Method, 0},
+		{"(*Segment).Open", Method, 0},
+		{"(Cpu).GoString", Method, 0},
+		{"(Cpu).String", Method, 0},
+		{"(Dylib).Raw", Method, 0},
+		{"(Dysymtab).Raw", Method, 0},
+		{"(FatArch).Close", Method, 3},
+		{"(FatArch).DWARF", Method, 3},
+		{"(FatArch).ImportedLibraries", Method, 3},
+		{"(FatArch).ImportedSymbols", Method, 3},
+		{"(FatArch).Section", Method, 3},
+		{"(FatArch).Segment", Method, 3},
+		{"(LoadBytes).Raw", Method, 0},
+		{"(LoadCmd).GoString", Method, 0},
+		{"(LoadCmd).String", Method, 0},
+		{"(RelocTypeARM).GoString", Method, 10},
+		{"(RelocTypeARM).String", Method, 10},
+		{"(RelocTypeARM64).GoString", Method, 10},
+		{"(RelocTypeARM64).String", Method, 10},
+		{"(RelocTypeGeneric).GoString", Method, 10},
+		{"(RelocTypeGeneric).String", Method, 10},
+		{"(RelocTypeX86_64).GoString", Method, 10},
+		{"(RelocTypeX86_64).String", Method, 10},
+		{"(Rpath).Raw", Method, 10},
+		{"(Section).ReadAt", Method, 0},
+		{"(Segment).Raw", Method, 0},
+		{"(Segment).ReadAt", Method, 0},
+		{"(Symtab).Raw", Method, 0},
+		{"(Type).GoString", Method, 10},
+		{"(Type).String", Method, 10},
+		{"ARM64_RELOC_ADDEND", Const, 10},
+		{"ARM64_RELOC_BRANCH26", Const, 10},
+		{"ARM64_RELOC_GOT_LOAD_PAGE21", Const, 10},
+		{"ARM64_RELOC_GOT_LOAD_PAGEOFF12", Const, 10},
+		{"ARM64_RELOC_PAGE21", Const, 10},
+		{"ARM64_RELOC_PAGEOFF12", Const, 10},
+		{"ARM64_RELOC_POINTER_TO_GOT", Const, 10},
+		{"ARM64_RELOC_SUBTRACTOR", Const, 10},
+		{"ARM64_RELOC_TLVP_LOAD_PAGE21", Const, 10},
+		{"ARM64_RELOC_TLVP_LOAD_PAGEOFF12", Const, 10},
+		{"ARM64_RELOC_UNSIGNED", Const, 10},
+		{"ARM_RELOC_BR24", Const, 10},
+		{"ARM_RELOC_HALF", Const, 10},
+		{"ARM_RELOC_HALF_SECTDIFF", Const, 10},
+		{"ARM_RELOC_LOCAL_SECTDIFF", Const, 10},
+		{"ARM_RELOC_PAIR", Const, 10},
+		{"ARM_RELOC_PB_LA_PTR", Const, 10},
+		{"ARM_RELOC_SECTDIFF", Const, 10},
+		{"ARM_RELOC_VANILLA", Const, 10},
+		{"ARM_THUMB_32BIT_BRANCH", Const, 10},
+		{"ARM_THUMB_RELOC_BR22", Const, 10},
+		{"Cpu", Type, 0},
+		{"Cpu386", Const, 0},
+		{"CpuAmd64", Const, 0},
+		{"CpuArm", Const, 3},
+		{"CpuArm64", Const, 11},
+		{"CpuPpc", Const, 3},
+		{"CpuPpc64", Const, 3},
+		{"Dylib", Type, 0},
+		{"Dylib.CompatVersion", Field, 0},
+		{"Dylib.CurrentVersion", Field, 0},
+		{"Dylib.LoadBytes", Field, 0},
+		{"Dylib.Name", Field, 0},
+		{"Dylib.Time", Field, 0},
+		{"DylibCmd", Type, 0},
+		{"DylibCmd.Cmd", Field, 0},
+		{"DylibCmd.CompatVersion", Field, 0},
+		{"DylibCmd.CurrentVersion", Field, 0},
+		{"DylibCmd.Len", Field, 0},
+		{"DylibCmd.Name", Field, 0},
+		{"DylibCmd.Time", Field, 0},
+		{"Dysymtab", Type, 0},
+		{"Dysymtab.DysymtabCmd", Field, 0},
+		{"Dysymtab.IndirectSyms", Field, 0},
+		{"Dysymtab.LoadBytes", Field, 0},
+		{"DysymtabCmd", Type, 0},
+		{"DysymtabCmd.Cmd", Field, 0},
+		{"DysymtabCmd.Extrefsymoff", Field, 0},
+		{"DysymtabCmd.Extreloff", Field, 0},
+		{"DysymtabCmd.Iextdefsym", Field, 0},
+		{"DysymtabCmd.Ilocalsym", Field, 0},
+		{"DysymtabCmd.Indirectsymoff", Field, 0},
+		{"DysymtabCmd.Iundefsym", Field, 0},
+		{"DysymtabCmd.Len", Field, 0},
+		{"DysymtabCmd.Locreloff", Field, 0},
+		{"DysymtabCmd.Modtaboff", Field, 0},
+		{"DysymtabCmd.Nextdefsym", Field, 0},
+		{"DysymtabCmd.Nextrefsyms", Field, 0},
+		{"DysymtabCmd.Nextrel", Field, 0},
+		{"DysymtabCmd.Nindirectsyms", Field, 0},
+		{"DysymtabCmd.Nlocalsym", Field, 0},
+		{"DysymtabCmd.Nlocrel", Field, 0},
+		{"DysymtabCmd.Nmodtab", Field, 0},
+		{"DysymtabCmd.Ntoc", Field, 0},
+		{"DysymtabCmd.Nundefsym", Field, 0},
+		{"DysymtabCmd.Tocoffset", Field, 0},
+		{"ErrNotFat", Var, 3},
+		{"FatArch", Type, 3},
+		{"FatArch.FatArchHeader", Field, 3},
+		{"FatArch.File", Field, 3},
+		{"FatArchHeader", Type, 3},
+		{"FatArchHeader.Align", Field, 3},
+		{"FatArchHeader.Cpu", Field, 3},
+		{"FatArchHeader.Offset", Field, 3},
+		{"FatArchHeader.Size", Field, 3},
+		{"FatArchHeader.SubCpu", Field, 3},
+		{"FatFile", Type, 3},
+		{"FatFile.Arches", Field, 3},
+		{"FatFile.Magic", Field, 3},
+		{"File", Type, 0},
+		{"File.ByteOrder", Field, 0},
+		{"File.Dysymtab", Field, 0},
+		{"File.FileHeader", Field, 0},
+		{"File.Loads", Field, 0},
+		{"File.Sections", Field, 0},
+		{"File.Symtab", Field, 0},
+		{"FileHeader", Type, 0},
+		{"FileHeader.Cmdsz", Field, 0},
+		{"FileHeader.Cpu", Field, 0},
+		{"FileHeader.Flags", Field, 0},
+		{"FileHeader.Magic", Field, 0},
+		{"FileHeader.Ncmd", Field, 0},
+		{"FileHeader.SubCpu", Field, 0},
+		{"FileHeader.Type", Field, 0},
+		{"FlagAllModsBound", Const, 10},
+		{"FlagAllowStackExecution", Const, 10},
+		{"FlagAppExtensionSafe", Const, 10},
+		{"FlagBindAtLoad", Const, 10},
+		{"FlagBindsToWeak", Const, 10},
+		{"FlagCanonical", Const, 10},
+		{"FlagDeadStrippableDylib", Const, 10},
+		{"FlagDyldLink", Const, 10},
+		{"FlagForceFlat", Const, 10},
+		{"FlagHasTLVDescriptors", Const, 10},
+		{"FlagIncrLink", Const, 10},
+		{"FlagLazyInit", Const, 10},
+		{"FlagNoFixPrebinding", Const, 10},
+		{"FlagNoHeapExecution", Const, 10},
+		{"FlagNoMultiDefs", Const, 10},
+		{"FlagNoReexportedDylibs", Const, 10},
+		{"FlagNoUndefs", Const, 10},
+		{"FlagPIE", Const, 10},
+		{"FlagPrebindable", Const, 10},
+		{"FlagPrebound", Const, 10},
+		{"FlagRootSafe", Const, 10},
+		{"FlagSetuidSafe", Const, 10},
+		{"FlagSplitSegs", Const, 10},
+		{"FlagSubsectionsViaSymbols", Const, 10},
+		{"FlagTwoLevel", Const, 10},
+		{"FlagWeakDefines", Const, 10},
+		{"FormatError", Type, 0},
+		{"GENERIC_RELOC_LOCAL_SECTDIFF", Const, 10},
+		{"GENERIC_RELOC_PAIR", Const, 10},
+		{"GENERIC_RELOC_PB_LA_PTR", Const, 10},
+		{"GENERIC_RELOC_SECTDIFF", Const, 10},
+		{"GENERIC_RELOC_TLV", Const, 10},
+		{"GENERIC_RELOC_VANILLA", Const, 10},
+		{"Load", Type, 0},
+		{"LoadBytes", Type, 0},
+		{"LoadCmd", Type, 0},
+		{"LoadCmdDylib", Const, 0},
+		{"LoadCmdDylinker", Const, 0},
+		{"LoadCmdDysymtab", Const, 0},
+		{"LoadCmdRpath", Const, 10},
+		{"LoadCmdSegment", Const, 0},
+		{"LoadCmdSegment64", Const, 0},
+		{"LoadCmdSymtab", Const, 0},
+		{"LoadCmdThread", Const, 0},
+		{"LoadCmdUnixThread", Const, 0},
+		{"Magic32", Const, 0},
+		{"Magic64", Const, 0},
+		{"MagicFat", Const, 3},
+		{"NewFatFile", Func, 3},
+		{"NewFile", Func, 0},
+		{"Nlist32", Type, 0},
+		{"Nlist32.Desc", Field, 0},
+		{"Nlist32.Name", Field, 0},
+		{"Nlist32.Sect", Field, 0},
+		{"Nlist32.Type", Field, 0},
+		{"Nlist32.Value", Field, 0},
+		{"Nlist64", Type, 0},
+		{"Nlist64.Desc", Field, 0},
+		{"Nlist64.Name", Field, 0},
+		{"Nlist64.Sect", Field, 0},
+		{"Nlist64.Type", Field, 0},
+		{"Nlist64.Value", Field, 0},
+		{"Open", Func, 0},
+		{"OpenFat", Func, 3},
+		{"Regs386", Type, 0},
+		{"Regs386.AX", Field, 0},
+		{"Regs386.BP", Field, 0},
+		{"Regs386.BX", Field, 0},
+		{"Regs386.CS", Field, 0},
+		{"Regs386.CX", Field, 0},
+		{"Regs386.DI", Field, 0},
+		{"Regs386.DS", Field, 0},
+		{"Regs386.DX", Field, 0},
+		{"Regs386.ES", Field, 0},
+		{"Regs386.FLAGS", Field, 0},
+		{"Regs386.FS", Field, 0},
+		{"Regs386.GS", Field, 0},
+		{"Regs386.IP", Field, 0},
+		{"Regs386.SI", Field, 0},
+		{"Regs386.SP", Field, 0},
+		{"Regs386.SS", Field, 0},
+		{"RegsAMD64", Type, 0},
+		{"RegsAMD64.AX", Field, 0},
+		{"RegsAMD64.BP", Field, 0},
+		{"RegsAMD64.BX", Field, 0},
+		{"RegsAMD64.CS", Field, 0},
+		{"RegsAMD64.CX", Field, 0},
+		{"RegsAMD64.DI", Field, 0},
+		{"RegsAMD64.DX", Field, 0},
+		{"RegsAMD64.FLAGS", Field, 0},
+		{"RegsAMD64.FS", Field, 0},
+		{"RegsAMD64.GS", Field, 0},
+		{"RegsAMD64.IP", Field, 0},
+		{"RegsAMD64.R10", Field, 0},
+		{"RegsAMD64.R11", Field, 0},
+		{"RegsAMD64.R12", Field, 0},
+		{"RegsAMD64.R13", Field, 0},
+		{"RegsAMD64.R14", Field, 0},
+		{"RegsAMD64.R15", Field, 0},
+		{"RegsAMD64.R8", Field, 0},
+		{"RegsAMD64.R9", Field, 0},
+		{"RegsAMD64.SI", Field, 0},
+		{"RegsAMD64.SP", Field, 0},
+		{"Reloc", Type, 10},
+		{"Reloc.Addr", Field, 10},
+		{"Reloc.Extern", Field, 10},
+		{"Reloc.Len", Field, 10},
+		{"Reloc.Pcrel", Field, 10},
+		{"Reloc.Scattered", Field, 10},
+		{"Reloc.Type", Field, 10},
+		{"Reloc.Value", Field, 10},
+		{"RelocTypeARM", Type, 10},
+		{"RelocTypeARM64", Type, 10},
+		{"RelocTypeGeneric", Type, 10},
+		{"RelocTypeX86_64", Type, 10},
+		{"Rpath", Type, 10},
+		{"Rpath.LoadBytes", Field, 10},
+		{"Rpath.Path", Field, 10},
+		{"RpathCmd", Type, 10},
+		{"RpathCmd.Cmd", Field, 10},
+		{"RpathCmd.Len", Field, 10},
+		{"RpathCmd.Path", Field, 10},
+		{"Section", Type, 0},
+		{"Section.ReaderAt", Field, 0},
+		{"Section.Relocs", Field, 10},
+		{"Section.SectionHeader", Field, 0},
+		{"Section32", Type, 0},
+		{"Section32.Addr", Field, 0},
+		{"Section32.Align", Field, 0},
+		{"Section32.Flags", Field, 0},
+		{"Section32.Name", Field, 0},
+		{"Section32.Nreloc", Field, 0},
+		{"Section32.Offset", Field, 0},
+		{"Section32.Reloff", Field, 0},
+		{"Section32.Reserve1", Field, 0},
+		{"Section32.Reserve2", Field, 0},
+		{"Section32.Seg", Field, 0},
+		{"Section32.Size", Field, 0},
+		{"Section64", Type, 0},
+		{"Section64.Addr", Field, 0},
+		{"Section64.Align", Field, 0},
+		{"Section64.Flags", Field, 0},
+		{"Section64.Name", Field, 0},
+		{"Section64.Nreloc", Field, 0},
+		{"Section64.Offset", Field, 0},
+		{"Section64.Reloff", Field, 0},
+		{"Section64.Reserve1", Field, 0},
+		{"Section64.Reserve2", Field, 0},
+		{"Section64.Reserve3", Field, 0},
+		{"Section64.Seg", Field, 0},
+		{"Section64.Size", Field, 0},
+		{"SectionHeader", Type, 0},
+		{"SectionHeader.Addr", Field, 0},
+		{"SectionHeader.Align", Field, 0},
+		{"SectionHeader.Flags", Field, 0},
+		{"SectionHeader.Name", Field, 0},
+		{"SectionHeader.Nreloc", Field, 0},
+		{"SectionHeader.Offset", Field, 0},
+		{"SectionHeader.Reloff", Field, 0},
+		{"SectionHeader.Seg", Field, 0},
+		{"SectionHeader.Size", Field, 0},
+		{"Segment", Type, 0},
+		{"Segment.LoadBytes", Field, 0},
+		{"Segment.ReaderAt", Field, 0},
+		{"Segment.SegmentHeader", Field, 0},
+		{"Segment32", Type, 0},
+		{"Segment32.Addr", Field, 0},
+		{"Segment32.Cmd", Field, 0},
+		{"Segment32.Filesz", Field, 0},
+		{"Segment32.Flag", Field, 0},
+		{"Segment32.Len", Field, 0},
+		{"Segment32.Maxprot", Field, 0},
+		{"Segment32.Memsz", Field, 0},
+		{"Segment32.Name", Field, 0},
+		{"Segment32.Nsect", Field, 0},
+		{"Segment32.Offset", Field, 0},
+		{"Segment32.Prot", Field, 0},
+		{"Segment64", Type, 0},
+		{"Segment64.Addr", Field, 0},
+		{"Segment64.Cmd", Field, 0},
+		{"Segment64.Filesz", Field, 0},
+		{"Segment64.Flag", Field, 0},
+		{"Segment64.Len", Field, 0},
+		{"Segment64.Maxprot", Field, 0},
+		{"Segment64.Memsz", Field, 0},
+		{"Segment64.Name", Field, 0},
+		{"Segment64.Nsect", Field, 0},
+		{"Segment64.Offset", Field, 0},
+		{"Segment64.Prot", Field, 0},
+		{"SegmentHeader", Type, 0},
+		{"SegmentHeader.Addr", Field, 0},
+		{"SegmentHeader.Cmd", Field, 0},
+		{"SegmentHeader.Filesz", Field, 0},
+		{"SegmentHeader.Flag", Field, 0},
+		{"SegmentHeader.Len", Field, 0},
+		{"SegmentHeader.Maxprot", Field, 0},
+		{"SegmentHeader.Memsz", Field, 0},
+		{"SegmentHeader.Name", Field, 0},
+		{"SegmentHeader.Nsect", Field, 0},
+		{"SegmentHeader.Offset", Field, 0},
+		{"SegmentHeader.Prot", Field, 0},
+		{"Symbol", Type, 0},
+		{"Symbol.Desc", Field, 0},
+		{"Symbol.Name", Field, 0},
+		{"Symbol.Sect", Field, 0},
+		{"Symbol.Type", Field, 0},
+		{"Symbol.Value", Field, 0},
+		{"Symtab", Type, 0},
+		{"Symtab.LoadBytes", Field, 0},
+		{"Symtab.Syms", Field, 0},
+		{"Symtab.SymtabCmd", Field, 0},
+		{"SymtabCmd", Type, 0},
+		{"SymtabCmd.Cmd", Field, 0},
+		{"SymtabCmd.Len", Field, 0},
+		{"SymtabCmd.Nsyms", Field, 0},
+		{"SymtabCmd.Stroff", Field, 0},
+		{"SymtabCmd.Strsize", Field, 0},
+		{"SymtabCmd.Symoff", Field, 0},
+		{"Thread", Type, 0},
+		{"Thread.Cmd", Field, 0},
+		{"Thread.Data", Field, 0},
+		{"Thread.Len", Field, 0},
+		{"Thread.Type", Field, 0},
+		{"Type", Type, 0},
+		{"TypeBundle", Const, 3},
+		{"TypeDylib", Const, 3},
+		{"TypeExec", Const, 0},
+		{"TypeObj", Const, 0},
+		{"X86_64_RELOC_BRANCH", Const, 10},
+		{"X86_64_RELOC_GOT", Const, 10},
+		{"X86_64_RELOC_GOT_LOAD", Const, 10},
+		{"X86_64_RELOC_SIGNED", Const, 10},
+		{"X86_64_RELOC_SIGNED_1", Const, 10},
+		{"X86_64_RELOC_SIGNED_2", Const, 10},
+		{"X86_64_RELOC_SIGNED_4", Const, 10},
+		{"X86_64_RELOC_SUBTRACTOR", Const, 10},
+		{"X86_64_RELOC_TLV", Const, 10},
+		{"X86_64_RELOC_UNSIGNED", Const, 10},
+	},
+	"debug/pe": {
+		{"(*COFFSymbol).FullName", Method, 8},
+		{"(*File).COFFSymbolReadSectionDefAux", Method, 19},
+		{"(*File).Close", Method, 0},
+		{"(*File).DWARF", Method, 0},
+		{"(*File).ImportedLibraries", Method, 0},
+		{"(*File).ImportedSymbols", Method, 0},
+		{"(*File).Section", Method, 0},
+		{"(*FormatError).Error", Method, 0},
+		{"(*Section).Data", Method, 0},
+		{"(*Section).Open", Method, 0},
+		{"(Section).ReadAt", Method, 0},
+		{"(StringTable).String", Method, 8},
+		{"COFFSymbol", Type, 1},
+		{"COFFSymbol.Name", Field, 1},
+		{"COFFSymbol.NumberOfAuxSymbols", Field, 1},
+		{"COFFSymbol.SectionNumber", Field, 1},
+		{"COFFSymbol.StorageClass", Field, 1},
+		{"COFFSymbol.Type", Field, 1},
+		{"COFFSymbol.Value", Field, 1},
+		{"COFFSymbolAuxFormat5", Type, 19},
+		{"COFFSymbolAuxFormat5.Checksum", Field, 19},
+		{"COFFSymbolAuxFormat5.NumLineNumbers", Field, 19},
+		{"COFFSymbolAuxFormat5.NumRelocs", Field, 19},
+		{"COFFSymbolAuxFormat5.SecNum", Field, 19},
+		{"COFFSymbolAuxFormat5.Selection", Field, 19},
+		{"COFFSymbolAuxFormat5.Size", Field, 19},
+		{"COFFSymbolSize", Const, 1},
+		{"DataDirectory", Type, 3},
+		{"DataDirectory.Size", Field, 3},
+		{"DataDirectory.VirtualAddress", Field, 3},
+		{"File", Type, 0},
+		{"File.COFFSymbols", Field, 8},
+		{"File.FileHeader", Field, 0},
+		{"File.OptionalHeader", Field, 3},
+		{"File.Sections", Field, 0},
+		{"File.StringTable", Field, 8},
+		{"File.Symbols", Field, 1},
+		{"FileHeader", Type, 0},
+		{"FileHeader.Characteristics", Field, 0},
+		{"FileHeader.Machine", Field, 0},
+		{"FileHeader.NumberOfSections", Field, 0},
+		{"FileHeader.NumberOfSymbols", Field, 0},
+		{"FileHeader.PointerToSymbolTable", Field, 0},
+		{"FileHeader.SizeOfOptionalHeader", Field, 0},
+		{"FileHeader.TimeDateStamp", Field, 0},
+		{"FormatError", Type, 0},
+		{"IMAGE_COMDAT_SELECT_ANY", Const, 19},
+		{"IMAGE_COMDAT_SELECT_ASSOCIATIVE", Const, 19},
+		{"IMAGE_COMDAT_SELECT_EXACT_MATCH", Const, 19},
+		{"IMAGE_COMDAT_SELECT_LARGEST", Const, 19},
+		{"IMAGE_COMDAT_SELECT_NODUPLICATES", Const, 19},
+		{"IMAGE_COMDAT_SELECT_SAME_SIZE", Const, 19},
+		{"IMAGE_DIRECTORY_ENTRY_ARCHITECTURE", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_BASERELOC", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_BOUND_IMPORT", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_COM_DESCRIPTOR", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_DEBUG", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_DELAY_IMPORT", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_EXCEPTION", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_EXPORT", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_GLOBALPTR", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_IAT", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_IMPORT", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_LOAD_CONFIG", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_RESOURCE", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_SECURITY", Const, 11},
+		{"IMAGE_DIRECTORY_ENTRY_TLS", Const, 11},
+		{"IMAGE_DLLCHARACTERISTICS_APPCONTAINER", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_DYNAMIC_BASE", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_FORCE_INTEGRITY", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_GUARD_CF", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_HIGH_ENTROPY_VA", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_NO_BIND", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_NO_ISOLATION", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_NO_SEH", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_NX_COMPAT", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_TERMINAL_SERVER_AWARE", Const, 15},
+		{"IMAGE_DLLCHARACTERISTICS_WDM_DRIVER", Const, 15},
+		{"IMAGE_FILE_32BIT_MACHINE", Const, 15},
+		{"IMAGE_FILE_AGGRESIVE_WS_TRIM", Const, 15},
+		{"IMAGE_FILE_BYTES_REVERSED_HI", Const, 15},
+		{"IMAGE_FILE_BYTES_REVERSED_LO", Const, 15},
+		{"IMAGE_FILE_DEBUG_STRIPPED", Const, 15},
+		{"IMAGE_FILE_DLL", Const, 15},
+		{"IMAGE_FILE_EXECUTABLE_IMAGE", Const, 15},
+		{"IMAGE_FILE_LARGE_ADDRESS_AWARE", Const, 15},
+		{"IMAGE_FILE_LINE_NUMS_STRIPPED", Const, 15},
+		{"IMAGE_FILE_LOCAL_SYMS_STRIPPED", Const, 15},
+		{"IMAGE_FILE_MACHINE_AM33", Const, 0},
+		{"IMAGE_FILE_MACHINE_AMD64", Const, 0},
+		{"IMAGE_FILE_MACHINE_ARM", Const, 0},
+		{"IMAGE_FILE_MACHINE_ARM64", Const, 11},
+		{"IMAGE_FILE_MACHINE_ARMNT", Const, 12},
+		{"IMAGE_FILE_MACHINE_EBC", Const, 0},
+		{"IMAGE_FILE_MACHINE_I386", Const, 0},
+		{"IMAGE_FILE_MACHINE_IA64", Const, 0},
+		{"IMAGE_FILE_MACHINE_LOONGARCH32", Const, 19},
+		{"IMAGE_FILE_MACHINE_LOONGARCH64", Const, 19},
+		{"IMAGE_FILE_MACHINE_M32R", Const, 0},
+		{"IMAGE_FILE_MACHINE_MIPS16", Const, 0},
+		{"IMAGE_FILE_MACHINE_MIPSFPU", Const, 0},
+		{"IMAGE_FILE_MACHINE_MIPSFPU16", Const, 0},
+		{"IMAGE_FILE_MACHINE_POWERPC", Const, 0},
+		{"IMAGE_FILE_MACHINE_POWERPCFP", Const, 0},
+		{"IMAGE_FILE_MACHINE_R4000", Const, 0},
+		{"IMAGE_FILE_MACHINE_RISCV128", Const, 20},
+		{"IMAGE_FILE_MACHINE_RISCV32", Const, 20},
+		{"IMAGE_FILE_MACHINE_RISCV64", Const, 20},
+		{"IMAGE_FILE_MACHINE_SH3", Const, 0},
+		{"IMAGE_FILE_MACHINE_SH3DSP", Const, 0},
+		{"IMAGE_FILE_MACHINE_SH4", Const, 0},
+		{"IMAGE_FILE_MACHINE_SH5", Const, 0},
+		{"IMAGE_FILE_MACHINE_THUMB", Const, 0},
+		{"IMAGE_FILE_MACHINE_UNKNOWN", Const, 0},
+		{"IMAGE_FILE_MACHINE_WCEMIPSV2", Const, 0},
+		{"IMAGE_FILE_NET_RUN_FROM_SWAP", Const, 15},
+		{"IMAGE_FILE_RELOCS_STRIPPED", Const, 15},
+		{"IMAGE_FILE_REMOVABLE_RUN_FROM_SWAP", Const, 15},
+		{"IMAGE_FILE_SYSTEM", Const, 15},
+		{"IMAGE_FILE_UP_SYSTEM_ONLY", Const, 15},
+		{"IMAGE_SCN_CNT_CODE", Const, 19},
+		{"IMAGE_SCN_CNT_INITIALIZED_DATA", Const, 19},
+		{"IMAGE_SCN_CNT_UNINITIALIZED_DATA", Const, 19},
+		{"IMAGE_SCN_LNK_COMDAT", Const, 19},
+		{"IMAGE_SCN_MEM_DISCARDABLE", Const, 19},
+		{"IMAGE_SCN_MEM_EXECUTE", Const, 19},
+		{"IMAGE_SCN_MEM_READ", Const, 19},
+		{"IMAGE_SCN_MEM_WRITE", Const, 19},
+		{"IMAGE_SUBSYSTEM_EFI_APPLICATION", Const, 15},
+		{"IMAGE_SUBSYSTEM_EFI_BOOT_SERVICE_DRIVER", Const, 15},
+		{"IMAGE_SUBSYSTEM_EFI_ROM", Const, 15},
+		{"IMAGE_SUBSYSTEM_EFI_RUNTIME_DRIVER", Const, 15},
+		{"IMAGE_SUBSYSTEM_NATIVE", Const, 15},
+		{"IMAGE_SUBSYSTEM_NATIVE_WINDOWS", Const, 15},
+		{"IMAGE_SUBSYSTEM_OS2_CUI", Const, 15},
+		{"IMAGE_SUBSYSTEM_POSIX_CUI", Const, 15},
+		{"IMAGE_SUBSYSTEM_UNKNOWN", Const, 15},
+		{"IMAGE_SUBSYSTEM_WINDOWS_BOOT_APPLICATION", Const, 15},
+		{"IMAGE_SUBSYSTEM_WINDOWS_CE_GUI", Const, 15},
+		{"IMAGE_SUBSYSTEM_WINDOWS_CUI", Const, 15},
+		{"IMAGE_SUBSYSTEM_WINDOWS_GUI", Const, 15},
+		{"IMAGE_SUBSYSTEM_XBOX", Const, 15},
+		{"ImportDirectory", Type, 0},
+		{"ImportDirectory.FirstThunk", Field, 0},
+		{"ImportDirectory.ForwarderChain", Field, 0},
+		{"ImportDirectory.Name", Field, 0},
+		{"ImportDirectory.OriginalFirstThunk", Field, 0},
+		{"ImportDirectory.TimeDateStamp", Field, 0},
+		{"NewFile", Func, 0},
+		{"Open", Func, 0},
+		{"OptionalHeader32", Type, 3},
+		{"OptionalHeader32.AddressOfEntryPoint", Field, 3},
+		{"OptionalHeader32.BaseOfCode", Field, 3},
+		{"OptionalHeader32.BaseOfData", Field, 3},
+		{"OptionalHeader32.CheckSum", Field, 3},
+		{"OptionalHeader32.DataDirectory", Field, 3},
+		{"OptionalHeader32.DllCharacteristics", Field, 3},
+		{"OptionalHeader32.FileAlignment", Field, 3},
+		{"OptionalHeader32.ImageBase", Field, 3},
+		{"OptionalHeader32.LoaderFlags", Field, 3},
+		{"OptionalHeader32.Magic", Field, 3},
+		{"OptionalHeader32.MajorImageVersion", Field, 3},
+		{"OptionalHeader32.MajorLinkerVersion", Field, 3},
+		{"OptionalHeader32.MajorOperatingSystemVersion", Field, 3},
+		{"OptionalHeader32.MajorSubsystemVersion", Field, 3},
+		{"OptionalHeader32.MinorImageVersion", Field, 3},
+		{"OptionalHeader32.MinorLinkerVersion", Field, 3},
+		{"OptionalHeader32.MinorOperatingSystemVersion", Field, 3},
+		{"OptionalHeader32.MinorSubsystemVersion", Field, 3},
+		{"OptionalHeader32.NumberOfRvaAndSizes", Field, 3},
+		{"OptionalHeader32.SectionAlignment", Field, 3},
+		{"OptionalHeader32.SizeOfCode", Field, 3},
+		{"OptionalHeader32.SizeOfHeaders", Field, 3},
+		{"OptionalHeader32.SizeOfHeapCommit", Field, 3},
+		{"OptionalHeader32.SizeOfHeapReserve", Field, 3},
+		{"OptionalHeader32.SizeOfImage", Field, 3},
+		{"OptionalHeader32.SizeOfInitializedData", Field, 3},
+		{"OptionalHeader32.SizeOfStackCommit", Field, 3},
+		{"OptionalHeader32.SizeOfStackReserve", Field, 3},
+		{"OptionalHeader32.SizeOfUninitializedData", Field, 3},
+		{"OptionalHeader32.Subsystem", Field, 3},
+		{"OptionalHeader32.Win32VersionValue", Field, 3},
+		{"OptionalHeader64", Type, 3},
+		{"OptionalHeader64.AddressOfEntryPoint", Field, 3},
+		{"OptionalHeader64.BaseOfCode", Field, 3},
+		{"OptionalHeader64.CheckSum", Field, 3},
+		{"OptionalHeader64.DataDirectory", Field, 3},
+		{"OptionalHeader64.DllCharacteristics", Field, 3},
+		{"OptionalHeader64.FileAlignment", Field, 3},
+		{"OptionalHeader64.ImageBase", Field, 3},
+		{"OptionalHeader64.LoaderFlags", Field, 3},
+		{"OptionalHeader64.Magic", Field, 3},
+		{"OptionalHeader64.MajorImageVersion", Field, 3},
+		{"OptionalHeader64.MajorLinkerVersion", Field, 3},
+		{"OptionalHeader64.MajorOperatingSystemVersion", Field, 3},
+		{"OptionalHeader64.MajorSubsystemVersion", Field, 3},
+		{"OptionalHeader64.MinorImageVersion", Field, 3},
+		{"OptionalHeader64.MinorLinkerVersion", Field, 3},
+		{"OptionalHeader64.MinorOperatingSystemVersion", Field, 3},
+		{"OptionalHeader64.MinorSubsystemVersion", Field, 3},
+		{"OptionalHeader64.NumberOfRvaAndSizes", Field, 3},
+		{"OptionalHeader64.SectionAlignment", Field, 3},
+		{"OptionalHeader64.SizeOfCode", Field, 3},
+		{"OptionalHeader64.SizeOfHeaders", Field, 3},
+		{"OptionalHeader64.SizeOfHeapCommit", Field, 3},
+		{"OptionalHeader64.SizeOfHeapReserve", Field, 3},
+		{"OptionalHeader64.SizeOfImage", Field, 3},
+		{"OptionalHeader64.SizeOfInitializedData", Field, 3},
+		{"OptionalHeader64.SizeOfStackCommit", Field, 3},
+		{"OptionalHeader64.SizeOfStackReserve", Field, 3},
+		{"OptionalHeader64.SizeOfUninitializedData", Field, 3},
+		{"OptionalHeader64.Subsystem", Field, 3},
+		{"OptionalHeader64.Win32VersionValue", Field, 3},
+		{"Reloc", Type, 8},
+		{"Reloc.SymbolTableIndex", Field, 8},
+		{"Reloc.Type", Field, 8},
+		{"Reloc.VirtualAddress", Field, 8},
+		{"Section", Type, 0},
+		{"Section.ReaderAt", Field, 0},
+		{"Section.Relocs", Field, 8},
+		{"Section.SectionHeader", Field, 0},
+		{"SectionHeader", Type, 0},
+		{"SectionHeader.Characteristics", Field, 0},
+		{"SectionHeader.Name", Field, 0},
+		{"SectionHeader.NumberOfLineNumbers", Field, 0},
+		{"SectionHeader.NumberOfRelocations", Field, 0},
+		{"SectionHeader.Offset", Field, 0},
+		{"SectionHeader.PointerToLineNumbers", Field, 0},
+		{"SectionHeader.PointerToRelocations", Field, 0},
+		{"SectionHeader.Size", Field, 0},
+		{"SectionHeader.VirtualAddress", Field, 0},
+		{"SectionHeader.VirtualSize", Field, 0},
+		{"SectionHeader32", Type, 0},
+		{"SectionHeader32.Characteristics", Field, 0},
+		{"SectionHeader32.Name", Field, 0},
+		{"SectionHeader32.NumberOfLineNumbers", Field, 0},
+		{"SectionHeader32.NumberOfRelocations", Field, 0},
+		{"SectionHeader32.PointerToLineNumbers", Field, 0},
+		{"SectionHeader32.PointerToRawData", Field, 0},
+		{"SectionHeader32.PointerToRelocations", Field, 0},
+		{"SectionHeader32.SizeOfRawData", Field, 0},
+		{"SectionHeader32.VirtualAddress", Field, 0},
+		{"SectionHeader32.VirtualSize", Field, 0},
+		{"StringTable", Type, 8},
+		{"Symbol", Type, 1},
+		{"Symbol.Name", Field, 1},
+		{"Symbol.SectionNumber", Field, 1},
+		{"Symbol.StorageClass", Field, 1},
+		{"Symbol.Type", Field, 1},
+		{"Symbol.Value", Field, 1},
+	},
+	"debug/plan9obj": {
+		{"(*File).Close", Method, 3},
+		{"(*File).Section", Method, 3},
+		{"(*File).Symbols", Method, 3},
+		{"(*Section).Data", Method, 3},
+		{"(*Section).Open", Method, 3},
+		{"(Section).ReadAt", Method, 3},
+		{"ErrNoSymbols", Var, 18},
+		{"File", Type, 3},
+		{"File.FileHeader", Field, 3},
+		{"File.Sections", Field, 3},
+		{"FileHeader", Type, 3},
+		{"FileHeader.Bss", Field, 3},
+		{"FileHeader.Entry", Field, 3},
+		{"FileHeader.HdrSize", Field, 4},
+		{"FileHeader.LoadAddress", Field, 4},
+		{"FileHeader.Magic", Field, 3},
+		{"FileHeader.PtrSize", Field, 3},
+		{"Magic386", Const, 3},
+		{"Magic64", Const, 3},
+		{"MagicAMD64", Const, 3},
+		{"MagicARM", Const, 3},
+		{"NewFile", Func, 3},
+		{"Open", Func, 3},
+		{"Section", Type, 3},
+		{"Section.ReaderAt", Field, 3},
+		{"Section.SectionHeader", Field, 3},
+		{"SectionHeader", Type, 3},
+		{"SectionHeader.Name", Field, 3},
+		{"SectionHeader.Offset", Field, 3},
+		{"SectionHeader.Size", Field, 3},
+		{"Sym", Type, 3},
+		{"Sym.Name", Field, 3},
+		{"Sym.Type", Field, 3},
+		{"Sym.Value", Field, 3},
+	},
+	"embed": {
+		{"(FS).Open", Method, 16},
+		{"(FS).ReadDir", Method, 16},
+		{"(FS).ReadFile", Method, 16},
+		{"FS", Type, 16},
+	},
+	"encoding": {
+		{"BinaryMarshaler", Type, 2},
+		{"BinaryUnmarshaler", Type, 2},
+		{"TextMarshaler", Type, 2},
+		{"TextUnmarshaler", Type, 2},
+	},
+	"encoding/ascii85": {
+		{"(CorruptInputError).Error", Method, 0},
+		{"CorruptInputError", Type, 0},
+		{"Decode", Func, 0},
+		{"Encode", Func, 0},
+		{"MaxEncodedLen", Func, 0},
+		{"NewDecoder", Func, 0},
+		{"NewEncoder", Func, 0},
+	},
+	"encoding/asn1": {
+		{"(BitString).At", Method, 0},
+		{"(BitString).RightAlign", Method, 0},
+		{"(ObjectIdentifier).Equal", Method, 0},
+		{"(ObjectIdentifier).String", Method, 3},
+		{"(StructuralError).Error", Method, 0},
+		{"(SyntaxError).Error", Method, 0},
+		{"BitString", Type, 0},
+		{"BitString.BitLength", Field, 0},
+		{"BitString.Bytes", Field, 0},
+		{"ClassApplication", Const, 6},
+		{"ClassContextSpecific", Const, 6},
+		{"ClassPrivate", Const, 6},
+		{"ClassUniversal", Const, 6},
+		{"Enumerated", Type, 0},
+		{"Flag", Type, 0},
+		{"Marshal", Func, 0},
+		{"MarshalWithParams", Func, 10},
+		{"NullBytes", Var, 9},
+		{"NullRawValue", Var, 9},
+		{"ObjectIdentifier", Type, 0},
+		{"RawContent", Type, 0},
+		{"RawValue", Type, 0},
+		{"RawValue.Bytes", Field, 0},
+		{"RawValue.Class", Field, 0},
+		{"RawValue.FullBytes", Field, 0},
+		{"RawValue.IsCompound", Field, 0},
+		{"RawValue.Tag", Field, 0},
+		{"StructuralError", Type, 0},
+		{"StructuralError.Msg", Field, 0},
+		{"SyntaxError", Type, 0},
+		{"SyntaxError.Msg", Field, 0},
+		{"TagBMPString", Const, 14},
+		{"TagBitString", Const, 6},
+		{"TagBoolean", Const, 6},
+		{"TagEnum", Const, 6},
+		{"TagGeneralString", Const, 6},
+		{"TagGeneralizedTime", Const, 6},
+		{"TagIA5String", Const, 6},
+		{"TagInteger", Const, 6},
+		{"TagNull", Const, 9},
+		{"TagNumericString", Const, 10},
+		{"TagOID", Const, 6},
+		{"TagOctetString", Const, 6},
+		{"TagPrintableString", Const, 6},
+		{"TagSequence", Const, 6},
+		{"TagSet", Const, 6},
+		{"TagT61String", Const, 6},
+		{"TagUTCTime", Const, 6},
+		{"TagUTF8String", Const, 6},
+		{"Unmarshal", Func, 0},
+		{"UnmarshalWithParams", Func, 0},
+	},
+	"encoding/base32": {
+		{"(*Encoding).AppendDecode", Method, 22},
+		{"(*Encoding).AppendEncode", Method, 22},
+		{"(*Encoding).Decode", Method, 0},
+		{"(*Encoding).DecodeString", Method, 0},
+		{"(*Encoding).DecodedLen", Method, 0},
+		{"(*Encoding).Encode", Method, 0},
+		{"(*Encoding).EncodeToString", Method, 0},
+		{"(*Encoding).EncodedLen", Method, 0},
+		{"(CorruptInputError).Error", Method, 0},
+		{"(Encoding).WithPadding", Method, 9},
+		{"CorruptInputError", Type, 0},
+		{"Encoding", Type, 0},
+		{"HexEncoding", Var, 0},
+		{"NewDecoder", Func, 0},
+		{"NewEncoder", Func, 0},
+		{"NewEncoding", Func, 0},
+		{"NoPadding", Const, 9},
+		{"StdEncoding", Var, 0},
+		{"StdPadding", Const, 9},
+	},
+	"encoding/base64": {
+		{"(*Encoding).AppendDecode", Method, 22},
+		{"(*Encoding).AppendEncode", Method, 22},
+		{"(*Encoding).Decode", Method, 0},
+		{"(*Encoding).DecodeString", Method, 0},
+		{"(*Encoding).DecodedLen", Method, 0},
+		{"(*Encoding).Encode", Method, 0},
+		{"(*Encoding).EncodeToString", Method, 0},
+		{"(*Encoding).EncodedLen", Method, 0},
+		{"(CorruptInputError).Error", Method, 0},
+		{"(Encoding).Strict", Method, 8},
+		{"(Encoding).WithPadding", Method, 5},
+		{"CorruptInputError", Type, 0},
+		{"Encoding", Type, 0},
+		{"NewDecoder", Func, 0},
+		{"NewEncoder", Func, 0},
+		{"NewEncoding", Func, 0},
+		{"NoPadding", Const, 5},
+		{"RawStdEncoding", Var, 5},
+		{"RawURLEncoding", Var, 5},
+		{"StdEncoding", Var, 0},
+		{"StdPadding", Const, 5},
+		{"URLEncoding", Var, 0},
+	},
+	"encoding/binary": {
+		{"AppendByteOrder", Type, 19},
+		{"AppendUvarint", Func, 19},
+		{"AppendVarint", Func, 19},
+		{"BigEndian", Var, 0},
+		{"ByteOrder", Type, 0},
+		{"LittleEndian", Var, 0},
+		{"MaxVarintLen16", Const, 0},
+		{"MaxVarintLen32", Const, 0},
+		{"MaxVarintLen64", Const, 0},
+		{"NativeEndian", Var, 21},
+		{"PutUvarint", Func, 0},
+		{"PutVarint", Func, 0},
+		{"Read", Func, 0},
+		{"ReadUvarint", Func, 0},
+		{"ReadVarint", Func, 0},
+		{"Size", Func, 0},
+		{"Uvarint", Func, 0},
+		{"Varint", Func, 0},
+		{"Write", Func, 0},
+	},
+	"encoding/csv": {
+		{"(*ParseError).Error", Method, 0},
+		{"(*ParseError).Unwrap", Method, 13},
+		{"(*Reader).FieldPos", Method, 17},
+		{"(*Reader).InputOffset", Method, 19},
+		{"(*Reader).Read", Method, 0},
+		{"(*Reader).ReadAll", Method, 0},
+		{"(*Writer).Error", Method, 1},
+		{"(*Writer).Flush", Method, 0},
+		{"(*Writer).Write", Method, 0},
+		{"(*Writer).WriteAll", Method, 0},
+		{"ErrBareQuote", Var, 0},
+		{"ErrFieldCount", Var, 0},
+		{"ErrQuote", Var, 0},
+		{"ErrTrailingComma", Var, 0},
+		{"NewReader", Func, 0},
+		{"NewWriter", Func, 0},
+		{"ParseError", Type, 0},
+		{"ParseError.Column", Field, 0},
+		{"ParseError.Err", Field, 0},
+		{"ParseError.Line", Field, 0},
+		{"ParseError.StartLine", Field, 10},
+		{"Reader", Type, 0},
+		{"Reader.Comma", Field, 0},
+		{"Reader.Comment", Field, 0},
+		{"Reader.FieldsPerRecord", Field, 0},
+		{"Reader.LazyQuotes", Field, 0},
+		{"Reader.ReuseRecord", Field, 9},
+		{"Reader.TrailingComma", Field, 0},
+		{"Reader.TrimLeadingSpace", Field, 0},
+		{"Writer", Type, 0},
+		{"Writer.Comma", Field, 0},
+		{"Writer.UseCRLF", Field, 0},
+	},
+	"encoding/gob": {
+		{"(*Decoder).Decode", Method, 0},
+		{"(*Decoder).DecodeValue", Method, 0},
+		{"(*Encoder).Encode", Method, 0},
+		{"(*Encoder).EncodeValue", Method, 0},
+		{"CommonType", Type, 0},
+		{"CommonType.Id", Field, 0},
+		{"CommonType.Name", Field, 0},
+		{"Decoder", Type, 0},
+		{"Encoder", Type, 0},
+		{"GobDecoder", Type, 0},
+		{"GobEncoder", Type, 0},
+		{"NewDecoder", Func, 0},
+		{"NewEncoder", Func, 0},
+		{"Register", Func, 0},
+		{"RegisterName", Func, 0},
+	},
+	"encoding/hex": {
+		{"(InvalidByteError).Error", Method, 0},
+		{"AppendDecode", Func, 22},
+		{"AppendEncode", Func, 22},
+		{"Decode", Func, 0},
+		{"DecodeString", Func, 0},
+		{"DecodedLen", Func, 0},
+		{"Dump", Func, 0},
+		{"Dumper", Func, 0},
+		{"Encode", Func, 0},
+		{"EncodeToString", Func, 0},
+		{"EncodedLen", Func, 0},
+		{"ErrLength", Var, 0},
+		{"InvalidByteError", Type, 0},
+		{"NewDecoder", Func, 10},
+		{"NewEncoder", Func, 10},
+	},
+	"encoding/json": {
+		{"(*Decoder).Buffered", Method, 1},
+		{"(*Decoder).Decode", Method, 0},
+		{"(*Decoder).DisallowUnknownFields", Method, 10},
+		{"(*Decoder).InputOffset", Method, 14},
+		{"(*Decoder).More", Method, 5},
+		{"(*Decoder).Token", Method, 5},
+		{"(*Decoder).UseNumber", Method, 1},
+		{"(*Encoder).Encode", Method, 0},
+		{"(*Encoder).SetEscapeHTML", Method, 7},
+		{"(*Encoder).SetIndent", Method, 7},
+		{"(*InvalidUTF8Error).Error", Method, 0},
+		{"(*InvalidUnmarshalError).Error", Method, 0},
+		{"(*MarshalerError).Error", Method, 0},
+		{"(*MarshalerError).Unwrap", Method, 13},
+		{"(*RawMessage).MarshalJSON", Method, 0},
+		{"(*RawMessage).UnmarshalJSON", Method, 0},
+		{"(*SyntaxError).Error", Method, 0},
+		{"(*UnmarshalFieldError).Error", Method, 0},
+		{"(*UnmarshalTypeError).Error", Method, 0},
+		{"(*UnsupportedTypeError).Error", Method, 0},
+		{"(*UnsupportedValueError).Error", Method, 0},
+		{"(Delim).String", Method, 5},
+		{"(Number).Float64", Method, 1},
+		{"(Number).Int64", Method, 1},
+		{"(Number).String", Method, 1},
+		{"(RawMessage).MarshalJSON", Method, 8},
+		{"Compact", Func, 0},
+		{"Decoder", Type, 0},
+		{"Delim", Type, 5},
+		{"Encoder", Type, 0},
+		{"HTMLEscape", Func, 0},
+		{"Indent", Func, 0},
+		{"InvalidUTF8Error", Type, 0},
+		{"InvalidUTF8Error.S", Field, 0},
+		{"InvalidUnmarshalError", Type, 0},
+		{"InvalidUnmarshalError.Type", Field, 0},
+		{"Marshal", Func, 0},
+		{"MarshalIndent", Func, 0},
+		{"Marshaler", Type, 0},
+		{"MarshalerError", Type, 0},
+		{"MarshalerError.Err", Field, 0},
+		{"MarshalerError.Type", Field, 0},
+		{"NewDecoder", Func, 0},
+		{"NewEncoder", Func, 0},
+		{"Number", Type, 1},
+		{"RawMessage", Type, 0},
+		{"SyntaxError", Type, 0},
+		{"SyntaxError.Offset", Field, 0},
+		{"Token", Type, 5},
+		{"Unmarshal", Func, 0},
+		{"UnmarshalFieldError", Type, 0},
+		{"UnmarshalFieldError.Field", Field, 0},
+		{"UnmarshalFieldError.Key", Field, 0},
+		{"UnmarshalFieldError.Type", Field, 0},
+		{"UnmarshalTypeError", Type, 0},
+		{"UnmarshalTypeError.Field", Field, 8},
+		{"UnmarshalTypeError.Offset", Field, 5},
+		{"UnmarshalTypeError.Struct", Field, 8},
+		{"UnmarshalTypeError.Type", Field, 0},
+		{"UnmarshalTypeError.Value", Field, 0},
+		{"Unmarshaler", Type, 0},
+		{"UnsupportedTypeError", Type, 0},
+		{"UnsupportedTypeError.Type", Field, 0},
+		{"UnsupportedValueError", Type, 0},
+		{"UnsupportedValueError.Str", Field, 0},
+		{"UnsupportedValueError.Value", Field, 0},
+		{"Valid", Func, 9},
+	},
+	"encoding/pem": {
+		{"Block", Type, 0},
+		{"Block.Bytes", Field, 0},
+		{"Block.Headers", Field, 0},
+		{"Block.Type", Field, 0},
+		{"Decode", Func, 0},
+		{"Encode", Func, 0},
+		{"EncodeToMemory", Func, 0},
+	},
+	"encoding/xml": {
+		{"(*Decoder).Decode", Method, 0},
+		{"(*Decoder).DecodeElement", Method, 0},
+		{"(*Decoder).InputOffset", Method, 4},
+		{"(*Decoder).InputPos", Method, 19},
+		{"(*Decoder).RawToken", Method, 0},
+		{"(*Decoder).Skip", Method, 0},
+		{"(*Decoder).Token", Method, 0},
+		{"(*Encoder).Close", Method, 20},
+		{"(*Encoder).Encode", Method, 0},
+		{"(*Encoder).EncodeElement", Method, 2},
+		{"(*Encoder).EncodeToken", Method, 2},
+		{"(*Encoder).Flush", Method, 2},
+		{"(*Encoder).Indent", Method, 1},
+		{"(*SyntaxError).Error", Method, 0},
+		{"(*TagPathError).Error", Method, 0},
+		{"(*UnsupportedTypeError).Error", Method, 0},
+		{"(CharData).Copy", Method, 0},
+		{"(Comment).Copy", Method, 0},
+		{"(Directive).Copy", Method, 0},
+		{"(ProcInst).Copy", Method, 0},
+		{"(StartElement).Copy", Method, 0},
+		{"(StartElement).End", Method, 2},
+		{"(UnmarshalError).Error", Method, 0},
+		{"Attr", Type, 0},
+		{"Attr.Name", Field, 0},
+		{"Attr.Value", Field, 0},
+		{"CharData", Type, 0},
+		{"Comment", Type, 0},
+		{"CopyToken", Func, 0},
+		{"Decoder", Type, 0},
+		{"Decoder.AutoClose", Field, 0},
+		{"Decoder.CharsetReader", Field, 0},
+		{"Decoder.DefaultSpace", Field, 1},
+		{"Decoder.Entity", Field, 0},
+		{"Decoder.Strict", Field, 0},
+		{"Directive", Type, 0},
+		{"Encoder", Type, 0},
+		{"EndElement", Type, 0},
+		{"EndElement.Name", Field, 0},
+		{"Escape", Func, 0},
+		{"EscapeText", Func, 1},
+		{"HTMLAutoClose", Var, 0},
+		{"HTMLEntity", Var, 0},
+		{"Header", Const, 0},
+		{"Marshal", Func, 0},
+		{"MarshalIndent", Func, 0},
+		{"Marshaler", Type, 2},
+		{"MarshalerAttr", Type, 2},
+		{"Name", Type, 0},
+		{"Name.Local", Field, 0},
+		{"Name.Space", Field, 0},
+		{"NewDecoder", Func, 0},
+		{"NewEncoder", Func, 0},
+		{"NewTokenDecoder", Func, 10},
+		{"ProcInst", Type, 0},
+		{"ProcInst.Inst", Field, 0},
+		{"ProcInst.Target", Field, 0},
+		{"StartElement", Type, 0},
+		{"StartElement.Attr", Field, 0},
+		{"StartElement.Name", Field, 0},
+		{"SyntaxError", Type, 0},
+		{"SyntaxError.Line", Field, 0},
+		{"SyntaxError.Msg", Field, 0},
+		{"TagPathError", Type, 0},
+		{"TagPathError.Field1", Field, 0},
+		{"TagPathError.Field2", Field, 0},
+		{"TagPathError.Struct", Field, 0},
+		{"TagPathError.Tag1", Field, 0},
+		{"TagPathError.Tag2", Field, 0},
+		{"Token", Type, 0},
+		{"TokenReader", Type, 10},
+		{"Unmarshal", Func, 0},
+		{"UnmarshalError", Type, 0},
+		{"Unmarshaler", Type, 2},
+		{"UnmarshalerAttr", Type, 2},
+		{"UnsupportedTypeError", Type, 0},
+		{"UnsupportedTypeError.Type", Field, 0},
+	},
+	"errors": {
+		{"As", Func, 13},
+		{"ErrUnsupported", Var, 21},
+		{"Is", Func, 13},
+		{"Join", Func, 20},
+		{"New", Func, 0},
+		{"Unwrap", Func, 13},
+	},
+	"expvar": {
+		{"(*Float).Add", Method, 0},
+		{"(*Float).Set", Method, 0},
+		{"(*Float).String", Method, 0},
+		{"(*Float).Value", Method, 8},
+		{"(*Int).Add", Method, 0},
+		{"(*Int).Set", Method, 0},
+		{"(*Int).String", Method, 0},
+		{"(*Int).Value", Method, 8},
+		{"(*Map).Add", Method, 0},
+		{"(*Map).AddFloat", Method, 0},
+		{"(*Map).Delete", Method, 12},
+		{"(*Map).Do", Method, 0},
+		{"(*Map).Get", Method, 0},
+		{"(*Map).Init", Method, 0},
+		{"(*Map).Set", Method, 0},
+		{"(*Map).String", Method, 0},
+		{"(*String).Set", Method, 0},
+		{"(*String).String", Method, 0},
+		{"(*String).Value", Method, 8},
+		{"(Func).String", Method, 0},
+		{"(Func).Value", Method, 8},
+		{"Do", Func, 0},
+		{"Float", Type, 0},
+		{"Func", Type, 0},
+		{"Get", Func, 0},
+		{"Handler", Func, 8},
+		{"Int", Type, 0},
+		{"KeyValue", Type, 0},
+		{"KeyValue.Key", Field, 0},
+		{"KeyValue.Value", Field, 0},
+		{"Map", Type, 0},
+		{"NewFloat", Func, 0},
+		{"NewInt", Func, 0},
+		{"NewMap", Func, 0},
+		{"NewString", Func, 0},
+		{"Publish", Func, 0},
+		{"String", Type, 0},
+		{"Var", Type, 0},
+	},
+	"flag": {
+		{"(*FlagSet).Arg", Method, 0},
+		{"(*FlagSet).Args", Method, 0},
+		{"(*FlagSet).Bool", Method, 0},
+		{"(*FlagSet).BoolFunc", Method, 21},
+		{"(*FlagSet).BoolVar", Method, 0},
+		{"(*FlagSet).Duration", Method, 0},
+		{"(*FlagSet).DurationVar", Method, 0},
+		{"(*FlagSet).ErrorHandling", Method, 10},
+		{"(*FlagSet).Float64", Method, 0},
+		{"(*FlagSet).Float64Var", Method, 0},
+		{"(*FlagSet).Func", Method, 16},
+		{"(*FlagSet).Init", Method, 0},
+		{"(*FlagSet).Int", Method, 0},
+		{"(*FlagSet).Int64", Method, 0},
+		{"(*FlagSet).Int64Var", Method, 0},
+		{"(*FlagSet).IntVar", Method, 0},
+		{"(*FlagSet).Lookup", Method, 0},
+		{"(*FlagSet).NArg", Method, 0},
+		{"(*FlagSet).NFlag", Method, 0},
+		{"(*FlagSet).Name", Method, 10},
+		{"(*FlagSet).Output", Method, 10},
+		{"(*FlagSet).Parse", Method, 0},
+		{"(*FlagSet).Parsed", Method, 0},
+		{"(*FlagSet).PrintDefaults", Method, 0},
+		{"(*FlagSet).Set", Method, 0},
+		{"(*FlagSet).SetOutput", Method, 0},
+		{"(*FlagSet).String", Method, 0},
+		{"(*FlagSet).StringVar", Method, 0},
+		{"(*FlagSet).TextVar", Method, 19},
+		{"(*FlagSet).Uint", Method, 0},
+		{"(*FlagSet).Uint64", Method, 0},
+		{"(*FlagSet).Uint64Var", Method, 0},
+		{"(*FlagSet).UintVar", Method, 0},
+		{"(*FlagSet).Var", Method, 0},
+		{"(*FlagSet).Visit", Method, 0},
+		{"(*FlagSet).VisitAll", Method, 0},
+		{"Arg", Func, 0},
+		{"Args", Func, 0},
+		{"Bool", Func, 0},
+		{"BoolFunc", Func, 21},
+		{"BoolVar", Func, 0},
+		{"CommandLine", Var, 2},
+		{"ContinueOnError", Const, 0},
+		{"Duration", Func, 0},
+		{"DurationVar", Func, 0},
+		{"ErrHelp", Var, 0},
+		{"ErrorHandling", Type, 0},
+		{"ExitOnError", Const, 0},
+		{"Flag", Type, 0},
+		{"Flag.DefValue", Field, 0},
+		{"Flag.Name", Field, 0},
+		{"Flag.Usage", Field, 0},
+		{"Flag.Value", Field, 0},
+		{"FlagSet", Type, 0},
+		{"FlagSet.Usage", Field, 0},
+		{"Float64", Func, 0},
+		{"Float64Var", Func, 0},
+		{"Func", Func, 16},
+		{"Getter", Type, 2},
+		{"Int", Func, 0},
+		{"Int64", Func, 0},
+		{"Int64Var", Func, 0},
+		{"IntVar", Func, 0},
+		{"Lookup", Func, 0},
+		{"NArg", Func, 0},
+		{"NFlag", Func, 0},
+		{"NewFlagSet", Func, 0},
+		{"PanicOnError", Const, 0},
+		{"Parse", Func, 0},
+		{"Parsed", Func, 0},
+		{"PrintDefaults", Func, 0},
+		{"Set", Func, 0},
+		{"String", Func, 0},
+		{"StringVar", Func, 0},
+		{"TextVar", Func, 19},
+		{"Uint", Func, 0},
+		{"Uint64", Func, 0},
+		{"Uint64Var", Func, 0},
+		{"UintVar", Func, 0},
+		{"UnquoteUsage", Func, 5},
+		{"Usage", Var, 0},
+		{"Value", Type, 0},
+		{"Var", Func, 0},
+		{"Visit", Func, 0},
+		{"VisitAll", Func, 0},
+	},
+	"fmt": {
+		{"Append", Func, 19},
+		{"Appendf", Func, 19},
+		{"Appendln", Func, 19},
+		{"Errorf", Func, 0},
+		{"FormatString", Func, 20},
+		{"Formatter", Type, 0},
+		{"Fprint", Func, 0},
+		{"Fprintf", Func, 0},
+		{"Fprintln", Func, 0},
+		{"Fscan", Func, 0},
+		{"Fscanf", Func, 0},
+		{"Fscanln", Func, 0},
+		{"GoStringer", Type, 0},
+		{"Print", Func, 0},
+		{"Printf", Func, 0},
+		{"Println", Func, 0},
+		{"Scan", Func, 0},
+		{"ScanState", Type, 0},
+		{"Scanf", Func, 0},
+		{"Scanln", Func, 0},
+		{"Scanner", Type, 0},
+		{"Sprint", Func, 0},
+		{"Sprintf", Func, 0},
+		{"Sprintln", Func, 0},
+		{"Sscan", Func, 0},
+		{"Sscanf", Func, 0},
+		{"Sscanln", Func, 0},
+		{"State", Type, 0},
+		{"Stringer", Type, 0},
+	},
+	"go/ast": {
+		{"(*ArrayType).End", Method, 0},
+		{"(*ArrayType).Pos", Method, 0},
+		{"(*AssignStmt).End", Method, 0},
+		{"(*AssignStmt).Pos", Method, 0},
+		{"(*BadDecl).End", Method, 0},
+		{"(*BadDecl).Pos", Method, 0},
+		{"(*BadExpr).End", Method, 0},
+		{"(*BadExpr).Pos", Method, 0},
+		{"(*BadStmt).End", Method, 0},
+		{"(*BadStmt).Pos", Method, 0},
+		{"(*BasicLit).End", Method, 0},
+		{"(*BasicLit).Pos", Method, 0},
+		{"(*BinaryExpr).End", Method, 0},
+		{"(*BinaryExpr).Pos", Method, 0},
+		{"(*BlockStmt).End", Method, 0},
+		{"(*BlockStmt).Pos", Method, 0},
+		{"(*BranchStmt).End", Method, 0},
+		{"(*BranchStmt).Pos", Method, 0},
+		{"(*CallExpr).End", Method, 0},
+		{"(*CallExpr).Pos", Method, 0},
+		{"(*CaseClause).End", Method, 0},
+		{"(*CaseClause).Pos", Method, 0},
+		{"(*ChanType).End", Method, 0},
+		{"(*ChanType).Pos", Method, 0},
+		{"(*CommClause).End", Method, 0},
+		{"(*CommClause).Pos", Method, 0},
+		{"(*Comment).End", Method, 0},
+		{"(*Comment).Pos", Method, 0},
+		{"(*CommentGroup).End", Method, 0},
+		{"(*CommentGroup).Pos", Method, 0},
+		{"(*CommentGroup).Text", Method, 0},
+		{"(*CompositeLit).End", Method, 0},
+		{"(*CompositeLit).Pos", Method, 0},
+		{"(*DeclStmt).End", Method, 0},
+		{"(*DeclStmt).Pos", Method, 0},
+		{"(*DeferStmt).End", Method, 0},
+		{"(*DeferStmt).Pos", Method, 0},
+		{"(*Ellipsis).End", Method, 0},
+		{"(*Ellipsis).Pos", Method, 0},
+		{"(*EmptyStmt).End", Method, 0},
+		{"(*EmptyStmt).Pos", Method, 0},
+		{"(*ExprStmt).End", Method, 0},
+		{"(*ExprStmt).Pos", Method, 0},
+		{"(*Field).End", Method, 0},
+		{"(*Field).Pos", Method, 0},
+		{"(*FieldList).End", Method, 0},
+		{"(*FieldList).NumFields", Method, 0},
+		{"(*FieldList).Pos", Method, 0},
+		{"(*File).End", Method, 0},
+		{"(*File).Pos", Method, 0},
+		{"(*ForStmt).End", Method, 0},
+		{"(*ForStmt).Pos", Method, 0},
+		{"(*FuncDecl).End", Method, 0},
+		{"(*FuncDecl).Pos", Method, 0},
+		{"(*FuncLit).End", Method, 0},
+		{"(*FuncLit).Pos", Method, 0},
+		{"(*FuncType).End", Method, 0},
+		{"(*FuncType).Pos", Method, 0},
+		{"(*GenDecl).End", Method, 0},
+		{"(*GenDecl).Pos", Method, 0},
+		{"(*GoStmt).End", Method, 0},
+		{"(*GoStmt).Pos", Method, 0},
+		{"(*Ident).End", Method, 0},
+		{"(*Ident).IsExported", Method, 0},
+		{"(*Ident).Pos", Method, 0},
+		{"(*Ident).String", Method, 0},
+		{"(*IfStmt).End", Method, 0},
+		{"(*IfStmt).Pos", Method, 0},
+		{"(*ImportSpec).End", Method, 0},
+		{"(*ImportSpec).Pos", Method, 0},
+		{"(*IncDecStmt).End", Method, 0},
+		{"(*IncDecStmt).Pos", Method, 0},
+		{"(*IndexExpr).End", Method, 0},
+		{"(*IndexExpr).Pos", Method, 0},
+		{"(*IndexListExpr).End", Method, 18},
+		{"(*IndexListExpr).Pos", Method, 18},
+		{"(*InterfaceType).End", Method, 0},
+		{"(*InterfaceType).Pos", Method, 0},
+		{"(*KeyValueExpr).End", Method, 0},
+		{"(*KeyValueExpr).Pos", Method, 0},
+		{"(*LabeledStmt).End", Method, 0},
+		{"(*LabeledStmt).Pos", Method, 0},
+		{"(*MapType).End", Method, 0},
+		{"(*MapType).Pos", Method, 0},
+		{"(*Object).Pos", Method, 0},
+		{"(*Package).End", Method, 0},
+		{"(*Package).Pos", Method, 0},
+		{"(*ParenExpr).End", Method, 0},
+		{"(*ParenExpr).Pos", Method, 0},
+		{"(*RangeStmt).End", Method, 0},
+		{"(*RangeStmt).Pos", Method, 0},
+		{"(*ReturnStmt).End", Method, 0},
+		{"(*ReturnStmt).Pos", Method, 0},
+		{"(*Scope).Insert", Method, 0},
+		{"(*Scope).Lookup", Method, 0},
+		{"(*Scope).String", Method, 0},
+		{"(*SelectStmt).End", Method, 0},
+		{"(*SelectStmt).Pos", Method, 0},
+		{"(*SelectorExpr).End", Method, 0},
+		{"(*SelectorExpr).Pos", Method, 0},
+		{"(*SendStmt).End", Method, 0},
+		{"(*SendStmt).Pos", Method, 0},
+		{"(*SliceExpr).End", Method, 0},
+		{"(*SliceExpr).Pos", Method, 0},
+		{"(*StarExpr).End", Method, 0},
+		{"(*StarExpr).Pos", Method, 0},
+		{"(*StructType).End", Method, 0},
+		{"(*StructType).Pos", Method, 0},
+		{"(*SwitchStmt).End", Method, 0},
+		{"(*SwitchStmt).Pos", Method, 0},
+		{"(*TypeAssertExpr).End", Method, 0},
+		{"(*TypeAssertExpr).Pos", Method, 0},
+		{"(*TypeSpec).End", Method, 0},
+		{"(*TypeSpec).Pos", Method, 0},
+		{"(*TypeSwitchStmt).End", Method, 0},
+		{"(*TypeSwitchStmt).Pos", Method, 0},
+		{"(*UnaryExpr).End", Method, 0},
+		{"(*UnaryExpr).Pos", Method, 0},
+		{"(*ValueSpec).End", Method, 0},
+		{"(*ValueSpec).Pos", Method, 0},
+		{"(CommentMap).Comments", Method, 1},
+		{"(CommentMap).Filter", Method, 1},
+		{"(CommentMap).String", Method, 1},
+		{"(CommentMap).Update", Method, 1},
+		{"(ObjKind).String", Method, 0},
+		{"ArrayType", Type, 0},
+		{"ArrayType.Elt", Field, 0},
+		{"ArrayType.Lbrack", Field, 0},
+		{"ArrayType.Len", Field, 0},
+		{"AssignStmt", Type, 0},
+		{"AssignStmt.Lhs", Field, 0},
+		{"AssignStmt.Rhs", Field, 0},
+		{"AssignStmt.Tok", Field, 0},
+		{"AssignStmt.TokPos", Field, 0},
+		{"Bad", Const, 0},
+		{"BadDecl", Type, 0},
+		{"BadDecl.From", Field, 0},
+		{"BadDecl.To", Field, 0},
+		{"BadExpr", Type, 0},
+		{"BadExpr.From", Field, 0},
+		{"BadExpr.To", Field, 0},
+		{"BadStmt", Type, 0},
+		{"BadStmt.From", Field, 0},
+		{"BadStmt.To", Field, 0},
+		{"BasicLit", Type, 0},
+		{"BasicLit.Kind", Field, 0},
+		{"BasicLit.Value", Field, 0},
+		{"BasicLit.ValuePos", Field, 0},
+		{"BinaryExpr", Type, 0},
+		{"BinaryExpr.Op", Field, 0},
+		{"BinaryExpr.OpPos", Field, 0},
+		{"BinaryExpr.X", Field, 0},
+		{"BinaryExpr.Y", Field, 0},
+		{"BlockStmt", Type, 0},
+		{"BlockStmt.Lbrace", Field, 0},
+		{"BlockStmt.List", Field, 0},
+		{"BlockStmt.Rbrace", Field, 0},
+		{"BranchStmt", Type, 0},
+		{"BranchStmt.Label", Field, 0},
+		{"BranchStmt.Tok", Field, 0},
+		{"BranchStmt.TokPos", Field, 0},
+		{"CallExpr", Type, 0},
+		{"CallExpr.Args", Field, 0},
+		{"CallExpr.Ellipsis", Field, 0},
+		{"CallExpr.Fun", Field, 0},
+		{"CallExpr.Lparen", Field, 0},
+		{"CallExpr.Rparen", Field, 0},
+		{"CaseClause", Type, 0},
+		{"CaseClause.Body", Field, 0},
+		{"CaseClause.Case", Field, 0},
+		{"CaseClause.Colon", Field, 0},
+		{"CaseClause.List", Field, 0},
+		{"ChanDir", Type, 0},
+		{"ChanType", Type, 0},
+		{"ChanType.Arrow", Field, 1},
+		{"ChanType.Begin", Field, 0},
+		{"ChanType.Dir", Field, 0},
+		{"ChanType.Value", Field, 0},
+		{"CommClause", Type, 0},
+		{"CommClause.Body", Field, 0},
+		{"CommClause.Case", Field, 0},
+		{"CommClause.Colon", Field, 0},
+		{"CommClause.Comm", Field, 0},
+		{"Comment", Type, 0},
+		{"Comment.Slash", Field, 0},
+		{"Comment.Text", Field, 0},
+		{"CommentGroup", Type, 0},
+		{"CommentGroup.List", Field, 0},
+		{"CommentMap", Type, 1},
+		{"CompositeLit", Type, 0},
+		{"CompositeLit.Elts", Field, 0},
+		{"CompositeLit.Incomplete", Field, 11},
+		{"CompositeLit.Lbrace", Field, 0},
+		{"CompositeLit.Rbrace", Field, 0},
+		{"CompositeLit.Type", Field, 0},
+		{"Con", Const, 0},
+		{"Decl", Type, 0},
+		{"DeclStmt", Type, 0},
+		{"DeclStmt.Decl", Field, 0},
+		{"DeferStmt", Type, 0},
+		{"DeferStmt.Call", Field, 0},
+		{"DeferStmt.Defer", Field, 0},
+		{"Ellipsis", Type, 0},
+		{"Ellipsis.Ellipsis", Field, 0},
+		{"Ellipsis.Elt", Field, 0},
+		{"EmptyStmt", Type, 0},
+		{"EmptyStmt.Implicit", Field, 5},
+		{"EmptyStmt.Semicolon", Field, 0},
+		{"Expr", Type, 0},
+		{"ExprStmt", Type, 0},
+		{"ExprStmt.X", Field, 0},
+		{"Field", Type, 0},
+		{"Field.Comment", Field, 0},
+		{"Field.Doc", Field, 0},
+		{"Field.Names", Field, 0},
+		{"Field.Tag", Field, 0},
+		{"Field.Type", Field, 0},
+		{"FieldFilter", Type, 0},
+		{"FieldList", Type, 0},
+		{"FieldList.Closing", Field, 0},
+		{"FieldList.List", Field, 0},
+		{"FieldList.Opening", Field, 0},
+		{"File", Type, 0},
+		{"File.Comments", Field, 0},
+		{"File.Decls", Field, 0},
+		{"File.Doc", Field, 0},
+		{"File.FileEnd", Field, 20},
+		{"File.FileStart", Field, 20},
+		{"File.GoVersion", Field, 21},
+		{"File.Imports", Field, 0},
+		{"File.Name", Field, 0},
+		{"File.Package", Field, 0},
+		{"File.Scope", Field, 0},
+		{"File.Unresolved", Field, 0},
+		{"FileExports", Func, 0},
+		{"Filter", Type, 0},
+		{"FilterDecl", Func, 0},
+		{"FilterFile", Func, 0},
+		{"FilterFuncDuplicates", Const, 0},
+		{"FilterImportDuplicates", Const, 0},
+		{"FilterPackage", Func, 0},
+		{"FilterUnassociatedComments", Const, 0},
+		{"ForStmt", Type, 0},
+		{"ForStmt.Body", Field, 0},
+		{"ForStmt.Cond", Field, 0},
+		{"ForStmt.For", Field, 0},
+		{"ForStmt.Init", Field, 0},
+		{"ForStmt.Post", Field, 0},
+		{"Fprint", Func, 0},
+		{"Fun", Const, 0},
+		{"FuncDecl", Type, 0},
+		{"FuncDecl.Body", Field, 0},
+		{"FuncDecl.Doc", Field, 0},
+		{"FuncDecl.Name", Field, 0},
+		{"FuncDecl.Recv", Field, 0},
+		{"FuncDecl.Type", Field, 0},
+		{"FuncLit", Type, 0},
+		{"FuncLit.Body", Field, 0},
+		{"FuncLit.Type", Field, 0},
+		{"FuncType", Type, 0},
+		{"FuncType.Func", Field, 0},
+		{"FuncType.Params", Field, 0},
+		{"FuncType.Results", Field, 0},
+		{"FuncType.TypeParams", Field, 18},
+		{"GenDecl", Type, 0},
+		{"GenDecl.Doc", Field, 0},
+		{"GenDecl.Lparen", Field, 0},
+		{"GenDecl.Rparen", Field, 0},
+		{"GenDecl.Specs", Field, 0},
+		{"GenDecl.Tok", Field, 0},
+		{"GenDecl.TokPos", Field, 0},
+		{"GoStmt", Type, 0},
+		{"GoStmt.Call", Field, 0},
+		{"GoStmt.Go", Field, 0},
+		{"Ident", Type, 0},
+		{"Ident.Name", Field, 0},
+		{"Ident.NamePos", Field, 0},
+		{"Ident.Obj", Field, 0},
+		{"IfStmt", Type, 0},
+		{"IfStmt.Body", Field, 0},
+		{"IfStmt.Cond", Field, 0},
+		{"IfStmt.Else", Field, 0},
+		{"IfStmt.If", Field, 0},
+		{"IfStmt.Init", Field, 0},
+		{"ImportSpec", Type, 0},
+		{"ImportSpec.Comment", Field, 0},
+		{"ImportSpec.Doc", Field, 0},
+		{"ImportSpec.EndPos", Field, 0},
+		{"ImportSpec.Name", Field, 0},
+		{"ImportSpec.Path", Field, 0},
+		{"Importer", Type, 0},
+		{"IncDecStmt", Type, 0},
+		{"IncDecStmt.Tok", Field, 0},
+		{"IncDecStmt.TokPos", Field, 0},
+		{"IncDecStmt.X", Field, 0},
+		{"IndexExpr", Type, 0},
+		{"IndexExpr.Index", Field, 0},
+		{"IndexExpr.Lbrack", Field, 0},
+		{"IndexExpr.Rbrack", Field, 0},
+		{"IndexExpr.X", Field, 0},
+		{"IndexListExpr", Type, 18},
+		{"IndexListExpr.Indices", Field, 18},
+		{"IndexListExpr.Lbrack", Field, 18},
+		{"IndexListExpr.Rbrack", Field, 18},
+		{"IndexListExpr.X", Field, 18},
+		{"Inspect", Func, 0},
+		{"InterfaceType", Type, 0},
+		{"InterfaceType.Incomplete", Field, 0},
+		{"InterfaceType.Interface", Field, 0},
+		{"InterfaceType.Methods", Field, 0},
+		{"IsExported", Func, 0},
+		{"IsGenerated", Func, 21},
+		{"KeyValueExpr", Type, 0},
+		{"KeyValueExpr.Colon", Field, 0},
+		{"KeyValueExpr.Key", Field, 0},
+		{"KeyValueExpr.Value", Field, 0},
+		{"LabeledStmt", Type, 0},
+		{"LabeledStmt.Colon", Field, 0},
+		{"LabeledStmt.Label", Field, 0},
+		{"LabeledStmt.Stmt", Field, 0},
+		{"Lbl", Const, 0},
+		{"MapType", Type, 0},
+		{"MapType.Key", Field, 0},
+		{"MapType.Map", Field, 0},
+		{"MapType.Value", Field, 0},
+		{"MergeMode", Type, 0},
+		{"MergePackageFiles", Func, 0},
+		{"NewCommentMap", Func, 1},
+		{"NewIdent", Func, 0},
+		{"NewObj", Func, 0},
+		{"NewPackage", Func, 0},
+		{"NewScope", Func, 0},
+		{"Node", Type, 0},
+		{"NotNilFilter", Func, 0},
+		{"ObjKind", Type, 0},
+		{"Object", Type, 0},
+		{"Object.Data", Field, 0},
+		{"Object.Decl", Field, 0},
+		{"Object.Kind", Field, 0},
+		{"Object.Name", Field, 0},
+		{"Object.Type", Field, 0},
+		{"Package", Type, 0},
+		{"Package.Files", Field, 0},
+		{"Package.Imports", Field, 0},
+		{"Package.Name", Field, 0},
+		{"Package.Scope", Field, 0},
+		{"PackageExports", Func, 0},
+		{"ParenExpr", Type, 0},
+		{"ParenExpr.Lparen", Field, 0},
+		{"ParenExpr.Rparen", Field, 0},
+		{"ParenExpr.X", Field, 0},
+		{"Pkg", Const, 0},
+		{"Print", Func, 0},
+		{"RECV", Const, 0},
+		{"RangeStmt", Type, 0},
+		{"RangeStmt.Body", Field, 0},
+		{"RangeStmt.For", Field, 0},
+		{"RangeStmt.Key", Field, 0},
+		{"RangeStmt.Range", Field, 20},
+		{"RangeStmt.Tok", Field, 0},
+		{"RangeStmt.TokPos", Field, 0},
+		{"RangeStmt.Value", Field, 0},
+		{"RangeStmt.X", Field, 0},
+		{"ReturnStmt", Type, 0},
+		{"ReturnStmt.Results", Field, 0},
+		{"ReturnStmt.Return", Field, 0},
+		{"SEND", Const, 0},
+		{"Scope", Type, 0},
+		{"Scope.Objects", Field, 0},
+		{"Scope.Outer", Field, 0},
+		{"SelectStmt", Type, 0},
+		{"SelectStmt.Body", Field, 0},
+		{"SelectStmt.Select", Field, 0},
+		{"SelectorExpr", Type, 0},
+		{"SelectorExpr.Sel", Field, 0},
+		{"SelectorExpr.X", Field, 0},
+		{"SendStmt", Type, 0},
+		{"SendStmt.Arrow", Field, 0},
+		{"SendStmt.Chan", Field, 0},
+		{"SendStmt.Value", Field, 0},
+		{"SliceExpr", Type, 0},
+		{"SliceExpr.High", Field, 0},
+		{"SliceExpr.Lbrack", Field, 0},
+		{"SliceExpr.Low", Field, 0},
+		{"SliceExpr.Max", Field, 2},
+		{"SliceExpr.Rbrack", Field, 0},
+		{"SliceExpr.Slice3", Field, 2},
+		{"SliceExpr.X", Field, 0},
+		{"SortImports", Func, 0},
+		{"Spec", Type, 0},
+		{"StarExpr", Type, 0},
+		{"StarExpr.Star", Field, 0},
+		{"StarExpr.X", Field, 0},
+		{"Stmt", Type, 0},
+		{"StructType", Type, 0},
+		{"StructType.Fields", Field, 0},
+		{"StructType.Incomplete", Field, 0},
+		{"StructType.Struct", Field, 0},
+		{"SwitchStmt", Type, 0},
+		{"SwitchStmt.Body", Field, 0},
+		{"SwitchStmt.Init", Field, 0},
+		{"SwitchStmt.Switch", Field, 0},
+		{"SwitchStmt.Tag", Field, 0},
+		{"Typ", Const, 0},
+		{"TypeAssertExpr", Type, 0},
+		{"TypeAssertExpr.Lparen", Field, 2},
+		{"TypeAssertExpr.Rparen", Field, 2},
+		{"TypeAssertExpr.Type", Field, 0},
+		{"TypeAssertExpr.X", Field, 0},
+		{"TypeSpec", Type, 0},
+		{"TypeSpec.Assign", Field, 9},
+		{"TypeSpec.Comment", Field, 0},
+		{"TypeSpec.Doc", Field, 0},
+		{"TypeSpec.Name", Field, 0},
+		{"TypeSpec.Type", Field, 0},
+		{"TypeSpec.TypeParams", Field, 18},
+		{"TypeSwitchStmt", Type, 0},
+		{"TypeSwitchStmt.Assign", Field, 0},
+		{"TypeSwitchStmt.Body", Field, 0},
+		{"TypeSwitchStmt.Init", Field, 0},
+		{"TypeSwitchStmt.Switch", Field, 0},
+		{"UnaryExpr", Type, 0},
+		{"UnaryExpr.Op", Field, 0},
+		{"UnaryExpr.OpPos", Field, 0},
+		{"UnaryExpr.X", Field, 0},
+		{"Unparen", Func, 22},
+		{"ValueSpec", Type, 0},
+		{"ValueSpec.Comment", Field, 0},
+		{"ValueSpec.Doc", Field, 0},
+		{"ValueSpec.Names", Field, 0},
+		{"ValueSpec.Type", Field, 0},
+		{"ValueSpec.Values", Field, 0},
+		{"Var", Const, 0},
+		{"Visitor", Type, 0},
+		{"Walk", Func, 0},
+	},
+	"go/build": {
+		{"(*Context).Import", Method, 0},
+		{"(*Context).ImportDir", Method, 0},
+		{"(*Context).MatchFile", Method, 2},
+		{"(*Context).SrcDirs", Method, 0},
+		{"(*MultiplePackageError).Error", Method, 4},
+		{"(*NoGoError).Error", Method, 0},
+		{"(*Package).IsCommand", Method, 0},
+		{"AllowBinary", Const, 0},
+		{"ArchChar", Func, 0},
+		{"Context", Type, 0},
+		{"Context.BuildTags", Field, 0},
+		{"Context.CgoEnabled", Field, 0},
+		{"Context.Compiler", Field, 0},
+		{"Context.Dir", Field, 14},
+		{"Context.GOARCH", Field, 0},
+		{"Context.GOOS", Field, 0},
+		{"Context.GOPATH", Field, 0},
+		{"Context.GOROOT", Field, 0},
+		{"Context.HasSubdir", Field, 0},
+		{"Context.InstallSuffix", Field, 1},
+		{"Context.IsAbsPath", Field, 0},
+		{"Context.IsDir", Field, 0},
+		{"Context.JoinPath", Field, 0},
+		{"Context.OpenFile", Field, 0},
+		{"Context.ReadDir", Field, 0},
+		{"Context.ReleaseTags", Field, 1},
+		{"Context.SplitPathList", Field, 0},
+		{"Context.ToolTags", Field, 17},
+		{"Context.UseAllFiles", Field, 0},
+		{"Default", Var, 0},
+		{"Directive", Type, 21},
+		{"Directive.Pos", Field, 21},
+		{"Directive.Text", Field, 21},
+		{"FindOnly", Const, 0},
+		{"IgnoreVendor", Const, 6},
+		{"Import", Func, 0},
+		{"ImportComment", Const, 4},
+		{"ImportDir", Func, 0},
+		{"ImportMode", Type, 0},
+		{"IsLocalImport", Func, 0},
+		{"MultiplePackageError", Type, 4},
+		{"MultiplePackageError.Dir", Field, 4},
+		{"MultiplePackageError.Files", Field, 4},
+		{"MultiplePackageError.Packages", Field, 4},
+		{"NoGoError", Type, 0},
+		{"NoGoError.Dir", Field, 0},
+		{"Package", Type, 0},
+		{"Package.AllTags", Field, 2},
+		{"Package.BinDir", Field, 0},
+		{"Package.BinaryOnly", Field, 7},
+		{"Package.CFiles", Field, 0},
+		{"Package.CXXFiles", Field, 2},
+		{"Package.CgoCFLAGS", Field, 0},
+		{"Package.CgoCPPFLAGS", Field, 2},
+		{"Package.CgoCXXFLAGS", Field, 2},
+		{"Package.CgoFFLAGS", Field, 7},
+		{"Package.CgoFiles", Field, 0},
+		{"Package.CgoLDFLAGS", Field, 0},
+		{"Package.CgoPkgConfig", Field, 0},
+		{"Package.ConflictDir", Field, 2},
+		{"Package.Dir", Field, 0},
+		{"Package.Directives", Field, 21},
+		{"Package.Doc", Field, 0},
+		{"Package.EmbedPatternPos", Field, 16},
+		{"Package.EmbedPatterns", Field, 16},
+		{"Package.FFiles", Field, 7},
+		{"Package.GoFiles", Field, 0},
+		{"Package.Goroot", Field, 0},
+		{"Package.HFiles", Field, 0},
+		{"Package.IgnoredGoFiles", Field, 1},
+		{"Package.IgnoredOtherFiles", Field, 16},
+		{"Package.ImportComment", Field, 4},
+		{"Package.ImportPath", Field, 0},
+		{"Package.ImportPos", Field, 0},
+		{"Package.Imports", Field, 0},
+		{"Package.InvalidGoFiles", Field, 6},
+		{"Package.MFiles", Field, 3},
+		{"Package.Name", Field, 0},
+		{"Package.PkgObj", Field, 0},
+		{"Package.PkgRoot", Field, 0},
+		{"Package.PkgTargetRoot", Field, 5},
+		{"Package.Root", Field, 0},
+		{"Package.SFiles", Field, 0},
+		{"Package.SrcRoot", Field, 0},
+		{"Package.SwigCXXFiles", Field, 1},
+		{"Package.SwigFiles", Field, 1},
+		{"Package.SysoFiles", Field, 0},
+		{"Package.TestDirectives", Field, 21},
+		{"Package.TestEmbedPatternPos", Field, 16},
+		{"Package.TestEmbedPatterns", Field, 16},
+		{"Package.TestGoFiles", Field, 0},
+		{"Package.TestImportPos", Field, 0},
+		{"Package.TestImports", Field, 0},
+		{"Package.XTestDirectives", Field, 21},
+		{"Package.XTestEmbedPatternPos", Field, 16},
+		{"Package.XTestEmbedPatterns", Field, 16},
+		{"Package.XTestGoFiles", Field, 0},
+		{"Package.XTestImportPos", Field, 0},
+		{"Package.XTestImports", Field, 0},
+		{"ToolDir", Var, 0},
+	},
+	"go/build/constraint": {
+		{"(*AndExpr).Eval", Method, 16},
+		{"(*AndExpr).String", Method, 16},
+		{"(*NotExpr).Eval", Method, 16},
+		{"(*NotExpr).String", Method, 16},
+		{"(*OrExpr).Eval", Method, 16},
+		{"(*OrExpr).String", Method, 16},
+		{"(*SyntaxError).Error", Method, 16},
+		{"(*TagExpr).Eval", Method, 16},
+		{"(*TagExpr).String", Method, 16},
+		{"AndExpr", Type, 16},
+		{"AndExpr.X", Field, 16},
+		{"AndExpr.Y", Field, 16},
+		{"Expr", Type, 16},
+		{"GoVersion", Func, 21},
+		{"IsGoBuild", Func, 16},
+		{"IsPlusBuild", Func, 16},
+		{"NotExpr", Type, 16},
+		{"NotExpr.X", Field, 16},
+		{"OrExpr", Type, 16},
+		{"OrExpr.X", Field, 16},
+		{"OrExpr.Y", Field, 16},
+		{"Parse", Func, 16},
+		{"PlusBuildLines", Func, 16},
+		{"SyntaxError", Type, 16},
+		{"SyntaxError.Err", Field, 16},
+		{"SyntaxError.Offset", Field, 16},
+		{"TagExpr", Type, 16},
+		{"TagExpr.Tag", Field, 16},
+	},
+	"go/constant": {
+		{"(Kind).String", Method, 18},
+		{"BinaryOp", Func, 5},
+		{"BitLen", Func, 5},
+		{"Bool", Const, 5},
+		{"BoolVal", Func, 5},
+		{"Bytes", Func, 5},
+		{"Compare", Func, 5},
+		{"Complex", Const, 5},
+		{"Denom", Func, 5},
+		{"Float", Const, 5},
+		{"Float32Val", Func, 5},
+		{"Float64Val", Func, 5},
+		{"Imag", Func, 5},
+		{"Int", Const, 5},
+		{"Int64Val", Func, 5},
+		{"Kind", Type, 5},
+		{"Make", Func, 13},
+		{"MakeBool", Func, 5},
+		{"MakeFloat64", Func, 5},
+		{"MakeFromBytes", Func, 5},
+		{"MakeFromLiteral", Func, 5},
+		{"MakeImag", Func, 5},
+		{"MakeInt64", Func, 5},
+		{"MakeString", Func, 5},
+		{"MakeUint64", Func, 5},
+		{"MakeUnknown", Func, 5},
+		{"Num", Func, 5},
+		{"Real", Func, 5},
+		{"Shift", Func, 5},
+		{"Sign", Func, 5},
+		{"String", Const, 5},
+		{"StringVal", Func, 5},
+		{"ToComplex", Func, 6},
+		{"ToFloat", Func, 6},
+		{"ToInt", Func, 6},
+		{"Uint64Val", Func, 5},
+		{"UnaryOp", Func, 5},
+		{"Unknown", Const, 5},
+		{"Val", Func, 13},
+		{"Value", Type, 5},
+	},
+	"go/doc": {
+		{"(*Package).Filter", Method, 0},
+		{"(*Package).HTML", Method, 19},
+		{"(*Package).Markdown", Method, 19},
+		{"(*Package).Parser", Method, 19},
+		{"(*Package).Printer", Method, 19},
+		{"(*Package).Synopsis", Method, 19},
+		{"(*Package).Text", Method, 19},
+		{"AllDecls", Const, 0},
+		{"AllMethods", Const, 0},
+		{"Example", Type, 0},
+		{"Example.Code", Field, 0},
+		{"Example.Comments", Field, 0},
+		{"Example.Doc", Field, 0},
+		{"Example.EmptyOutput", Field, 1},
+		{"Example.Name", Field, 0},
+		{"Example.Order", Field, 1},
+		{"Example.Output", Field, 0},
+		{"Example.Play", Field, 1},
+		{"Example.Suffix", Field, 14},
+		{"Example.Unordered", Field, 7},
+		{"Examples", Func, 0},
+		{"Filter", Type, 0},
+		{"Func", Type, 0},
+		{"Func.Decl", Field, 0},
+		{"Func.Doc", Field, 0},
+		{"Func.Examples", Field, 14},
+		{"Func.Level", Field, 0},
+		{"Func.Name", Field, 0},
+		{"Func.Orig", Field, 0},
+		{"Func.Recv", Field, 0},
+		{"IllegalPrefixes", Var, 1},
+		{"IsPredeclared", Func, 8},
+		{"Mode", Type, 0},
+		{"New", Func, 0},
+		{"NewFromFiles", Func, 14},
+		{"Note", Type, 1},
+		{"Note.Body", Field, 1},
+		{"Note.End", Field, 1},
+		{"Note.Pos", Field, 1},
+		{"Note.UID", Field, 1},
+		{"Package", Type, 0},
+		{"Package.Bugs", Field, 0},
+		{"Package.Consts", Field, 0},
+		{"Package.Doc", Field, 0},
+		{"Package.Examples", Field, 14},
+		{"Package.Filenames", Field, 0},
+		{"Package.Funcs", Field, 0},
+		{"Package.ImportPath", Field, 0},
+		{"Package.Imports", Field, 0},
+		{"Package.Name", Field, 0},
+		{"Package.Notes", Field, 1},
+		{"Package.Types", Field, 0},
+		{"Package.Vars", Field, 0},
+		{"PreserveAST", Const, 12},
+		{"Synopsis", Func, 0},
+		{"ToHTML", Func, 0},
+		{"ToText", Func, 0},
+		{"Type", Type, 0},
+		{"Type.Consts", Field, 0},
+		{"Type.Decl", Field, 0},
+		{"Type.Doc", Field, 0},
+		{"Type.Examples", Field, 14},
+		{"Type.Funcs", Field, 0},
+		{"Type.Methods", Field, 0},
+		{"Type.Name", Field, 0},
+		{"Type.Vars", Field, 0},
+		{"Value", Type, 0},
+		{"Value.Decl", Field, 0},
+		{"Value.Doc", Field, 0},
+		{"Value.Names", Field, 0},
+	},
+	"go/doc/comment": {
+		{"(*DocLink).DefaultURL", Method, 19},
+		{"(*Heading).DefaultID", Method, 19},
+		{"(*List).BlankBefore", Method, 19},
+		{"(*List).BlankBetween", Method, 19},
+		{"(*Parser).Parse", Method, 19},
+		{"(*Printer).Comment", Method, 19},
+		{"(*Printer).HTML", Method, 19},
+		{"(*Printer).Markdown", Method, 19},
+		{"(*Printer).Text", Method, 19},
+		{"Block", Type, 19},
+		{"Code", Type, 19},
+		{"Code.Text", Field, 19},
+		{"DefaultLookupPackage", Func, 19},
+		{"Doc", Type, 19},
+		{"Doc.Content", Field, 19},
+		{"Doc.Links", Field, 19},
+		{"DocLink", Type, 19},
+		{"DocLink.ImportPath", Field, 19},
+		{"DocLink.Name", Field, 19},
+		{"DocLink.Recv", Field, 19},
+		{"DocLink.Text", Field, 19},
+		{"Heading", Type, 19},
+		{"Heading.Text", Field, 19},
+		{"Italic", Type, 19},
+		{"Link", Type, 19},
+		{"Link.Auto", Field, 19},
+		{"Link.Text", Field, 19},
+		{"Link.URL", Field, 19},
+		{"LinkDef", Type, 19},
+		{"LinkDef.Text", Field, 19},
+		{"LinkDef.URL", Field, 19},
+		{"LinkDef.Used", Field, 19},
+		{"List", Type, 19},
+		{"List.ForceBlankBefore", Field, 19},
+		{"List.ForceBlankBetween", Field, 19},
+		{"List.Items", Field, 19},
+		{"ListItem", Type, 19},
+		{"ListItem.Content", Field, 19},
+		{"ListItem.Number", Field, 19},
+		{"Paragraph", Type, 19},
+		{"Paragraph.Text", Field, 19},
+		{"Parser", Type, 19},
+		{"Parser.LookupPackage", Field, 19},
+		{"Parser.LookupSym", Field, 19},
+		{"Parser.Words", Field, 19},
+		{"Plain", Type, 19},
+		{"Printer", Type, 19},
+		{"Printer.DocLinkBaseURL", Field, 19},
+		{"Printer.DocLinkURL", Field, 19},
+		{"Printer.HeadingID", Field, 19},
+		{"Printer.HeadingLevel", Field, 19},
+		{"Printer.TextCodePrefix", Field, 19},
+		{"Printer.TextPrefix", Field, 19},
+		{"Printer.TextWidth", Field, 19},
+		{"Text", Type, 19},
+	},
+	"go/format": {
+		{"Node", Func, 1},
+		{"Source", Func, 1},
+	},
+	"go/importer": {
+		{"Default", Func, 5},
+		{"For", Func, 5},
+		{"ForCompiler", Func, 12},
+		{"Lookup", Type, 5},
+	},
+	"go/parser": {
+		{"AllErrors", Const, 1},
+		{"DeclarationErrors", Const, 0},
+		{"ImportsOnly", Const, 0},
+		{"Mode", Type, 0},
+		{"PackageClauseOnly", Const, 0},
+		{"ParseComments", Const, 0},
+		{"ParseDir", Func, 0},
+		{"ParseExpr", Func, 0},
+		{"ParseExprFrom", Func, 5},
+		{"ParseFile", Func, 0},
+		{"SkipObjectResolution", Const, 17},
+		{"SpuriousErrors", Const, 0},
+		{"Trace", Const, 0},
+	},
+	"go/printer": {
+		{"(*Config).Fprint", Method, 0},
+		{"CommentedNode", Type, 0},
+		{"CommentedNode.Comments", Field, 0},
+		{"CommentedNode.Node", Field, 0},
+		{"Config", Type, 0},
+		{"Config.Indent", Field, 1},
+		{"Config.Mode", Field, 0},
+		{"Config.Tabwidth", Field, 0},
+		{"Fprint", Func, 0},
+		{"Mode", Type, 0},
+		{"RawFormat", Const, 0},
+		{"SourcePos", Const, 0},
+		{"TabIndent", Const, 0},
+		{"UseSpaces", Const, 0},
+	},
+	"go/scanner": {
+		{"(*ErrorList).Add", Method, 0},
+		{"(*ErrorList).RemoveMultiples", Method, 0},
+		{"(*ErrorList).Reset", Method, 0},
+		{"(*Scanner).Init", Method, 0},
+		{"(*Scanner).Scan", Method, 0},
+		{"(Error).Error", Method, 0},
+		{"(ErrorList).Err", Method, 0},
+		{"(ErrorList).Error", Method, 0},
+		{"(ErrorList).Len", Method, 0},
+		{"(ErrorList).Less", Method, 0},
+		{"(ErrorList).Sort", Method, 0},
+		{"(ErrorList).Swap", Method, 0},
+		{"Error", Type, 0},
+		{"Error.Msg", Field, 0},
+		{"Error.Pos", Field, 0},
+		{"ErrorHandler", Type, 0},
+		{"ErrorList", Type, 0},
+		{"Mode", Type, 0},
+		{"PrintError", Func, 0},
+		{"ScanComments", Const, 0},
+		{"Scanner", Type, 0},
+		{"Scanner.ErrorCount", Field, 0},
+	},
+	"go/token": {
+		{"(*File).AddLine", Method, 0},
+		{"(*File).AddLineColumnInfo", Method, 11},
+		{"(*File).AddLineInfo", Method, 0},
+		{"(*File).Base", Method, 0},
+		{"(*File).Line", Method, 0},
+		{"(*File).LineCount", Method, 0},
+		{"(*File).LineStart", Method, 12},
+		{"(*File).Lines", Method, 21},
+		{"(*File).MergeLine", Method, 2},
+		{"(*File).Name", Method, 0},
+		{"(*File).Offset", Method, 0},
+		{"(*File).Pos", Method, 0},
+		{"(*File).Position", Method, 0},
+		{"(*File).PositionFor", Method, 4},
+		{"(*File).SetLines", Method, 0},
+		{"(*File).SetLinesForContent", Method, 0},
+		{"(*File).Size", Method, 0},
+		{"(*FileSet).AddFile", Method, 0},
+		{"(*FileSet).Base", Method, 0},
+		{"(*FileSet).File", Method, 0},
+		{"(*FileSet).Iterate", Method, 0},
+		{"(*FileSet).Position", Method, 0},
+		{"(*FileSet).PositionFor", Method, 4},
+		{"(*FileSet).Read", Method, 0},
+		{"(*FileSet).RemoveFile", Method, 20},
+		{"(*FileSet).Write", Method, 0},
+		{"(*Position).IsValid", Method, 0},
+		{"(Pos).IsValid", Method, 0},
+		{"(Position).String", Method, 0},
+		{"(Token).IsKeyword", Method, 0},
+		{"(Token).IsLiteral", Method, 0},
+		{"(Token).IsOperator", Method, 0},
+		{"(Token).Precedence", Method, 0},
+		{"(Token).String", Method, 0},
+		{"ADD", Const, 0},
+		{"ADD_ASSIGN", Const, 0},
+		{"AND", Const, 0},
+		{"AND_ASSIGN", Const, 0},
+		{"AND_NOT", Const, 0},
+		{"AND_NOT_ASSIGN", Const, 0},
+		{"ARROW", Const, 0},
+		{"ASSIGN", Const, 0},
+		{"BREAK", Const, 0},
+		{"CASE", Const, 0},
+		{"CHAN", Const, 0},
+		{"CHAR", Const, 0},
+		{"COLON", Const, 0},
+		{"COMMA", Const, 0},
+		{"COMMENT", Const, 0},
+		{"CONST", Const, 0},
+		{"CONTINUE", Const, 0},
+		{"DEC", Const, 0},
+		{"DEFAULT", Const, 0},
+		{"DEFER", Const, 0},
+		{"DEFINE", Const, 0},
+		{"ELLIPSIS", Const, 0},
+		{"ELSE", Const, 0},
+		{"EOF", Const, 0},
+		{"EQL", Const, 0},
+		{"FALLTHROUGH", Const, 0},
+		{"FLOAT", Const, 0},
+		{"FOR", Const, 0},
+		{"FUNC", Const, 0},
+		{"File", Type, 0},
+		{"FileSet", Type, 0},
+		{"GEQ", Const, 0},
+		{"GO", Const, 0},
+		{"GOTO", Const, 0},
+		{"GTR", Const, 0},
+		{"HighestPrec", Const, 0},
+		{"IDENT", Const, 0},
+		{"IF", Const, 0},
+		{"ILLEGAL", Const, 0},
+		{"IMAG", Const, 0},
+		{"IMPORT", Const, 0},
+		{"INC", Const, 0},
+		{"INT", Const, 0},
+		{"INTERFACE", Const, 0},
+		{"IsExported", Func, 13},
+		{"IsIdentifier", Func, 13},
+		{"IsKeyword", Func, 13},
+		{"LAND", Const, 0},
+		{"LBRACE", Const, 0},
+		{"LBRACK", Const, 0},
+		{"LEQ", Const, 0},
+		{"LOR", Const, 0},
+		{"LPAREN", Const, 0},
+		{"LSS", Const, 0},
+		{"Lookup", Func, 0},
+		{"LowestPrec", Const, 0},
+		{"MAP", Const, 0},
+		{"MUL", Const, 0},
+		{"MUL_ASSIGN", Const, 0},
+		{"NEQ", Const, 0},
+		{"NOT", Const, 0},
+		{"NewFileSet", Func, 0},
+		{"NoPos", Const, 0},
+		{"OR", Const, 0},
+		{"OR_ASSIGN", Const, 0},
+		{"PACKAGE", Const, 0},
+		{"PERIOD", Const, 0},
+		{"Pos", Type, 0},
+		{"Position", Type, 0},
+		{"Position.Column", Field, 0},
+		{"Position.Filename", Field, 0},
+		{"Position.Line", Field, 0},
+		{"Position.Offset", Field, 0},
+		{"QUO", Const, 0},
+		{"QUO_ASSIGN", Const, 0},
+		{"RANGE", Const, 0},
+		{"RBRACE", Const, 0},
+		{"RBRACK", Const, 0},
+		{"REM", Const, 0},
+		{"REM_ASSIGN", Const, 0},
+		{"RETURN", Const, 0},
+		{"RPAREN", Const, 0},
+		{"SELECT", Const, 0},
+		{"SEMICOLON", Const, 0},
+		{"SHL", Const, 0},
+		{"SHL_ASSIGN", Const, 0},
+		{"SHR", Const, 0},
+		{"SHR_ASSIGN", Const, 0},
+		{"STRING", Const, 0},
+		{"STRUCT", Const, 0},
+		{"SUB", Const, 0},
+		{"SUB_ASSIGN", Const, 0},
+		{"SWITCH", Const, 0},
+		{"TILDE", Const, 18},
+		{"TYPE", Const, 0},
+		{"Token", Type, 0},
+		{"UnaryPrec", Const, 0},
+		{"VAR", Const, 0},
+		{"XOR", Const, 0},
+		{"XOR_ASSIGN", Const, 0},
+	},
+	"go/types": {
+		{"(*Alias).Obj", Method, 22},
+		{"(*Alias).String", Method, 22},
+		{"(*Alias).Underlying", Method, 22},
+		{"(*ArgumentError).Error", Method, 18},
+		{"(*ArgumentError).Unwrap", Method, 18},
+		{"(*Array).Elem", Method, 5},
+		{"(*Array).Len", Method, 5},
+		{"(*Array).String", Method, 5},
+		{"(*Array).Underlying", Method, 5},
+		{"(*Basic).Info", Method, 5},
+		{"(*Basic).Kind", Method, 5},
+		{"(*Basic).Name", Method, 5},
+		{"(*Basic).String", Method, 5},
+		{"(*Basic).Underlying", Method, 5},
+		{"(*Builtin).Exported", Method, 5},
+		{"(*Builtin).Id", Method, 5},
+		{"(*Builtin).Name", Method, 5},
+		{"(*Builtin).Parent", Method, 5},
+		{"(*Builtin).Pkg", Method, 5},
+		{"(*Builtin).Pos", Method, 5},
+		{"(*Builtin).String", Method, 5},
+		{"(*Builtin).Type", Method, 5},
+		{"(*Chan).Dir", Method, 5},
+		{"(*Chan).Elem", Method, 5},
+		{"(*Chan).String", Method, 5},
+		{"(*Chan).Underlying", Method, 5},
+		{"(*Checker).Files", Method, 5},
+		{"(*Config).Check", Method, 5},
+		{"(*Const).Exported", Method, 5},
+		{"(*Const).Id", Method, 5},
+		{"(*Const).Name", Method, 5},
+		{"(*Const).Parent", Method, 5},
+		{"(*Const).Pkg", Method, 5},
+		{"(*Const).Pos", Method, 5},
+		{"(*Const).String", Method, 5},
+		{"(*Const).Type", Method, 5},
+		{"(*Const).Val", Method, 5},
+		{"(*Func).Exported", Method, 5},
+		{"(*Func).FullName", Method, 5},
+		{"(*Func).Id", Method, 5},
+		{"(*Func).Name", Method, 5},
+		{"(*Func).Origin", Method, 19},
+		{"(*Func).Parent", Method, 5},
+		{"(*Func).Pkg", Method, 5},
+		{"(*Func).Pos", Method, 5},
+		{"(*Func).Scope", Method, 5},
+		{"(*Func).String", Method, 5},
+		{"(*Func).Type", Method, 5},
+		{"(*Info).ObjectOf", Method, 5},
+		{"(*Info).PkgNameOf", Method, 22},
+		{"(*Info).TypeOf", Method, 5},
+		{"(*Initializer).String", Method, 5},
+		{"(*Interface).Complete", Method, 5},
+		{"(*Interface).Embedded", Method, 5},
+		{"(*Interface).EmbeddedType", Method, 11},
+		{"(*Interface).Empty", Method, 5},
+		{"(*Interface).ExplicitMethod", Method, 5},
+		{"(*Interface).IsComparable", Method, 18},
+		{"(*Interface).IsImplicit", Method, 18},
+		{"(*Interface).IsMethodSet", Method, 18},
+		{"(*Interface).MarkImplicit", Method, 18},
+		{"(*Interface).Method", Method, 5},
+		{"(*Interface).NumEmbeddeds", Method, 5},
+		{"(*Interface).NumExplicitMethods", Method, 5},
+		{"(*Interface).NumMethods", Method, 5},
+		{"(*Interface).String", Method, 5},
+		{"(*Interface).Underlying", Method, 5},
+		{"(*Label).Exported", Method, 5},
+		{"(*Label).Id", Method, 5},
+		{"(*Label).Name", Method, 5},
+		{"(*Label).Parent", Method, 5},
+		{"(*Label).Pkg", Method, 5},
+		{"(*Label).Pos", Method, 5},
+		{"(*Label).String", Method, 5},
+		{"(*Label).Type", Method, 5},
+		{"(*Map).Elem", Method, 5},
+		{"(*Map).Key", Method, 5},
+		{"(*Map).String", Method, 5},
+		{"(*Map).Underlying", Method, 5},
+		{"(*MethodSet).At", Method, 5},
+		{"(*MethodSet).Len", Method, 5},
+		{"(*MethodSet).Lookup", Method, 5},
+		{"(*MethodSet).String", Method, 5},
+		{"(*Named).AddMethod", Method, 5},
+		{"(*Named).Method", Method, 5},
+		{"(*Named).NumMethods", Method, 5},
+		{"(*Named).Obj", Method, 5},
+		{"(*Named).Origin", Method, 18},
+		{"(*Named).SetTypeParams", Method, 18},
+		{"(*Named).SetUnderlying", Method, 5},
+		{"(*Named).String", Method, 5},
+		{"(*Named).TypeArgs", Method, 18},
+		{"(*Named).TypeParams", Method, 18},
+		{"(*Named).Underlying", Method, 5},
+		{"(*Nil).Exported", Method, 5},
+		{"(*Nil).Id", Method, 5},
+		{"(*Nil).Name", Method, 5},
+		{"(*Nil).Parent", Method, 5},
+		{"(*Nil).Pkg", Method, 5},
+		{"(*Nil).Pos", Method, 5},
+		{"(*Nil).String", Method, 5},
+		{"(*Nil).Type", Method, 5},
+		{"(*Package).Complete", Method, 5},
+		{"(*Package).GoVersion", Method, 21},
+		{"(*Package).Imports", Method, 5},
+		{"(*Package).MarkComplete", Method, 5},
+		{"(*Package).Name", Method, 5},
+		{"(*Package).Path", Method, 5},
+		{"(*Package).Scope", Method, 5},
+		{"(*Package).SetImports", Method, 5},
+		{"(*Package).SetName", Method, 6},
+		{"(*Package).String", Method, 5},
+		{"(*PkgName).Exported", Method, 5},
+		{"(*PkgName).Id", Method, 5},
+		{"(*PkgName).Imported", Method, 5},
+		{"(*PkgName).Name", Method, 5},
+		{"(*PkgName).Parent", Method, 5},
+		{"(*PkgName).Pkg", Method, 5},
+		{"(*PkgName).Pos", Method, 5},
+		{"(*PkgName).String", Method, 5},
+		{"(*PkgName).Type", Method, 5},
+		{"(*Pointer).Elem", Method, 5},
+		{"(*Pointer).String", Method, 5},
+		{"(*Pointer).Underlying", Method, 5},
+		{"(*Scope).Child", Method, 5},
+		{"(*Scope).Contains", Method, 5},
+		{"(*Scope).End", Method, 5},
+		{"(*Scope).Innermost", Method, 5},
+		{"(*Scope).Insert", Method, 5},
+		{"(*Scope).Len", Method, 5},
+		{"(*Scope).Lookup", Method, 5},
+		{"(*Scope).LookupParent", Method, 5},
+		{"(*Scope).Names", Method, 5},
+		{"(*Scope).NumChildren", Method, 5},
+		{"(*Scope).Parent", Method, 5},
+		{"(*Scope).Pos", Method, 5},
+		{"(*Scope).String", Method, 5},
+		{"(*Scope).WriteTo", Method, 5},
+		{"(*Selection).Index", Method, 5},
+		{"(*Selection).Indirect", Method, 5},
+		{"(*Selection).Kind", Method, 5},
+		{"(*Selection).Obj", Method, 5},
+		{"(*Selection).Recv", Method, 5},
+		{"(*Selection).String", Method, 5},
+		{"(*Selection).Type", Method, 5},
+		{"(*Signature).Params", Method, 5},
+		{"(*Signature).Recv", Method, 5},
+		{"(*Signature).RecvTypeParams", Method, 18},
+		{"(*Signature).Results", Method, 5},
+		{"(*Signature).String", Method, 5},
+		{"(*Signature).TypeParams", Method, 18},
+		{"(*Signature).Underlying", Method, 5},
+		{"(*Signature).Variadic", Method, 5},
+		{"(*Slice).Elem", Method, 5},
+		{"(*Slice).String", Method, 5},
+		{"(*Slice).Underlying", Method, 5},
+		{"(*StdSizes).Alignof", Method, 5},
+		{"(*StdSizes).Offsetsof", Method, 5},
+		{"(*StdSizes).Sizeof", Method, 5},
+		{"(*Struct).Field", Method, 5},
+		{"(*Struct).NumFields", Method, 5},
+		{"(*Struct).String", Method, 5},
+		{"(*Struct).Tag", Method, 5},
+		{"(*Struct).Underlying", Method, 5},
+		{"(*Term).String", Method, 18},
+		{"(*Term).Tilde", Method, 18},
+		{"(*Term).Type", Method, 18},
+		{"(*Tuple).At", Method, 5},
+		{"(*Tuple).Len", Method, 5},
+		{"(*Tuple).String", Method, 5},
+		{"(*Tuple).Underlying", Method, 5},
+		{"(*TypeList).At", Method, 18},
+		{"(*TypeList).Len", Method, 18},
+		{"(*TypeName).Exported", Method, 5},
+		{"(*TypeName).Id", Method, 5},
+		{"(*TypeName).IsAlias", Method, 9},
+		{"(*TypeName).Name", Method, 5},
+		{"(*TypeName).Parent", Method, 5},
+		{"(*TypeName).Pkg", Method, 5},
+		{"(*TypeName).Pos", Method, 5},
+		{"(*TypeName).String", Method, 5},
+		{"(*TypeName).Type", Method, 5},
+		{"(*TypeParam).Constraint", Method, 18},
+		{"(*TypeParam).Index", Method, 18},
+		{"(*TypeParam).Obj", Method, 18},
+		{"(*TypeParam).SetConstraint", Method, 18},
+		{"(*TypeParam).String", Method, 18},
+		{"(*TypeParam).Underlying", Method, 18},
+		{"(*TypeParamList).At", Method, 18},
+		{"(*TypeParamList).Len", Method, 18},
+		{"(*Union).Len", Method, 18},
+		{"(*Union).String", Method, 18},
+		{"(*Union).Term", Method, 18},
+		{"(*Union).Underlying", Method, 18},
+		{"(*Var).Anonymous", Method, 5},
+		{"(*Var).Embedded", Method, 11},
+		{"(*Var).Exported", Method, 5},
+		{"(*Var).Id", Method, 5},
+		{"(*Var).IsField", Method, 5},
+		{"(*Var).Name", Method, 5},
+		{"(*Var).Origin", Method, 19},
+		{"(*Var).Parent", Method, 5},
+		{"(*Var).Pkg", Method, 5},
+		{"(*Var).Pos", Method, 5},
+		{"(*Var).String", Method, 5},
+		{"(*Var).Type", Method, 5},
+		{"(Checker).ObjectOf", Method, 5},
+		{"(Checker).PkgNameOf", Method, 22},
+		{"(Checker).TypeOf", Method, 5},
+		{"(Error).Error", Method, 5},
+		{"(TypeAndValue).Addressable", Method, 5},
+		{"(TypeAndValue).Assignable", Method, 5},
+		{"(TypeAndValue).HasOk", Method, 5},
+		{"(TypeAndValue).IsBuiltin", Method, 5},
+		{"(TypeAndValue).IsNil", Method, 5},
+		{"(TypeAndValue).IsType", Method, 5},
+		{"(TypeAndValue).IsValue", Method, 5},
+		{"(TypeAndValue).IsVoid", Method, 5},
+		{"Alias", Type, 22},
+		{"ArgumentError", Type, 18},
+		{"ArgumentError.Err", Field, 18},
+		{"ArgumentError.Index", Field, 18},
+		{"Array", Type, 5},
+		{"AssertableTo", Func, 5},
+		{"AssignableTo", Func, 5},
+		{"Basic", Type, 5},
+		{"BasicInfo", Type, 5},
+		{"BasicKind", Type, 5},
+		{"Bool", Const, 5},
+		{"Builtin", Type, 5},
+		{"Byte", Const, 5},
+		{"Chan", Type, 5},
+		{"ChanDir", Type, 5},
+		{"CheckExpr", Func, 13},
+		{"Checker", Type, 5},
+		{"Checker.Info", Field, 5},
+		{"Comparable", Func, 5},
+		{"Complex128", Const, 5},
+		{"Complex64", Const, 5},
+		{"Config", Type, 5},
+		{"Config.Context", Field, 18},
+		{"Config.DisableUnusedImportCheck", Field, 5},
+		{"Config.Error", Field, 5},
+		{"Config.FakeImportC", Field, 5},
+		{"Config.GoVersion", Field, 18},
+		{"Config.IgnoreFuncBodies", Field, 5},
+		{"Config.Importer", Field, 5},
+		{"Config.Sizes", Field, 5},
+		{"Const", Type, 5},
+		{"Context", Type, 18},
+		{"ConvertibleTo", Func, 5},
+		{"DefPredeclaredTestFuncs", Func, 5},
+		{"Default", Func, 8},
+		{"Error", Type, 5},
+		{"Error.Fset", Field, 5},
+		{"Error.Msg", Field, 5},
+		{"Error.Pos", Field, 5},
+		{"Error.Soft", Field, 5},
+		{"Eval", Func, 5},
+		{"ExprString", Func, 5},
+		{"FieldVal", Const, 5},
+		{"Float32", Const, 5},
+		{"Float64", Const, 5},
+		{"Func", Type, 5},
+		{"Id", Func, 5},
+		{"Identical", Func, 5},
+		{"IdenticalIgnoreTags", Func, 8},
+		{"Implements", Func, 5},
+		{"ImportMode", Type, 6},
+		{"Importer", Type, 5},
+		{"ImporterFrom", Type, 6},
+		{"Info", Type, 5},
+		{"Info.Defs", Field, 5},
+		{"Info.FileVersions", Field, 22},
+		{"Info.Implicits", Field, 5},
+		{"Info.InitOrder", Field, 5},
+		{"Info.Instances", Field, 18},
+		{"Info.Scopes", Field, 5},
+		{"Info.Selections", Field, 5},
+		{"Info.Types", Field, 5},
+		{"Info.Uses", Field, 5},
+		{"Initializer", Type, 5},
+		{"Initializer.Lhs", Field, 5},
+		{"Initializer.Rhs", Field, 5},
+		{"Instance", Type, 18},
+		{"Instance.Type", Field, 18},
+		{"Instance.TypeArgs", Field, 18},
+		{"Instantiate", Func, 18},
+		{"Int", Const, 5},
+		{"Int16", Const, 5},
+		{"Int32", Const, 5},
+		{"Int64", Const, 5},
+		{"Int8", Const, 5},
+		{"Interface", Type, 5},
+		{"Invalid", Const, 5},
+		{"IsBoolean", Const, 5},
+		{"IsComplex", Const, 5},
+		{"IsConstType", Const, 5},
+		{"IsFloat", Const, 5},
+		{"IsInteger", Const, 5},
+		{"IsInterface", Func, 5},
+		{"IsNumeric", Const, 5},
+		{"IsOrdered", Const, 5},
+		{"IsString", Const, 5},
+		{"IsUnsigned", Const, 5},
+		{"IsUntyped", Const, 5},
+		{"Label", Type, 5},
+		{"LookupFieldOrMethod", Func, 5},
+		{"Map", Type, 5},
+		{"MethodExpr", Const, 5},
+		{"MethodSet", Type, 5},
+		{"MethodVal", Const, 5},
+		{"MissingMethod", Func, 5},
+		{"Named", Type, 5},
+		{"NewAlias", Func, 22},
+		{"NewArray", Func, 5},
+		{"NewChan", Func, 5},
+		{"NewChecker", Func, 5},
+		{"NewConst", Func, 5},
+		{"NewContext", Func, 18},
+		{"NewField", Func, 5},
+		{"NewFunc", Func, 5},
+		{"NewInterface", Func, 5},
+		{"NewInterfaceType", Func, 11},
+		{"NewLabel", Func, 5},
+		{"NewMap", Func, 5},
+		{"NewMethodSet", Func, 5},
+		{"NewNamed", Func, 5},
+		{"NewPackage", Func, 5},
+		{"NewParam", Func, 5},
+		{"NewPkgName", Func, 5},
+		{"NewPointer", Func, 5},
+		{"NewScope", Func, 5},
+		{"NewSignature", Func, 5},
+		{"NewSignatureType", Func, 18},
+		{"NewSlice", Func, 5},
+		{"NewStruct", Func, 5},
+		{"NewTerm", Func, 18},
+		{"NewTuple", Func, 5},
+		{"NewTypeName", Func, 5},
+		{"NewTypeParam", Func, 18},
+		{"NewUnion", Func, 18},
+		{"NewVar", Func, 5},
+		{"Nil", Type, 5},
+		{"Object", Type, 5},
+		{"ObjectString", Func, 5},
+		{"Package", Type, 5},
+		{"PkgName", Type, 5},
+		{"Pointer", Type, 5},
+		{"Qualifier", Type, 5},
+		{"RecvOnly", Const, 5},
+		{"RelativeTo", Func, 5},
+		{"Rune", Const, 5},
+		{"Satisfies", Func, 20},
+		{"Scope", Type, 5},
+		{"Selection", Type, 5},
+		{"SelectionKind", Type, 5},
+		{"SelectionString", Func, 5},
+		{"SendOnly", Const, 5},
+		{"SendRecv", Const, 5},
+		{"Signature", Type, 5},
+		{"Sizes", Type, 5},
+		{"SizesFor", Func, 9},
+		{"Slice", Type, 5},
+		{"StdSizes", Type, 5},
+		{"StdSizes.MaxAlign", Field, 5},
+		{"StdSizes.WordSize", Field, 5},
+		{"String", Const, 5},
+		{"Struct", Type, 5},
+		{"Term", Type, 18},
+		{"Tuple", Type, 5},
+		{"Typ", Var, 5},
+		{"Type", Type, 5},
+		{"TypeAndValue", Type, 5},
+		{"TypeAndValue.Type", Field, 5},
+		{"TypeAndValue.Value", Field, 5},
+		{"TypeList", Type, 18},
+		{"TypeName", Type, 5},
+		{"TypeParam", Type, 18},
+		{"TypeParamList", Type, 18},
+		{"TypeString", Func, 5},
+		{"Uint", Const, 5},
+		{"Uint16", Const, 5},
+		{"Uint32", Const, 5},
+		{"Uint64", Const, 5},
+		{"Uint8", Const, 5},
+		{"Uintptr", Const, 5},
+		{"Unalias", Func, 22},
+		{"Union", Type, 18},
+		{"Universe", Var, 5},
+		{"Unsafe", Var, 5},
+		{"UnsafePointer", Const, 5},
+		{"UntypedBool", Const, 5},
+		{"UntypedComplex", Const, 5},
+		{"UntypedFloat", Const, 5},
+		{"UntypedInt", Const, 5},
+		{"UntypedNil", Const, 5},
+		{"UntypedRune", Const, 5},
+		{"UntypedString", Const, 5},
+		{"Var", Type, 5},
+		{"WriteExpr", Func, 5},
+		{"WriteSignature", Func, 5},
+		{"WriteType", Func, 5},
+	},
+	"go/version": {
+		{"Compare", Func, 22},
+		{"IsValid", Func, 22},
+		{"Lang", Func, 22},
+	},
+	"hash": {
+		{"Hash", Type, 0},
+		{"Hash32", Type, 0},
+		{"Hash64", Type, 0},
+	},
+	"hash/adler32": {
+		{"Checksum", Func, 0},
+		{"New", Func, 0},
+		{"Size", Const, 0},
+	},
+	"hash/crc32": {
+		{"Castagnoli", Const, 0},
+		{"Checksum", Func, 0},
+		{"ChecksumIEEE", Func, 0},
+		{"IEEE", Const, 0},
+		{"IEEETable", Var, 0},
+		{"Koopman", Const, 0},
+		{"MakeTable", Func, 0},
+		{"New", Func, 0},
+		{"NewIEEE", Func, 0},
+		{"Size", Const, 0},
+		{"Table", Type, 0},
+		{"Update", Func, 0},
+	},
+	"hash/crc64": {
+		{"Checksum", Func, 0},
+		{"ECMA", Const, 0},
+		{"ISO", Const, 0},
+		{"MakeTable", Func, 0},
+		{"New", Func, 0},
+		{"Size", Const, 0},
+		{"Table", Type, 0},
+		{"Update", Func, 0},
+	},
+	"hash/fnv": {
+		{"New128", Func, 9},
+		{"New128a", Func, 9},
+		{"New32", Func, 0},
+		{"New32a", Func, 0},
+		{"New64", Func, 0},
+		{"New64a", Func, 0},
+	},
+	"hash/maphash": {
+		{"(*Hash).BlockSize", Method, 14},
+		{"(*Hash).Reset", Method, 14},
+		{"(*Hash).Seed", Method, 14},
+		{"(*Hash).SetSeed", Method, 14},
+		{"(*Hash).Size", Method, 14},
+		{"(*Hash).Sum", Method, 14},
+		{"(*Hash).Sum64", Method, 14},
+		{"(*Hash).Write", Method, 14},
+		{"(*Hash).WriteByte", Method, 14},
+		{"(*Hash).WriteString", Method, 14},
+		{"Bytes", Func, 19},
+		{"Hash", Type, 14},
+		{"MakeSeed", Func, 14},
+		{"Seed", Type, 14},
+		{"String", Func, 19},
+	},
+	"html": {
+		{"EscapeString", Func, 0},
+		{"UnescapeString", Func, 0},
+	},
+	"html/template": {
+		{"(*Error).Error", Method, 0},
+		{"(*Template).AddParseTree", Method, 0},
+		{"(*Template).Clone", Method, 0},
+		{"(*Template).DefinedTemplates", Method, 6},
+		{"(*Template).Delims", Method, 0},
+		{"(*Template).Execute", Method, 0},
+		{"(*Template).ExecuteTemplate", Method, 0},
+		{"(*Template).Funcs", Method, 0},
+		{"(*Template).Lookup", Method, 0},
+		{"(*Template).Name", Method, 0},
+		{"(*Template).New", Method, 0},
+		{"(*Template).Option", Method, 5},
+		{"(*Template).Parse", Method, 0},
+		{"(*Template).ParseFS", Method, 16},
+		{"(*Template).ParseFiles", Method, 0},
+		{"(*Template).ParseGlob", Method, 0},
+		{"(*Template).Templates", Method, 0},
+		{"CSS", Type, 0},
+		{"ErrAmbigContext", Const, 0},
+		{"ErrBadHTML", Const, 0},
+		{"ErrBranchEnd", Const, 0},
+		{"ErrEndContext", Const, 0},
+		{"ErrJSTemplate", Const, 21},
+		{"ErrNoSuchTemplate", Const, 0},
+		{"ErrOutputContext", Const, 0},
+		{"ErrPartialCharset", Const, 0},
+		{"ErrPartialEscape", Const, 0},
+		{"ErrPredefinedEscaper", Const, 9},
+		{"ErrRangeLoopReentry", Const, 0},
+		{"ErrSlashAmbig", Const, 0},
+		{"Error", Type, 0},
+		{"Error.Description", Field, 0},
+		{"Error.ErrorCode", Field, 0},
+		{"Error.Line", Field, 0},
+		{"Error.Name", Field, 0},
+		{"Error.Node", Field, 4},
+		{"ErrorCode", Type, 0},
+		{"FuncMap", Type, 0},
+		{"HTML", Type, 0},
+		{"HTMLAttr", Type, 0},
+		{"HTMLEscape", Func, 0},
+		{"HTMLEscapeString", Func, 0},
+		{"HTMLEscaper", Func, 0},
+		{"IsTrue", Func, 6},
+		{"JS", Type, 0},
+		{"JSEscape", Func, 0},
+		{"JSEscapeString", Func, 0},
+		{"JSEscaper", Func, 0},
+		{"JSStr", Type, 0},
+		{"Must", Func, 0},
+		{"New", Func, 0},
+		{"OK", Const, 0},
+		{"ParseFS", Func, 16},
+		{"ParseFiles", Func, 0},
+		{"ParseGlob", Func, 0},
+		{"Srcset", Type, 10},
+		{"Template", Type, 0},
+		{"Template.Tree", Field, 2},
+		{"URL", Type, 0},
+		{"URLQueryEscaper", Func, 0},
+	},
+	"image": {
+		{"(*Alpha).AlphaAt", Method, 4},
+		{"(*Alpha).At", Method, 0},
+		{"(*Alpha).Bounds", Method, 0},
+		{"(*Alpha).ColorModel", Method, 0},
+		{"(*Alpha).Opaque", Method, 0},
+		{"(*Alpha).PixOffset", Method, 0},
+		{"(*Alpha).RGBA64At", Method, 17},
+		{"(*Alpha).Set", Method, 0},
+		{"(*Alpha).SetAlpha", Method, 0},
+		{"(*Alpha).SetRGBA64", Method, 17},
+		{"(*Alpha).SubImage", Method, 0},
+		{"(*Alpha16).Alpha16At", Method, 4},
+		{"(*Alpha16).At", Method, 0},
+		{"(*Alpha16).Bounds", Method, 0},
+		{"(*Alpha16).ColorModel", Method, 0},
+		{"(*Alpha16).Opaque", Method, 0},
+		{"(*Alpha16).PixOffset", Method, 0},
+		{"(*Alpha16).RGBA64At", Method, 17},
+		{"(*Alpha16).Set", Method, 0},
+		{"(*Alpha16).SetAlpha16", Method, 0},
+		{"(*Alpha16).SetRGBA64", Method, 17},
+		{"(*Alpha16).SubImage", Method, 0},
+		{"(*CMYK).At", Method, 5},
+		{"(*CMYK).Bounds", Method, 5},
+		{"(*CMYK).CMYKAt", Method, 5},
+		{"(*CMYK).ColorModel", Method, 5},
+		{"(*CMYK).Opaque", Method, 5},
+		{"(*CMYK).PixOffset", Method, 5},
+		{"(*CMYK).RGBA64At", Method, 17},
+		{"(*CMYK).Set", Method, 5},
+		{"(*CMYK).SetCMYK", Method, 5},
+		{"(*CMYK).SetRGBA64", Method, 17},
+		{"(*CMYK).SubImage", Method, 5},
+		{"(*Gray).At", Method, 0},
+		{"(*Gray).Bounds", Method, 0},
+		{"(*Gray).ColorModel", Method, 0},
+		{"(*Gray).GrayAt", Method, 4},
+		{"(*Gray).Opaque", Method, 0},
+		{"(*Gray).PixOffset", Method, 0},
+		{"(*Gray).RGBA64At", Method, 17},
+		{"(*Gray).Set", Method, 0},
+		{"(*Gray).SetGray", Method, 0},
+		{"(*Gray).SetRGBA64", Method, 17},
+		{"(*Gray).SubImage", Method, 0},
+		{"(*Gray16).At", Method, 0},
+		{"(*Gray16).Bounds", Method, 0},
+		{"(*Gray16).ColorModel", Method, 0},
+		{"(*Gray16).Gray16At", Method, 4},
+		{"(*Gray16).Opaque", Method, 0},
+		{"(*Gray16).PixOffset", Method, 0},
+		{"(*Gray16).RGBA64At", Method, 17},
+		{"(*Gray16).Set", Method, 0},
+		{"(*Gray16).SetGray16", Method, 0},
+		{"(*Gray16).SetRGBA64", Method, 17},
+		{"(*Gray16).SubImage", Method, 0},
+		{"(*NRGBA).At", Method, 0},
+		{"(*NRGBA).Bounds", Method, 0},
+		{"(*NRGBA).ColorModel", Method, 0},
+		{"(*NRGBA).NRGBAAt", Method, 4},
+		{"(*NRGBA).Opaque", Method, 0},
+		{"(*NRGBA).PixOffset", Method, 0},
+		{"(*NRGBA).RGBA64At", Method, 17},
+		{"(*NRGBA).Set", Method, 0},
+		{"(*NRGBA).SetNRGBA", Method, 0},
+		{"(*NRGBA).SetRGBA64", Method, 17},
+		{"(*NRGBA).SubImage", Method, 0},
+		{"(*NRGBA64).At", Method, 0},
+		{"(*NRGBA64).Bounds", Method, 0},
+		{"(*NRGBA64).ColorModel", Method, 0},
+		{"(*NRGBA64).NRGBA64At", Method, 4},
+		{"(*NRGBA64).Opaque", Method, 0},
+		{"(*NRGBA64).PixOffset", Method, 0},
+		{"(*NRGBA64).RGBA64At", Method, 17},
+		{"(*NRGBA64).Set", Method, 0},
+		{"(*NRGBA64).SetNRGBA64", Method, 0},
+		{"(*NRGBA64).SetRGBA64", Method, 17},
+		{"(*NRGBA64).SubImage", Method, 0},
+		{"(*NYCbCrA).AOffset", Method, 6},
+		{"(*NYCbCrA).At", Method, 6},
+		{"(*NYCbCrA).Bounds", Method, 6},
+		{"(*NYCbCrA).COffset", Method, 6},
+		{"(*NYCbCrA).ColorModel", Method, 6},
+		{"(*NYCbCrA).NYCbCrAAt", Method, 6},
+		{"(*NYCbCrA).Opaque", Method, 6},
+		{"(*NYCbCrA).RGBA64At", Method, 17},
+		{"(*NYCbCrA).SubImage", Method, 6},
+		{"(*NYCbCrA).YCbCrAt", Method, 6},
+		{"(*NYCbCrA).YOffset", Method, 6},
+		{"(*Paletted).At", Method, 0},
+		{"(*Paletted).Bounds", Method, 0},
+		{"(*Paletted).ColorIndexAt", Method, 0},
+		{"(*Paletted).ColorModel", Method, 0},
+		{"(*Paletted).Opaque", Method, 0},
+		{"(*Paletted).PixOffset", Method, 0},
+		{"(*Paletted).RGBA64At", Method, 17},
+		{"(*Paletted).Set", Method, 0},
+		{"(*Paletted).SetColorIndex", Method, 0},
+		{"(*Paletted).SetRGBA64", Method, 17},
+		{"(*Paletted).SubImage", Method, 0},
+		{"(*RGBA).At", Method, 0},
+		{"(*RGBA).Bounds", Method, 0},
+		{"(*RGBA).ColorModel", Method, 0},
+		{"(*RGBA).Opaque", Method, 0},
+		{"(*RGBA).PixOffset", Method, 0},
+		{"(*RGBA).RGBA64At", Method, 17},
+		{"(*RGBA).RGBAAt", Method, 4},
+		{"(*RGBA).Set", Method, 0},
+		{"(*RGBA).SetRGBA", Method, 0},
+		{"(*RGBA).SetRGBA64", Method, 17},
+		{"(*RGBA).SubImage", Method, 0},
+		{"(*RGBA64).At", Method, 0},
+		{"(*RGBA64).Bounds", Method, 0},
+		{"(*RGBA64).ColorModel", Method, 0},
+		{"(*RGBA64).Opaque", Method, 0},
+		{"(*RGBA64).PixOffset", Method, 0},
+		{"(*RGBA64).RGBA64At", Method, 4},
+		{"(*RGBA64).Set", Method, 0},
+		{"(*RGBA64).SetRGBA64", Method, 0},
+		{"(*RGBA64).SubImage", Method, 0},
+		{"(*Uniform).At", Method, 0},
+		{"(*Uniform).Bounds", Method, 0},
+		{"(*Uniform).ColorModel", Method, 0},
+		{"(*Uniform).Convert", Method, 0},
+		{"(*Uniform).Opaque", Method, 0},
+		{"(*Uniform).RGBA", Method, 0},
+		{"(*Uniform).RGBA64At", Method, 17},
+		{"(*YCbCr).At", Method, 0},
+		{"(*YCbCr).Bounds", Method, 0},
+		{"(*YCbCr).COffset", Method, 0},
+		{"(*YCbCr).ColorModel", Method, 0},
+		{"(*YCbCr).Opaque", Method, 0},
+		{"(*YCbCr).RGBA64At", Method, 17},
+		{"(*YCbCr).SubImage", Method, 0},
+		{"(*YCbCr).YCbCrAt", Method, 4},
+		{"(*YCbCr).YOffset", Method, 0},
+		{"(Point).Add", Method, 0},
+		{"(Point).Div", Method, 0},
+		{"(Point).Eq", Method, 0},
+		{"(Point).In", Method, 0},
+		{"(Point).Mod", Method, 0},
+		{"(Point).Mul", Method, 0},
+		{"(Point).String", Method, 0},
+		{"(Point).Sub", Method, 0},
+		{"(Rectangle).Add", Method, 0},
+		{"(Rectangle).At", Method, 5},
+		{"(Rectangle).Bounds", Method, 5},
+		{"(Rectangle).Canon", Method, 0},
+		{"(Rectangle).ColorModel", Method, 5},
+		{"(Rectangle).Dx", Method, 0},
+		{"(Rectangle).Dy", Method, 0},
+		{"(Rectangle).Empty", Method, 0},
+		{"(Rectangle).Eq", Method, 0},
+		{"(Rectangle).In", Method, 0},
+		{"(Rectangle).Inset", Method, 0},
+		{"(Rectangle).Intersect", Method, 0},
+		{"(Rectangle).Overlaps", Method, 0},
+		{"(Rectangle).RGBA64At", Method, 17},
+		{"(Rectangle).Size", Method, 0},
+		{"(Rectangle).String", Method, 0},
+		{"(Rectangle).Sub", Method, 0},
+		{"(Rectangle).Union", Method, 0},
+		{"(YCbCrSubsampleRatio).String", Method, 0},
+		{"Alpha", Type, 0},
+		{"Alpha.Pix", Field, 0},
+		{"Alpha.Rect", Field, 0},
+		{"Alpha.Stride", Field, 0},
+		{"Alpha16", Type, 0},
+		{"Alpha16.Pix", Field, 0},
+		{"Alpha16.Rect", Field, 0},
+		{"Alpha16.Stride", Field, 0},
+		{"Black", Var, 0},
+		{"CMYK", Type, 5},
+		{"CMYK.Pix", Field, 5},
+		{"CMYK.Rect", Field, 5},
+		{"CMYK.Stride", Field, 5},
+		{"Config", Type, 0},
+		{"Config.ColorModel", Field, 0},
+		{"Config.Height", Field, 0},
+		{"Config.Width", Field, 0},
+		{"Decode", Func, 0},
+		{"DecodeConfig", Func, 0},
+		{"ErrFormat", Var, 0},
+		{"Gray", Type, 0},
+		{"Gray.Pix", Field, 0},
+		{"Gray.Rect", Field, 0},
+		{"Gray.Stride", Field, 0},
+		{"Gray16", Type, 0},
+		{"Gray16.Pix", Field, 0},
+		{"Gray16.Rect", Field, 0},
+		{"Gray16.Stride", Field, 0},
+		{"Image", Type, 0},
+		{"NRGBA", Type, 0},
+		{"NRGBA.Pix", Field, 0},
+		{"NRGBA.Rect", Field, 0},
+		{"NRGBA.Stride", Field, 0},
+		{"NRGBA64", Type, 0},
+		{"NRGBA64.Pix", Field, 0},
+		{"NRGBA64.Rect", Field, 0},
+		{"NRGBA64.Stride", Field, 0},
+		{"NYCbCrA", Type, 6},
+		{"NYCbCrA.A", Field, 6},
+		{"NYCbCrA.AStride", Field, 6},
+		{"NYCbCrA.YCbCr", Field, 6},
+		{"NewAlpha", Func, 0},
+		{"NewAlpha16", Func, 0},
+		{"NewCMYK", Func, 5},
+		{"NewGray", Func, 0},
+		{"NewGray16", Func, 0},
+		{"NewNRGBA", Func, 0},
+		{"NewNRGBA64", Func, 0},
+		{"NewNYCbCrA", Func, 6},
+		{"NewPaletted", Func, 0},
+		{"NewRGBA", Func, 0},
+		{"NewRGBA64", Func, 0},
+		{"NewUniform", Func, 0},
+		{"NewYCbCr", Func, 0},
+		{"Opaque", Var, 0},
+		{"Paletted", Type, 0},
+		{"Paletted.Palette", Field, 0},
+		{"Paletted.Pix", Field, 0},
+		{"Paletted.Rect", Field, 0},
+		{"Paletted.Stride", Field, 0},
+		{"PalettedImage", Type, 0},
+		{"Point", Type, 0},
+		{"Point.X", Field, 0},
+		{"Point.Y", Field, 0},
+		{"Pt", Func, 0},
+		{"RGBA", Type, 0},
+		{"RGBA.Pix", Field, 0},
+		{"RGBA.Rect", Field, 0},
+		{"RGBA.Stride", Field, 0},
+		{"RGBA64", Type, 0},
+		{"RGBA64.Pix", Field, 0},
+		{"RGBA64.Rect", Field, 0},
+		{"RGBA64.Stride", Field, 0},
+		{"RGBA64Image", Type, 17},
+		{"Rect", Func, 0},
+		{"Rectangle", Type, 0},
+		{"Rectangle.Max", Field, 0},
+		{"Rectangle.Min", Field, 0},
+		{"RegisterFormat", Func, 0},
+		{"Transparent", Var, 0},
+		{"Uniform", Type, 0},
+		{"Uniform.C", Field, 0},
+		{"White", Var, 0},
+		{"YCbCr", Type, 0},
+		{"YCbCr.CStride", Field, 0},
+		{"YCbCr.Cb", Field, 0},
+		{"YCbCr.Cr", Field, 0},
+		{"YCbCr.Rect", Field, 0},
+		{"YCbCr.SubsampleRatio", Field, 0},
+		{"YCbCr.Y", Field, 0},
+		{"YCbCr.YStride", Field, 0},
+		{"YCbCrSubsampleRatio", Type, 0},
+		{"YCbCrSubsampleRatio410", Const, 5},
+		{"YCbCrSubsampleRatio411", Const, 5},
+		{"YCbCrSubsampleRatio420", Const, 0},
+		{"YCbCrSubsampleRatio422", Const, 0},
+		{"YCbCrSubsampleRatio440", Const, 1},
+		{"YCbCrSubsampleRatio444", Const, 0},
+		{"ZP", Var, 0},
+		{"ZR", Var, 0},
+	},
+	"image/color": {
+		{"(Alpha).RGBA", Method, 0},
+		{"(Alpha16).RGBA", Method, 0},
+		{"(CMYK).RGBA", Method, 5},
+		{"(Gray).RGBA", Method, 0},
+		{"(Gray16).RGBA", Method, 0},
+		{"(NRGBA).RGBA", Method, 0},
+		{"(NRGBA64).RGBA", Method, 0},
+		{"(NYCbCrA).RGBA", Method, 6},
+		{"(Palette).Convert", Method, 0},
+		{"(Palette).Index", Method, 0},
+		{"(RGBA).RGBA", Method, 0},
+		{"(RGBA64).RGBA", Method, 0},
+		{"(YCbCr).RGBA", Method, 0},
+		{"Alpha", Type, 0},
+		{"Alpha.A", Field, 0},
+		{"Alpha16", Type, 0},
+		{"Alpha16.A", Field, 0},
+		{"Alpha16Model", Var, 0},
+		{"AlphaModel", Var, 0},
+		{"Black", Var, 0},
+		{"CMYK", Type, 5},
+		{"CMYK.C", Field, 5},
+		{"CMYK.K", Field, 5},
+		{"CMYK.M", Field, 5},
+		{"CMYK.Y", Field, 5},
+		{"CMYKModel", Var, 5},
+		{"CMYKToRGB", Func, 5},
+		{"Color", Type, 0},
+		{"Gray", Type, 0},
+		{"Gray.Y", Field, 0},
+		{"Gray16", Type, 0},
+		{"Gray16.Y", Field, 0},
+		{"Gray16Model", Var, 0},
+		{"GrayModel", Var, 0},
+		{"Model", Type, 0},
+		{"ModelFunc", Func, 0},
+		{"NRGBA", Type, 0},
+		{"NRGBA.A", Field, 0},
+		{"NRGBA.B", Field, 0},
+		{"NRGBA.G", Field, 0},
+		{"NRGBA.R", Field, 0},
+		{"NRGBA64", Type, 0},
+		{"NRGBA64.A", Field, 0},
+		{"NRGBA64.B", Field, 0},
+		{"NRGBA64.G", Field, 0},
+		{"NRGBA64.R", Field, 0},
+		{"NRGBA64Model", Var, 0},
+		{"NRGBAModel", Var, 0},
+		{"NYCbCrA", Type, 6},
+		{"NYCbCrA.A", Field, 6},
+		{"NYCbCrA.YCbCr", Field, 6},
+		{"NYCbCrAModel", Var, 6},
+		{"Opaque", Var, 0},
+		{"Palette", Type, 0},
+		{"RGBA", Type, 0},
+		{"RGBA.A", Field, 0},
+		{"RGBA.B", Field, 0},
+		{"RGBA.G", Field, 0},
+		{"RGBA.R", Field, 0},
+		{"RGBA64", Type, 0},
+		{"RGBA64.A", Field, 0},
+		{"RGBA64.B", Field, 0},
+		{"RGBA64.G", Field, 0},
+		{"RGBA64.R", Field, 0},
+		{"RGBA64Model", Var, 0},
+		{"RGBAModel", Var, 0},
+		{"RGBToCMYK", Func, 5},
+		{"RGBToYCbCr", Func, 0},
+		{"Transparent", Var, 0},
+		{"White", Var, 0},
+		{"YCbCr", Type, 0},
+		{"YCbCr.Cb", Field, 0},
+		{"YCbCr.Cr", Field, 0},
+		{"YCbCr.Y", Field, 0},
+		{"YCbCrModel", Var, 0},
+		{"YCbCrToRGB", Func, 0},
+	},
+	"image/color/palette": {
+		{"Plan9", Var, 2},
+		{"WebSafe", Var, 2},
+	},
+	"image/draw": {
+		{"(Op).Draw", Method, 2},
+		{"Draw", Func, 0},
+		{"DrawMask", Func, 0},
+		{"Drawer", Type, 2},
+		{"FloydSteinberg", Var, 2},
+		{"Image", Type, 0},
+		{"Op", Type, 0},
+		{"Over", Const, 0},
+		{"Quantizer", Type, 2},
+		{"RGBA64Image", Type, 17},
+		{"Src", Const, 0},
+	},
+	"image/gif": {
+		{"Decode", Func, 0},
+		{"DecodeAll", Func, 0},
+		{"DecodeConfig", Func, 0},
+		{"DisposalBackground", Const, 5},
+		{"DisposalNone", Const, 5},
+		{"DisposalPrevious", Const, 5},
+		{"Encode", Func, 2},
+		{"EncodeAll", Func, 2},
+		{"GIF", Type, 0},
+		{"GIF.BackgroundIndex", Field, 5},
+		{"GIF.Config", Field, 5},
+		{"GIF.Delay", Field, 0},
+		{"GIF.Disposal", Field, 5},
+		{"GIF.Image", Field, 0},
+		{"GIF.LoopCount", Field, 0},
+		{"Options", Type, 2},
+		{"Options.Drawer", Field, 2},
+		{"Options.NumColors", Field, 2},
+		{"Options.Quantizer", Field, 2},
+	},
+	"image/jpeg": {
+		{"(FormatError).Error", Method, 0},
+		{"(UnsupportedError).Error", Method, 0},
+		{"Decode", Func, 0},
+		{"DecodeConfig", Func, 0},
+		{"DefaultQuality", Const, 0},
+		{"Encode", Func, 0},
+		{"FormatError", Type, 0},
+		{"Options", Type, 0},
+		{"Options.Quality", Field, 0},
+		{"Reader", Type, 0},
+		{"UnsupportedError", Type, 0},
+	},
+	"image/png": {
+		{"(*Encoder).Encode", Method, 4},
+		{"(FormatError).Error", Method, 0},
+		{"(UnsupportedError).Error", Method, 0},
+		{"BestCompression", Const, 4},
+		{"BestSpeed", Const, 4},
+		{"CompressionLevel", Type, 4},
+		{"Decode", Func, 0},
+		{"DecodeConfig", Func, 0},
+		{"DefaultCompression", Const, 4},
+		{"Encode", Func, 0},
+		{"Encoder", Type, 4},
+		{"Encoder.BufferPool", Field, 9},
+		{"Encoder.CompressionLevel", Field, 4},
+		{"EncoderBuffer", Type, 9},
+		{"EncoderBufferPool", Type, 9},
+		{"FormatError", Type, 0},
+		{"NoCompression", Const, 4},
+		{"UnsupportedError", Type, 0},
+	},
+	"index/suffixarray": {
+		{"(*Index).Bytes", Method, 0},
+		{"(*Index).FindAllIndex", Method, 0},
+		{"(*Index).Lookup", Method, 0},
+		{"(*Index).Read", Method, 0},
+		{"(*Index).Write", Method, 0},
+		{"Index", Type, 0},
+		{"New", Func, 0},
+	},
+	"io": {
+		{"(*LimitedReader).Read", Method, 0},
+		{"(*OffsetWriter).Seek", Method, 20},
+		{"(*OffsetWriter).Write", Method, 20},
+		{"(*OffsetWriter).WriteAt", Method, 20},
+		{"(*PipeReader).Close", Method, 0},
+		{"(*PipeReader).CloseWithError", Method, 0},
+		{"(*PipeReader).Read", Method, 0},
+		{"(*PipeWriter).Close", Method, 0},
+		{"(*PipeWriter).CloseWithError", Method, 0},
+		{"(*PipeWriter).Write", Method, 0},
+		{"(*SectionReader).Outer", Method, 22},
+		{"(*SectionReader).Read", Method, 0},
+		{"(*SectionReader).ReadAt", Method, 0},
+		{"(*SectionReader).Seek", Method, 0},
+		{"(*SectionReader).Size", Method, 0},
+		{"ByteReader", Type, 0},
+		{"ByteScanner", Type, 0},
+		{"ByteWriter", Type, 1},
+		{"Closer", Type, 0},
+		{"Copy", Func, 0},
+		{"CopyBuffer", Func, 5},
+		{"CopyN", Func, 0},
+		{"Discard", Var, 16},
+		{"EOF", Var, 0},
+		{"ErrClosedPipe", Var, 0},
+		{"ErrNoProgress", Var, 1},
+		{"ErrShortBuffer", Var, 0},
+		{"ErrShortWrite", Var, 0},
+		{"ErrUnexpectedEOF", Var, 0},
+		{"LimitReader", Func, 0},
+		{"LimitedReader", Type, 0},
+		{"LimitedReader.N", Field, 0},
+		{"LimitedReader.R", Field, 0},
+		{"MultiReader", Func, 0},
+		{"MultiWriter", Func, 0},
+		{"NewOffsetWriter", Func, 20},
+		{"NewSectionReader", Func, 0},
+		{"NopCloser", Func, 16},
+		{"OffsetWriter", Type, 20},
+		{"Pipe", Func, 0},
+		{"PipeReader", Type, 0},
+		{"PipeWriter", Type, 0},
+		{"ReadAll", Func, 16},
+		{"ReadAtLeast", Func, 0},
+		{"ReadCloser", Type, 0},
+		{"ReadFull", Func, 0},
+		{"ReadSeekCloser", Type, 16},
+		{"ReadSeeker", Type, 0},
+		{"ReadWriteCloser", Type, 0},
+		{"ReadWriteSeeker", Type, 0},
+		{"ReadWriter", Type, 0},
+		{"Reader", Type, 0},
+		{"ReaderAt", Type, 0},
+		{"ReaderFrom", Type, 0},
+		{"RuneReader", Type, 0},
+		{"RuneScanner", Type, 0},
+		{"SectionReader", Type, 0},
+		{"SeekCurrent", Const, 7},
+		{"SeekEnd", Const, 7},
+		{"SeekStart", Const, 7},
+		{"Seeker", Type, 0},
+		{"StringWriter", Type, 12},
+		{"TeeReader", Func, 0},
+		{"WriteCloser", Type, 0},
+		{"WriteSeeker", Type, 0},
+		{"WriteString", Func, 0},
+		{"Writer", Type, 0},
+		{"WriterAt", Type, 0},
+		{"WriterTo", Type, 0},
+	},
+	"io/fs": {
+		{"(*PathError).Error", Method, 16},
+		{"(*PathError).Timeout", Method, 16},
+		{"(*PathError).Unwrap", Method, 16},
+		{"(FileMode).IsDir", Method, 16},
+		{"(FileMode).IsRegular", Method, 16},
+		{"(FileMode).Perm", Method, 16},
+		{"(FileMode).String", Method, 16},
+		{"(FileMode).Type", Method, 16},
+		{"DirEntry", Type, 16},
+		{"ErrClosed", Var, 16},
+		{"ErrExist", Var, 16},
+		{"ErrInvalid", Var, 16},
+		{"ErrNotExist", Var, 16},
+		{"ErrPermission", Var, 16},
+		{"FS", Type, 16},
+		{"File", Type, 16},
+		{"FileInfo", Type, 16},
+		{"FileInfoToDirEntry", Func, 17},
+		{"FileMode", Type, 16},
+		{"FormatDirEntry", Func, 21},
+		{"FormatFileInfo", Func, 21},
+		{"Glob", Func, 16},
+		{"GlobFS", Type, 16},
+		{"ModeAppend", Const, 16},
+		{"ModeCharDevice", Const, 16},
+		{"ModeDevice", Const, 16},
+		{"ModeDir", Const, 16},
+		{"ModeExclusive", Const, 16},
+		{"ModeIrregular", Const, 16},
+		{"ModeNamedPipe", Const, 16},
+		{"ModePerm", Const, 16},
+		{"ModeSetgid", Const, 16},
+		{"ModeSetuid", Const, 16},
+		{"ModeSocket", Const, 16},
+		{"ModeSticky", Const, 16},
+		{"ModeSymlink", Const, 16},
+		{"ModeTemporary", Const, 16},
+		{"ModeType", Const, 16},
+		{"PathError", Type, 16},
+		{"PathError.Err", Field, 16},
+		{"PathError.Op", Field, 16},
+		{"PathError.Path", Field, 16},
+		{"ReadDir", Func, 16},
+		{"ReadDirFS", Type, 16},
+		{"ReadDirFile", Type, 16},
+		{"ReadFile", Func, 16},
+		{"ReadFileFS", Type, 16},
+		{"SkipAll", Var, 20},
+		{"SkipDir", Var, 16},
+		{"Stat", Func, 16},
+		{"StatFS", Type, 16},
+		{"Sub", Func, 16},
+		{"SubFS", Type, 16},
+		{"ValidPath", Func, 16},
+		{"WalkDir", Func, 16},
+		{"WalkDirFunc", Type, 16},
+	},
+	"io/ioutil": {
+		{"Discard", Var, 0},
+		{"NopCloser", Func, 0},
+		{"ReadAll", Func, 0},
+		{"ReadDir", Func, 0},
+		{"ReadFile", Func, 0},
+		{"TempDir", Func, 0},
+		{"TempFile", Func, 0},
+		{"WriteFile", Func, 0},
+	},
+	"log": {
+		{"(*Logger).Fatal", Method, 0},
+		{"(*Logger).Fatalf", Method, 0},
+		{"(*Logger).Fatalln", Method, 0},
+		{"(*Logger).Flags", Method, 0},
+		{"(*Logger).Output", Method, 0},
+		{"(*Logger).Panic", Method, 0},
+		{"(*Logger).Panicf", Method, 0},
+		{"(*Logger).Panicln", Method, 0},
+		{"(*Logger).Prefix", Method, 0},
+		{"(*Logger).Print", Method, 0},
+		{"(*Logger).Printf", Method, 0},
+		{"(*Logger).Println", Method, 0},
+		{"(*Logger).SetFlags", Method, 0},
+		{"(*Logger).SetOutput", Method, 5},
+		{"(*Logger).SetPrefix", Method, 0},
+		{"(*Logger).Writer", Method, 12},
+		{"Default", Func, 16},
+		{"Fatal", Func, 0},
+		{"Fatalf", Func, 0},
+		{"Fatalln", Func, 0},
+		{"Flags", Func, 0},
+		{"LUTC", Const, 5},
+		{"Ldate", Const, 0},
+		{"Llongfile", Const, 0},
+		{"Lmicroseconds", Const, 0},
+		{"Lmsgprefix", Const, 14},
+		{"Logger", Type, 0},
+		{"Lshortfile", Const, 0},
+		{"LstdFlags", Const, 0},
+		{"Ltime", Const, 0},
+		{"New", Func, 0},
+		{"Output", Func, 5},
+		{"Panic", Func, 0},
+		{"Panicf", Func, 0},
+		{"Panicln", Func, 0},
+		{"Prefix", Func, 0},
+		{"Print", Func, 0},
+		{"Printf", Func, 0},
+		{"Println", Func, 0},
+		{"SetFlags", Func, 0},
+		{"SetOutput", Func, 0},
+		{"SetPrefix", Func, 0},
+		{"Writer", Func, 13},
+	},
+	"log/slog": {
+		{"(*JSONHandler).Enabled", Method, 21},
+		{"(*JSONHandler).Handle", Method, 21},
+		{"(*JSONHandler).WithAttrs", Method, 21},
+		{"(*JSONHandler).WithGroup", Method, 21},
+		{"(*Level).UnmarshalJSON", Method, 21},
+		{"(*Level).UnmarshalText", Method, 21},
+		{"(*LevelVar).Level", Method, 21},
+		{"(*LevelVar).MarshalText", Method, 21},
+		{"(*LevelVar).Set", Method, 21},
+		{"(*LevelVar).String", Method, 21},
+		{"(*LevelVar).UnmarshalText", Method, 21},
+		{"(*Logger).Debug", Method, 21},
+		{"(*Logger).DebugContext", Method, 21},
+		{"(*Logger).Enabled", Method, 21},
+		{"(*Logger).Error", Method, 21},
+		{"(*Logger).ErrorContext", Method, 21},
+		{"(*Logger).Handler", Method, 21},
+		{"(*Logger).Info", Method, 21},
+		{"(*Logger).InfoContext", Method, 21},
+		{"(*Logger).Log", Method, 21},
+		{"(*Logger).LogAttrs", Method, 21},
+		{"(*Logger).Warn", Method, 21},
+		{"(*Logger).WarnContext", Method, 21},
+		{"(*Logger).With", Method, 21},
+		{"(*Logger).WithGroup", Method, 21},
+		{"(*Record).Add", Method, 21},
+		{"(*Record).AddAttrs", Method, 21},
+		{"(*TextHandler).Enabled", Method, 21},
+		{"(*TextHandler).Handle", Method, 21},
+		{"(*TextHandler).WithAttrs", Method, 21},
+		{"(*TextHandler).WithGroup", Method, 21},
+		{"(Attr).Equal", Method, 21},
+		{"(Attr).String", Method, 21},
+		{"(Kind).String", Method, 21},
+		{"(Level).Level", Method, 21},
+		{"(Level).MarshalJSON", Method, 21},
+		{"(Level).MarshalText", Method, 21},
+		{"(Level).String", Method, 21},
+		{"(Record).Attrs", Method, 21},
+		{"(Record).Clone", Method, 21},
+		{"(Record).NumAttrs", Method, 21},
+		{"(Value).Any", Method, 21},
+		{"(Value).Bool", Method, 21},
+		{"(Value).Duration", Method, 21},
+		{"(Value).Equal", Method, 21},
+		{"(Value).Float64", Method, 21},
+		{"(Value).Group", Method, 21},
+		{"(Value).Int64", Method, 21},
+		{"(Value).Kind", Method, 21},
+		{"(Value).LogValuer", Method, 21},
+		{"(Value).Resolve", Method, 21},
+		{"(Value).String", Method, 21},
+		{"(Value).Time", Method, 21},
+		{"(Value).Uint64", Method, 21},
+		{"Any", Func, 21},
+		{"AnyValue", Func, 21},
+		{"Attr", Type, 21},
+		{"Attr.Key", Field, 21},
+		{"Attr.Value", Field, 21},
+		{"Bool", Func, 21},
+		{"BoolValue", Func, 21},
+		{"Debug", Func, 21},
+		{"DebugContext", Func, 21},
+		{"Default", Func, 21},
+		{"Duration", Func, 21},
+		{"DurationValue", Func, 21},
+		{"Error", Func, 21},
+		{"ErrorContext", Func, 21},
+		{"Float64", Func, 21},
+		{"Float64Value", Func, 21},
+		{"Group", Func, 21},
+		{"GroupValue", Func, 21},
+		{"Handler", Type, 21},
+		{"HandlerOptions", Type, 21},
+		{"HandlerOptions.AddSource", Field, 21},
+		{"HandlerOptions.Level", Field, 21},
+		{"HandlerOptions.ReplaceAttr", Field, 21},
+		{"Info", Func, 21},
+		{"InfoContext", Func, 21},
+		{"Int", Func, 21},
+		{"Int64", Func, 21},
+		{"Int64Value", Func, 21},
+		{"IntValue", Func, 21},
+		{"JSONHandler", Type, 21},
+		{"Kind", Type, 21},
+		{"KindAny", Const, 21},
+		{"KindBool", Const, 21},
+		{"KindDuration", Const, 21},
+		{"KindFloat64", Const, 21},
+		{"KindGroup", Const, 21},
+		{"KindInt64", Const, 21},
+		{"KindLogValuer", Const, 21},
+		{"KindString", Const, 21},
+		{"KindTime", Const, 21},
+		{"KindUint64", Const, 21},
+		{"Level", Type, 21},
+		{"LevelDebug", Const, 21},
+		{"LevelError", Const, 21},
+		{"LevelInfo", Const, 21},
+		{"LevelKey", Const, 21},
+		{"LevelVar", Type, 21},
+		{"LevelWarn", Const, 21},
+		{"Leveler", Type, 21},
+		{"Log", Func, 21},
+		{"LogAttrs", Func, 21},
+		{"LogValuer", Type, 21},
+		{"Logger", Type, 21},
+		{"MessageKey", Const, 21},
+		{"New", Func, 21},
+		{"NewJSONHandler", Func, 21},
+		{"NewLogLogger", Func, 21},
+		{"NewRecord", Func, 21},
+		{"NewTextHandler", Func, 21},
+		{"Record", Type, 21},
+		{"Record.Level", Field, 21},
+		{"Record.Message", Field, 21},
+		{"Record.PC", Field, 21},
+		{"Record.Time", Field, 21},
+		{"SetDefault", Func, 21},
+		{"SetLogLoggerLevel", Func, 22},
+		{"Source", Type, 21},
+		{"Source.File", Field, 21},
+		{"Source.Function", Field, 21},
+		{"Source.Line", Field, 21},
+		{"SourceKey", Const, 21},
+		{"String", Func, 21},
+		{"StringValue", Func, 21},
+		{"TextHandler", Type, 21},
+		{"Time", Func, 21},
+		{"TimeKey", Const, 21},
+		{"TimeValue", Func, 21},
+		{"Uint64", Func, 21},
+		{"Uint64Value", Func, 21},
+		{"Value", Type, 21},
+		{"Warn", Func, 21},
+		{"WarnContext", Func, 21},
+		{"With", Func, 21},
+	},
+	"log/syslog": {
+		{"(*Writer).Alert", Method, 0},
+		{"(*Writer).Close", Method, 0},
+		{"(*Writer).Crit", Method, 0},
+		{"(*Writer).Debug", Method, 0},
+		{"(*Writer).Emerg", Method, 0},
+		{"(*Writer).Err", Method, 0},
+		{"(*Writer).Info", Method, 0},
+		{"(*Writer).Notice", Method, 0},
+		{"(*Writer).Warning", Method, 0},
+		{"(*Writer).Write", Method, 0},
+		{"Dial", Func, 0},
+		{"LOG_ALERT", Const, 0},
+		{"LOG_AUTH", Const, 1},
+		{"LOG_AUTHPRIV", Const, 1},
+		{"LOG_CRIT", Const, 0},
+		{"LOG_CRON", Const, 1},
+		{"LOG_DAEMON", Const, 1},
+		{"LOG_DEBUG", Const, 0},
+		{"LOG_EMERG", Const, 0},
+		{"LOG_ERR", Const, 0},
+		{"LOG_FTP", Const, 1},
+		{"LOG_INFO", Const, 0},
+		{"LOG_KERN", Const, 1},
+		{"LOG_LOCAL0", Const, 1},
+		{"LOG_LOCAL1", Const, 1},
+		{"LOG_LOCAL2", Const, 1},
+		{"LOG_LOCAL3", Const, 1},
+		{"LOG_LOCAL4", Const, 1},
+		{"LOG_LOCAL5", Const, 1},
+		{"LOG_LOCAL6", Const, 1},
+		{"LOG_LOCAL7", Const, 1},
+		{"LOG_LPR", Const, 1},
+		{"LOG_MAIL", Const, 1},
+		{"LOG_NEWS", Const, 1},
+		{"LOG_NOTICE", Const, 0},
+		{"LOG_SYSLOG", Const, 1},
+		{"LOG_USER", Const, 1},
+		{"LOG_UUCP", Const, 1},
+		{"LOG_WARNING", Const, 0},
+		{"New", Func, 0},
+		{"NewLogger", Func, 0},
+		{"Priority", Type, 0},
+		{"Writer", Type, 0},
+	},
+	"maps": {
+		{"Clone", Func, 21},
+		{"Copy", Func, 21},
+		{"DeleteFunc", Func, 21},
+		{"Equal", Func, 21},
+		{"EqualFunc", Func, 21},
+	},
+	"math": {
+		{"Abs", Func, 0},
+		{"Acos", Func, 0},
+		{"Acosh", Func, 0},
+		{"Asin", Func, 0},
+		{"Asinh", Func, 0},
+		{"Atan", Func, 0},
+		{"Atan2", Func, 0},
+		{"Atanh", Func, 0},
+		{"Cbrt", Func, 0},
+		{"Ceil", Func, 0},
+		{"Copysign", Func, 0},
+		{"Cos", Func, 0},
+		{"Cosh", Func, 0},
+		{"Dim", Func, 0},
+		{"E", Const, 0},
+		{"Erf", Func, 0},
+		{"Erfc", Func, 0},
+		{"Erfcinv", Func, 10},
+		{"Erfinv", Func, 10},
+		{"Exp", Func, 0},
+		{"Exp2", Func, 0},
+		{"Expm1", Func, 0},
+		{"FMA", Func, 14},
+		{"Float32bits", Func, 0},
+		{"Float32frombits", Func, 0},
+		{"Float64bits", Func, 0},
+		{"Float64frombits", Func, 0},
+		{"Floor", Func, 0},
+		{"Frexp", Func, 0},
+		{"Gamma", Func, 0},
+		{"Hypot", Func, 0},
+		{"Ilogb", Func, 0},
+		{"Inf", Func, 0},
+		{"IsInf", Func, 0},
+		{"IsNaN", Func, 0},
+		{"J0", Func, 0},
+		{"J1", Func, 0},
+		{"Jn", Func, 0},
+		{"Ldexp", Func, 0},
+		{"Lgamma", Func, 0},
+		{"Ln10", Const, 0},
+		{"Ln2", Const, 0},
+		{"Log", Func, 0},
+		{"Log10", Func, 0},
+		{"Log10E", Const, 0},
+		{"Log1p", Func, 0},
+		{"Log2", Func, 0},
+		{"Log2E", Const, 0},
+		{"Logb", Func, 0},
+		{"Max", Func, 0},
+		{"MaxFloat32", Const, 0},
+		{"MaxFloat64", Const, 0},
+		{"MaxInt", Const, 17},
+		{"MaxInt16", Const, 0},
+		{"MaxInt32", Const, 0},
+		{"MaxInt64", Const, 0},
+		{"MaxInt8", Const, 0},
+		{"MaxUint", Const, 17},
+		{"MaxUint16", Const, 0},
+		{"MaxUint32", Const, 0},
+		{"MaxUint64", Const, 0},
+		{"MaxUint8", Const, 0},
+		{"Min", Func, 0},
+		{"MinInt", Const, 17},
+		{"MinInt16", Const, 0},
+		{"MinInt32", Const, 0},
+		{"MinInt64", Const, 0},
+		{"MinInt8", Const, 0},
+		{"Mod", Func, 0},
+		{"Modf", Func, 0},
+		{"NaN", Func, 0},
+		{"Nextafter", Func, 0},
+		{"Nextafter32", Func, 4},
+		{"Phi", Const, 0},
+		{"Pi", Const, 0},
+		{"Pow", Func, 0},
+		{"Pow10", Func, 0},
+		{"Remainder", Func, 0},
+		{"Round", Func, 10},
+		{"RoundToEven", Func, 10},
+		{"Signbit", Func, 0},
+		{"Sin", Func, 0},
+		{"Sincos", Func, 0},
+		{"Sinh", Func, 0},
+		{"SmallestNonzeroFloat32", Const, 0},
+		{"SmallestNonzeroFloat64", Const, 0},
+		{"Sqrt", Func, 0},
+		{"Sqrt2", Const, 0},
+		{"SqrtE", Const, 0},
+		{"SqrtPhi", Const, 0},
+		{"SqrtPi", Const, 0},
+		{"Tan", Func, 0},
+		{"Tanh", Func, 0},
+		{"Trunc", Func, 0},
+		{"Y0", Func, 0},
+		{"Y1", Func, 0},
+		{"Yn", Func, 0},
+	},
+	"math/big": {
+		{"(*Float).Abs", Method, 5},
+		{"(*Float).Acc", Method, 5},
+		{"(*Float).Add", Method, 5},
+		{"(*Float).Append", Method, 5},
+		{"(*Float).Cmp", Method, 5},
+		{"(*Float).Copy", Method, 5},
+		{"(*Float).Float32", Method, 5},
+		{"(*Float).Float64", Method, 5},
+		{"(*Float).Format", Method, 5},
+		{"(*Float).GobDecode", Method, 7},
+		{"(*Float).GobEncode", Method, 7},
+		{"(*Float).Int", Method, 5},
+		{"(*Float).Int64", Method, 5},
+		{"(*Float).IsInf", Method, 5},
+		{"(*Float).IsInt", Method, 5},
+		{"(*Float).MantExp", Method, 5},
+		{"(*Float).MarshalText", Method, 6},
+		{"(*Float).MinPrec", Method, 5},
+		{"(*Float).Mode", Method, 5},
+		{"(*Float).Mul", Method, 5},
+		{"(*Float).Neg", Method, 5},
+		{"(*Float).Parse", Method, 5},
+		{"(*Float).Prec", Method, 5},
+		{"(*Float).Quo", Method, 5},
+		{"(*Float).Rat", Method, 5},
+		{"(*Float).Scan", Method, 8},
+		{"(*Float).Set", Method, 5},
+		{"(*Float).SetFloat64", Method, 5},
+		{"(*Float).SetInf", Method, 5},
+		{"(*Float).SetInt", Method, 5},
+		{"(*Float).SetInt64", Method, 5},
+		{"(*Float).SetMantExp", Method, 5},
+		{"(*Float).SetMode", Method, 5},
+		{"(*Float).SetPrec", Method, 5},
+		{"(*Float).SetRat", Method, 5},
+		{"(*Float).SetString", Method, 5},
+		{"(*Float).SetUint64", Method, 5},
+		{"(*Float).Sign", Method, 5},
+		{"(*Float).Signbit", Method, 5},
+		{"(*Float).Sqrt", Method, 10},
+		{"(*Float).String", Method, 5},
+		{"(*Float).Sub", Method, 5},
+		{"(*Float).Text", Method, 5},
+		{"(*Float).Uint64", Method, 5},
+		{"(*Float).UnmarshalText", Method, 6},
+		{"(*Int).Abs", Method, 0},
+		{"(*Int).Add", Method, 0},
+		{"(*Int).And", Method, 0},
+		{"(*Int).AndNot", Method, 0},
+		{"(*Int).Append", Method, 6},
+		{"(*Int).Binomial", Method, 0},
+		{"(*Int).Bit", Method, 0},
+		{"(*Int).BitLen", Method, 0},
+		{"(*Int).Bits", Method, 0},
+		{"(*Int).Bytes", Method, 0},
+		{"(*Int).Cmp", Method, 0},
+		{"(*Int).CmpAbs", Method, 10},
+		{"(*Int).Div", Method, 0},
+		{"(*Int).DivMod", Method, 0},
+		{"(*Int).Exp", Method, 0},
+		{"(*Int).FillBytes", Method, 15},
+		{"(*Int).Float64", Method, 21},
+		{"(*Int).Format", Method, 0},
+		{"(*Int).GCD", Method, 0},
+		{"(*Int).GobDecode", Method, 0},
+		{"(*Int).GobEncode", Method, 0},
+		{"(*Int).Int64", Method, 0},
+		{"(*Int).IsInt64", Method, 9},
+		{"(*Int).IsUint64", Method, 9},
+		{"(*Int).Lsh", Method, 0},
+		{"(*Int).MarshalJSON", Method, 1},
+		{"(*Int).MarshalText", Method, 3},
+		{"(*Int).Mod", Method, 0},
+		{"(*Int).ModInverse", Method, 0},
+		{"(*Int).ModSqrt", Method, 5},
+		{"(*Int).Mul", Method, 0},
+		{"(*Int).MulRange", Method, 0},
+		{"(*Int).Neg", Method, 0},
+		{"(*Int).Not", Method, 0},
+		{"(*Int).Or", Method, 0},
+		{"(*Int).ProbablyPrime", Method, 0},
+		{"(*Int).Quo", Method, 0},
+		{"(*Int).QuoRem", Method, 0},
+		{"(*Int).Rand", Method, 0},
+		{"(*Int).Rem", Method, 0},
+		{"(*Int).Rsh", Method, 0},
+		{"(*Int).Scan", Method, 0},
+		{"(*Int).Set", Method, 0},
+		{"(*Int).SetBit", Method, 0},
+		{"(*Int).SetBits", Method, 0},
+		{"(*Int).SetBytes", Method, 0},
+		{"(*Int).SetInt64", Method, 0},
+		{"(*Int).SetString", Method, 0},
+		{"(*Int).SetUint64", Method, 1},
+		{"(*Int).Sign", Method, 0},
+		{"(*Int).Sqrt", Method, 8},
+		{"(*Int).String", Method, 0},
+		{"(*Int).Sub", Method, 0},
+		{"(*Int).Text", Method, 6},
+		{"(*Int).TrailingZeroBits", Method, 13},
+		{"(*Int).Uint64", Method, 1},
+		{"(*Int).UnmarshalJSON", Method, 1},
+		{"(*Int).UnmarshalText", Method, 3},
+		{"(*Int).Xor", Method, 0},
+		{"(*Rat).Abs", Method, 0},
+		{"(*Rat).Add", Method, 0},
+		{"(*Rat).Cmp", Method, 0},
+		{"(*Rat).Denom", Method, 0},
+		{"(*Rat).Float32", Method, 4},
+		{"(*Rat).Float64", Method, 1},
+		{"(*Rat).FloatPrec", Method, 22},
+		{"(*Rat).FloatString", Method, 0},
+		{"(*Rat).GobDecode", Method, 0},
+		{"(*Rat).GobEncode", Method, 0},
+		{"(*Rat).Inv", Method, 0},
+		{"(*Rat).IsInt", Method, 0},
+		{"(*Rat).MarshalText", Method, 3},
+		{"(*Rat).Mul", Method, 0},
+		{"(*Rat).Neg", Method, 0},
+		{"(*Rat).Num", Method, 0},
+		{"(*Rat).Quo", Method, 0},
+		{"(*Rat).RatString", Method, 0},
+		{"(*Rat).Scan", Method, 0},
+		{"(*Rat).Set", Method, 0},
+		{"(*Rat).SetFloat64", Method, 1},
+		{"(*Rat).SetFrac", Method, 0},
+		{"(*Rat).SetFrac64", Method, 0},
+		{"(*Rat).SetInt", Method, 0},
+		{"(*Rat).SetInt64", Method, 0},
+		{"(*Rat).SetString", Method, 0},
+		{"(*Rat).SetUint64", Method, 13},
+		{"(*Rat).Sign", Method, 0},
+		{"(*Rat).String", Method, 0},
+		{"(*Rat).Sub", Method, 0},
+		{"(*Rat).UnmarshalText", Method, 3},
+		{"(Accuracy).String", Method, 5},
+		{"(ErrNaN).Error", Method, 5},
+		{"(RoundingMode).String", Method, 5},
+		{"Above", Const, 5},
+		{"Accuracy", Type, 5},
+		{"AwayFromZero", Const, 5},
+		{"Below", Const, 5},
+		{"ErrNaN", Type, 5},
+		{"Exact", Const, 5},
+		{"Float", Type, 5},
+		{"Int", Type, 0},
+		{"Jacobi", Func, 5},
+		{"MaxBase", Const, 0},
+		{"MaxExp", Const, 5},
+		{"MaxPrec", Const, 5},
+		{"MinExp", Const, 5},
+		{"NewFloat", Func, 5},
+		{"NewInt", Func, 0},
+		{"NewRat", Func, 0},
+		{"ParseFloat", Func, 5},
+		{"Rat", Type, 0},
+		{"RoundingMode", Type, 5},
+		{"ToNearestAway", Const, 5},
+		{"ToNearestEven", Const, 5},
+		{"ToNegativeInf", Const, 5},
+		{"ToPositiveInf", Const, 5},
+		{"ToZero", Const, 5},
+		{"Word", Type, 0},
+	},
+	"math/bits": {
+		{"Add", Func, 12},
+		{"Add32", Func, 12},
+		{"Add64", Func, 12},
+		{"Div", Func, 12},
+		{"Div32", Func, 12},
+		{"Div64", Func, 12},
+		{"LeadingZeros", Func, 9},
+		{"LeadingZeros16", Func, 9},
+		{"LeadingZeros32", Func, 9},
+		{"LeadingZeros64", Func, 9},
+		{"LeadingZeros8", Func, 9},
+		{"Len", Func, 9},
+		{"Len16", Func, 9},
+		{"Len32", Func, 9},
+		{"Len64", Func, 9},
+		{"Len8", Func, 9},
+		{"Mul", Func, 12},
+		{"Mul32", Func, 12},
+		{"Mul64", Func, 12},
+		{"OnesCount", Func, 9},
+		{"OnesCount16", Func, 9},
+		{"OnesCount32", Func, 9},
+		{"OnesCount64", Func, 9},
+		{"OnesCount8", Func, 9},
+		{"Rem", Func, 14},
+		{"Rem32", Func, 14},
+		{"Rem64", Func, 14},
+		{"Reverse", Func, 9},
+		{"Reverse16", Func, 9},
+		{"Reverse32", Func, 9},
+		{"Reverse64", Func, 9},
+		{"Reverse8", Func, 9},
+		{"ReverseBytes", Func, 9},
+		{"ReverseBytes16", Func, 9},
+		{"ReverseBytes32", Func, 9},
+		{"ReverseBytes64", Func, 9},
+		{"RotateLeft", Func, 9},
+		{"RotateLeft16", Func, 9},
+		{"RotateLeft32", Func, 9},
+		{"RotateLeft64", Func, 9},
+		{"RotateLeft8", Func, 9},
+		{"Sub", Func, 12},
+		{"Sub32", Func, 12},
+		{"Sub64", Func, 12},
+		{"TrailingZeros", Func, 9},
+		{"TrailingZeros16", Func, 9},
+		{"TrailingZeros32", Func, 9},
+		{"TrailingZeros64", Func, 9},
+		{"TrailingZeros8", Func, 9},
+		{"UintSize", Const, 9},
+	},
+	"math/cmplx": {
+		{"Abs", Func, 0},
+		{"Acos", Func, 0},
+		{"Acosh", Func, 0},
+		{"Asin", Func, 0},
+		{"Asinh", Func, 0},
+		{"Atan", Func, 0},
+		{"Atanh", Func, 0},
+		{"Conj", Func, 0},
+		{"Cos", Func, 0},
+		{"Cosh", Func, 0},
+		{"Cot", Func, 0},
+		{"Exp", Func, 0},
+		{"Inf", Func, 0},
+		{"IsInf", Func, 0},
+		{"IsNaN", Func, 0},
+		{"Log", Func, 0},
+		{"Log10", Func, 0},
+		{"NaN", Func, 0},
+		{"Phase", Func, 0},
+		{"Polar", Func, 0},
+		{"Pow", Func, 0},
+		{"Rect", Func, 0},
+		{"Sin", Func, 0},
+		{"Sinh", Func, 0},
+		{"Sqrt", Func, 0},
+		{"Tan", Func, 0},
+		{"Tanh", Func, 0},
+	},
+	"math/rand": {
+		{"(*Rand).ExpFloat64", Method, 0},
+		{"(*Rand).Float32", Method, 0},
+		{"(*Rand).Float64", Method, 0},
+		{"(*Rand).Int", Method, 0},
+		{"(*Rand).Int31", Method, 0},
+		{"(*Rand).Int31n", Method, 0},
+		{"(*Rand).Int63", Method, 0},
+		{"(*Rand).Int63n", Method, 0},
+		{"(*Rand).Intn", Method, 0},
+		{"(*Rand).NormFloat64", Method, 0},
+		{"(*Rand).Perm", Method, 0},
+		{"(*Rand).Read", Method, 6},
+		{"(*Rand).Seed", Method, 0},
+		{"(*Rand).Shuffle", Method, 10},
+		{"(*Rand).Uint32", Method, 0},
+		{"(*Rand).Uint64", Method, 8},
+		{"(*Zipf).Uint64", Method, 0},
+		{"ExpFloat64", Func, 0},
+		{"Float32", Func, 0},
+		{"Float64", Func, 0},
+		{"Int", Func, 0},
+		{"Int31", Func, 0},
+		{"Int31n", Func, 0},
+		{"Int63", Func, 0},
+		{"Int63n", Func, 0},
+		{"Intn", Func, 0},
+		{"New", Func, 0},
+		{"NewSource", Func, 0},
+		{"NewZipf", Func, 0},
+		{"NormFloat64", Func, 0},
+		{"Perm", Func, 0},
+		{"Rand", Type, 0},
+		{"Read", Func, 6},
+		{"Seed", Func, 0},
+		{"Shuffle", Func, 10},
+		{"Source", Type, 0},
+		{"Source64", Type, 8},
+		{"Uint32", Func, 0},
+		{"Uint64", Func, 8},
+		{"Zipf", Type, 0},
+	},
+	"math/rand/v2": {
+		{"(*ChaCha8).MarshalBinary", Method, 22},
+		{"(*ChaCha8).Seed", Method, 22},
+		{"(*ChaCha8).Uint64", Method, 22},
+		{"(*ChaCha8).UnmarshalBinary", Method, 22},
+		{"(*PCG).MarshalBinary", Method, 22},
+		{"(*PCG).Seed", Method, 22},
+		{"(*PCG).Uint64", Method, 22},
+		{"(*PCG).UnmarshalBinary", Method, 22},
+		{"(*Rand).ExpFloat64", Method, 22},
+		{"(*Rand).Float32", Method, 22},
+		{"(*Rand).Float64", Method, 22},
+		{"(*Rand).Int", Method, 22},
+		{"(*Rand).Int32", Method, 22},
+		{"(*Rand).Int32N", Method, 22},
+		{"(*Rand).Int64", Method, 22},
+		{"(*Rand).Int64N", Method, 22},
+		{"(*Rand).IntN", Method, 22},
+		{"(*Rand).NormFloat64", Method, 22},
+		{"(*Rand).Perm", Method, 22},
+		{"(*Rand).Shuffle", Method, 22},
+		{"(*Rand).Uint32", Method, 22},
+		{"(*Rand).Uint32N", Method, 22},
+		{"(*Rand).Uint64", Method, 22},
+		{"(*Rand).Uint64N", Method, 22},
+		{"(*Rand).UintN", Method, 22},
+		{"(*Zipf).Uint64", Method, 22},
+		{"ChaCha8", Type, 22},
+		{"ExpFloat64", Func, 22},
+		{"Float32", Func, 22},
+		{"Float64", Func, 22},
+		{"Int", Func, 22},
+		{"Int32", Func, 22},
+		{"Int32N", Func, 22},
+		{"Int64", Func, 22},
+		{"Int64N", Func, 22},
+		{"IntN", Func, 22},
+		{"N", Func, 22},
+		{"New", Func, 22},
+		{"NewChaCha8", Func, 22},
+		{"NewPCG", Func, 22},
+		{"NewZipf", Func, 22},
+		{"NormFloat64", Func, 22},
+		{"PCG", Type, 22},
+		{"Perm", Func, 22},
+		{"Rand", Type, 22},
+		{"Shuffle", Func, 22},
+		{"Source", Type, 22},
+		{"Uint32", Func, 22},
+		{"Uint32N", Func, 22},
+		{"Uint64", Func, 22},
+		{"Uint64N", Func, 22},
+		{"UintN", Func, 22},
+		{"Zipf", Type, 22},
+	},
+	"mime": {
+		{"(*WordDecoder).Decode", Method, 5},
+		{"(*WordDecoder).DecodeHeader", Method, 5},
+		{"(WordEncoder).Encode", Method, 5},
+		{"AddExtensionType", Func, 0},
+		{"BEncoding", Const, 5},
+		{"ErrInvalidMediaParameter", Var, 9},
+		{"ExtensionsByType", Func, 5},
+		{"FormatMediaType", Func, 0},
+		{"ParseMediaType", Func, 0},
+		{"QEncoding", Const, 5},
+		{"TypeByExtension", Func, 0},
+		{"WordDecoder", Type, 5},
+		{"WordDecoder.CharsetReader", Field, 5},
+		{"WordEncoder", Type, 5},
+	},
+	"mime/multipart": {
+		{"(*FileHeader).Open", Method, 0},
+		{"(*Form).RemoveAll", Method, 0},
+		{"(*Part).Close", Method, 0},
+		{"(*Part).FileName", Method, 0},
+		{"(*Part).FormName", Method, 0},
+		{"(*Part).Read", Method, 0},
+		{"(*Reader).NextPart", Method, 0},
+		{"(*Reader).NextRawPart", Method, 14},
+		{"(*Reader).ReadForm", Method, 0},
+		{"(*Writer).Boundary", Method, 0},
+		{"(*Writer).Close", Method, 0},
+		{"(*Writer).CreateFormField", Method, 0},
+		{"(*Writer).CreateFormFile", Method, 0},
+		{"(*Writer).CreatePart", Method, 0},
+		{"(*Writer).FormDataContentType", Method, 0},
+		{"(*Writer).SetBoundary", Method, 1},
+		{"(*Writer).WriteField", Method, 0},
+		{"ErrMessageTooLarge", Var, 9},
+		{"File", Type, 0},
+		{"FileHeader", Type, 0},
+		{"FileHeader.Filename", Field, 0},
+		{"FileHeader.Header", Field, 0},
+		{"FileHeader.Size", Field, 9},
+		{"Form", Type, 0},
+		{"Form.File", Field, 0},
+		{"Form.Value", Field, 0},
+		{"NewReader", Func, 0},
+		{"NewWriter", Func, 0},
+		{"Part", Type, 0},
+		{"Part.Header", Field, 0},
+		{"Reader", Type, 0},
+		{"Writer", Type, 0},
+	},
+	"mime/quotedprintable": {
+		{"(*Reader).Read", Method, 5},
+		{"(*Writer).Close", Method, 5},
+		{"(*Writer).Write", Method, 5},
+		{"NewReader", Func, 5},
+		{"NewWriter", Func, 5},
+		{"Reader", Type, 5},
+		{"Writer", Type, 5},
+		{"Writer.Binary", Field, 5},
+	},
+	"net": {
+		{"(*AddrError).Error", Method, 0},
+		{"(*AddrError).Temporary", Method, 0},
+		{"(*AddrError).Timeout", Method, 0},
+		{"(*Buffers).Read", Method, 8},
+		{"(*Buffers).WriteTo", Method, 8},
+		{"(*DNSConfigError).Error", Method, 0},
+		{"(*DNSConfigError).Temporary", Method, 0},
+		{"(*DNSConfigError).Timeout", Method, 0},
+		{"(*DNSConfigError).Unwrap", Method, 13},
+		{"(*DNSError).Error", Method, 0},
+		{"(*DNSError).Temporary", Method, 0},
+		{"(*DNSError).Timeout", Method, 0},
+		{"(*Dialer).Dial", Method, 1},
+		{"(*Dialer).DialContext", Method, 7},
+		{"(*Dialer).MultipathTCP", Method, 21},
+		{"(*Dialer).SetMultipathTCP", Method, 21},
+		{"(*IP).UnmarshalText", Method, 2},
+		{"(*IPAddr).Network", Method, 0},
+		{"(*IPAddr).String", Method, 0},
+		{"(*IPConn).Close", Method, 0},
+		{"(*IPConn).File", Method, 0},
+		{"(*IPConn).LocalAddr", Method, 0},
+		{"(*IPConn).Read", Method, 0},
+		{"(*IPConn).ReadFrom", Method, 0},
+		{"(*IPConn).ReadFromIP", Method, 0},
+		{"(*IPConn).ReadMsgIP", Method, 1},
+		{"(*IPConn).RemoteAddr", Method, 0},
+		{"(*IPConn).SetDeadline", Method, 0},
+		{"(*IPConn).SetReadBuffer", Method, 0},
+		{"(*IPConn).SetReadDeadline", Method, 0},
+		{"(*IPConn).SetWriteBuffer", Method, 0},
+		{"(*IPConn).SetWriteDeadline", Method, 0},
+		{"(*IPConn).SyscallConn", Method, 9},
+		{"(*IPConn).Write", Method, 0},
+		{"(*IPConn).WriteMsgIP", Method, 1},
+		{"(*IPConn).WriteTo", Method, 0},
+		{"(*IPConn).WriteToIP", Method, 0},
+		{"(*IPNet).Contains", Method, 0},
+		{"(*IPNet).Network", Method, 0},
+		{"(*IPNet).String", Method, 0},
+		{"(*Interface).Addrs", Method, 0},
+		{"(*Interface).MulticastAddrs", Method, 0},
+		{"(*ListenConfig).Listen", Method, 11},
+		{"(*ListenConfig).ListenPacket", Method, 11},
+		{"(*ListenConfig).MultipathTCP", Method, 21},
+		{"(*ListenConfig).SetMultipathTCP", Method, 21},
+		{"(*OpError).Error", Method, 0},
+		{"(*OpError).Temporary", Method, 0},
+		{"(*OpError).Timeout", Method, 0},
+		{"(*OpError).Unwrap", Method, 13},
+		{"(*ParseError).Error", Method, 0},
+		{"(*ParseError).Temporary", Method, 17},
+		{"(*ParseError).Timeout", Method, 17},
+		{"(*Resolver).LookupAddr", Method, 8},
+		{"(*Resolver).LookupCNAME", Method, 8},
+		{"(*Resolver).LookupHost", Method, 8},
+		{"(*Resolver).LookupIP", Method, 15},
+		{"(*Resolver).LookupIPAddr", Method, 8},
+		{"(*Resolver).LookupMX", Method, 8},
+		{"(*Resolver).LookupNS", Method, 8},
+		{"(*Resolver).LookupNetIP", Method, 18},
+		{"(*Resolver).LookupPort", Method, 8},
+		{"(*Resolver).LookupSRV", Method, 8},
+		{"(*Resolver).LookupTXT", Method, 8},
+		{"(*TCPAddr).AddrPort", Method, 18},
+		{"(*TCPAddr).Network", Method, 0},
+		{"(*TCPAddr).String", Method, 0},
+		{"(*TCPConn).Close", Method, 0},
+		{"(*TCPConn).CloseRead", Method, 0},
+		{"(*TCPConn).CloseWrite", Method, 0},
+		{"(*TCPConn).File", Method, 0},
+		{"(*TCPConn).LocalAddr", Method, 0},
+		{"(*TCPConn).MultipathTCP", Method, 21},
+		{"(*TCPConn).Read", Method, 0},
+		{"(*TCPConn).ReadFrom", Method, 0},
+		{"(*TCPConn).RemoteAddr", Method, 0},
+		{"(*TCPConn).SetDeadline", Method, 0},
+		{"(*TCPConn).SetKeepAlive", Method, 0},
+		{"(*TCPConn).SetKeepAlivePeriod", Method, 2},
+		{"(*TCPConn).SetLinger", Method, 0},
+		{"(*TCPConn).SetNoDelay", Method, 0},
+		{"(*TCPConn).SetReadBuffer", Method, 0},
+		{"(*TCPConn).SetReadDeadline", Method, 0},
+		{"(*TCPConn).SetWriteBuffer", Method, 0},
+		{"(*TCPConn).SetWriteDeadline", Method, 0},
+		{"(*TCPConn).SyscallConn", Method, 9},
+		{"(*TCPConn).Write", Method, 0},
+		{"(*TCPConn).WriteTo", Method, 22},
+		{"(*TCPListener).Accept", Method, 0},
+		{"(*TCPListener).AcceptTCP", Method, 0},
+		{"(*TCPListener).Addr", Method, 0},
+		{"(*TCPListener).Close", Method, 0},
+		{"(*TCPListener).File", Method, 0},
+		{"(*TCPListener).SetDeadline", Method, 0},
+		{"(*TCPListener).SyscallConn", Method, 10},
+		{"(*UDPAddr).AddrPort", Method, 18},
+		{"(*UDPAddr).Network", Method, 0},
+		{"(*UDPAddr).String", Method, 0},
+		{"(*UDPConn).Close", Method, 0},
+		{"(*UDPConn).File", Method, 0},
+		{"(*UDPConn).LocalAddr", Method, 0},
+		{"(*UDPConn).Read", Method, 0},
+		{"(*UDPConn).ReadFrom", Method, 0},
+		{"(*UDPConn).ReadFromUDP", Method, 0},
+		{"(*UDPConn).ReadFromUDPAddrPort", Method, 18},
+		{"(*UDPConn).ReadMsgUDP", Method, 1},
+		{"(*UDPConn).ReadMsgUDPAddrPort", Method, 18},
+		{"(*UDPConn).RemoteAddr", Method, 0},
+		{"(*UDPConn).SetDeadline", Method, 0},
+		{"(*UDPConn).SetReadBuffer", Method, 0},
+		{"(*UDPConn).SetReadDeadline", Method, 0},
+		{"(*UDPConn).SetWriteBuffer", Method, 0},
+		{"(*UDPConn).SetWriteDeadline", Method, 0},
+		{"(*UDPConn).SyscallConn", Method, 9},
+		{"(*UDPConn).Write", Method, 0},
+		{"(*UDPConn).WriteMsgUDP", Method, 1},
+		{"(*UDPConn).WriteMsgUDPAddrPort", Method, 18},
+		{"(*UDPConn).WriteTo", Method, 0},
+		{"(*UDPConn).WriteToUDP", Method, 0},
+		{"(*UDPConn).WriteToUDPAddrPort", Method, 18},
+		{"(*UnixAddr).Network", Method, 0},
+		{"(*UnixAddr).String", Method, 0},
+		{"(*UnixConn).Close", Method, 0},
+		{"(*UnixConn).CloseRead", Method, 1},
+		{"(*UnixConn).CloseWrite", Method, 1},
+		{"(*UnixConn).File", Method, 0},
+		{"(*UnixConn).LocalAddr", Method, 0},
+		{"(*UnixConn).Read", Method, 0},
+		{"(*UnixConn).ReadFrom", Method, 0},
+		{"(*UnixConn).ReadFromUnix", Method, 0},
+		{"(*UnixConn).ReadMsgUnix", Method, 0},
+		{"(*UnixConn).RemoteAddr", Method, 0},
+		{"(*UnixConn).SetDeadline", Method, 0},
+		{"(*UnixConn).SetReadBuffer", Method, 0},
+		{"(*UnixConn).SetReadDeadline", Method, 0},
+		{"(*UnixConn).SetWriteBuffer", Method, 0},
+		{"(*UnixConn).SetWriteDeadline", Method, 0},
+		{"(*UnixConn).SyscallConn", Method, 9},
+		{"(*UnixConn).Write", Method, 0},
+		{"(*UnixConn).WriteMsgUnix", Method, 0},
+		{"(*UnixConn).WriteTo", Method, 0},
+		{"(*UnixConn).WriteToUnix", Method, 0},
+		{"(*UnixListener).Accept", Method, 0},
+		{"(*UnixListener).AcceptUnix", Method, 0},
+		{"(*UnixListener).Addr", Method, 0},
+		{"(*UnixListener).Close", Method, 0},
+		{"(*UnixListener).File", Method, 0},
+		{"(*UnixListener).SetDeadline", Method, 0},
+		{"(*UnixListener).SetUnlinkOnClose", Method, 8},
+		{"(*UnixListener).SyscallConn", Method, 10},
+		{"(Flags).String", Method, 0},
+		{"(HardwareAddr).String", Method, 0},
+		{"(IP).DefaultMask", Method, 0},
+		{"(IP).Equal", Method, 0},
+		{"(IP).IsGlobalUnicast", Method, 0},
+		{"(IP).IsInterfaceLocalMulticast", Method, 0},
+		{"(IP).IsLinkLocalMulticast", Method, 0},
+		{"(IP).IsLinkLocalUnicast", Method, 0},
+		{"(IP).IsLoopback", Method, 0},
+		{"(IP).IsMulticast", Method, 0},
+		{"(IP).IsPrivate", Method, 17},
+		{"(IP).IsUnspecified", Method, 0},
+		{"(IP).MarshalText", Method, 2},
+		{"(IP).Mask", Method, 0},
+		{"(IP).String", Method, 0},
+		{"(IP).To16", Method, 0},
+		{"(IP).To4", Method, 0},
+		{"(IPMask).Size", Method, 0},
+		{"(IPMask).String", Method, 0},
+		{"(InvalidAddrError).Error", Method, 0},
+		{"(InvalidAddrError).Temporary", Method, 0},
+		{"(InvalidAddrError).Timeout", Method, 0},
+		{"(UnknownNetworkError).Error", Method, 0},
+		{"(UnknownNetworkError).Temporary", Method, 0},
+		{"(UnknownNetworkError).Timeout", Method, 0},
+		{"Addr", Type, 0},
+		{"AddrError", Type, 0},
+		{"AddrError.Addr", Field, 0},
+		{"AddrError.Err", Field, 0},
+		{"Buffers", Type, 8},
+		{"CIDRMask", Func, 0},
+		{"Conn", Type, 0},
+		{"DNSConfigError", Type, 0},
+		{"DNSConfigError.Err", Field, 0},
+		{"DNSError", Type, 0},
+		{"DNSError.Err", Field, 0},
+		{"DNSError.IsNotFound", Field, 13},
+		{"DNSError.IsTemporary", Field, 6},
+		{"DNSError.IsTimeout", Field, 0},
+		{"DNSError.Name", Field, 0},
+		{"DNSError.Server", Field, 0},
+		{"DefaultResolver", Var, 8},
+		{"Dial", Func, 0},
+		{"DialIP", Func, 0},
+		{"DialTCP", Func, 0},
+		{"DialTimeout", Func, 0},
+		{"DialUDP", Func, 0},
+		{"DialUnix", Func, 0},
+		{"Dialer", Type, 1},
+		{"Dialer.Cancel", Field, 6},
+		{"Dialer.Control", Field, 11},
+		{"Dialer.ControlContext", Field, 20},
+		{"Dialer.Deadline", Field, 1},
+		{"Dialer.DualStack", Field, 2},
+		{"Dialer.FallbackDelay", Field, 5},
+		{"Dialer.KeepAlive", Field, 3},
+		{"Dialer.LocalAddr", Field, 1},
+		{"Dialer.Resolver", Field, 8},
+		{"Dialer.Timeout", Field, 1},
+		{"ErrClosed", Var, 16},
+		{"ErrWriteToConnected", Var, 0},
+		{"Error", Type, 0},
+		{"FileConn", Func, 0},
+		{"FileListener", Func, 0},
+		{"FilePacketConn", Func, 0},
+		{"FlagBroadcast", Const, 0},
+		{"FlagLoopback", Const, 0},
+		{"FlagMulticast", Const, 0},
+		{"FlagPointToPoint", Const, 0},
+		{"FlagRunning", Const, 20},
+		{"FlagUp", Const, 0},
+		{"Flags", Type, 0},
+		{"HardwareAddr", Type, 0},
+		{"IP", Type, 0},
+		{"IPAddr", Type, 0},
+		{"IPAddr.IP", Field, 0},
+		{"IPAddr.Zone", Field, 1},
+		{"IPConn", Type, 0},
+		{"IPMask", Type, 0},
+		{"IPNet", Type, 0},
+		{"IPNet.IP", Field, 0},
+		{"IPNet.Mask", Field, 0},
+		{"IPv4", Func, 0},
+		{"IPv4Mask", Func, 0},
+		{"IPv4allrouter", Var, 0},
+		{"IPv4allsys", Var, 0},
+		{"IPv4bcast", Var, 0},
+		{"IPv4len", Const, 0},
+		{"IPv4zero", Var, 0},
+		{"IPv6interfacelocalallnodes", Var, 0},
+		{"IPv6len", Const, 0},
+		{"IPv6linklocalallnodes", Var, 0},
+		{"IPv6linklocalallrouters", Var, 0},
+		{"IPv6loopback", Var, 0},
+		{"IPv6unspecified", Var, 0},
+		{"IPv6zero", Var, 0},
+		{"Interface", Type, 0},
+		{"Interface.Flags", Field, 0},
+		{"Interface.HardwareAddr", Field, 0},
+		{"Interface.Index", Field, 0},
+		{"Interface.MTU", Field, 0},
+		{"Interface.Name", Field, 0},
+		{"InterfaceAddrs", Func, 0},
+		{"InterfaceByIndex", Func, 0},
+		{"InterfaceByName", Func, 0},
+		{"Interfaces", Func, 0},
+		{"InvalidAddrError", Type, 0},
+		{"JoinHostPort", Func, 0},
+		{"Listen", Func, 0},
+		{"ListenConfig", Type, 11},
+		{"ListenConfig.Control", Field, 11},
+		{"ListenConfig.KeepAlive", Field, 13},
+		{"ListenIP", Func, 0},
+		{"ListenMulticastUDP", Func, 0},
+		{"ListenPacket", Func, 0},
+		{"ListenTCP", Func, 0},
+		{"ListenUDP", Func, 0},
+		{"ListenUnix", Func, 0},
+		{"ListenUnixgram", Func, 0},
+		{"Listener", Type, 0},
+		{"LookupAddr", Func, 0},
+		{"LookupCNAME", Func, 0},
+		{"LookupHost", Func, 0},
+		{"LookupIP", Func, 0},
+		{"LookupMX", Func, 0},
+		{"LookupNS", Func, 1},
+		{"LookupPort", Func, 0},
+		{"LookupSRV", Func, 0},
+		{"LookupTXT", Func, 0},
+		{"MX", Type, 0},
+		{"MX.Host", Field, 0},
+		{"MX.Pref", Field, 0},
+		{"NS", Type, 1},
+		{"NS.Host", Field, 1},
+		{"OpError", Type, 0},
+		{"OpError.Addr", Field, 0},
+		{"OpError.Err", Field, 0},
+		{"OpError.Net", Field, 0},
+		{"OpError.Op", Field, 0},
+		{"OpError.Source", Field, 5},
+		{"PacketConn", Type, 0},
+		{"ParseCIDR", Func, 0},
+		{"ParseError", Type, 0},
+		{"ParseError.Text", Field, 0},
+		{"ParseError.Type", Field, 0},
+		{"ParseIP", Func, 0},
+		{"ParseMAC", Func, 0},
+		{"Pipe", Func, 0},
+		{"ResolveIPAddr", Func, 0},
+		{"ResolveTCPAddr", Func, 0},
+		{"ResolveUDPAddr", Func, 0},
+		{"ResolveUnixAddr", Func, 0},
+		{"Resolver", Type, 8},
+		{"Resolver.Dial", Field, 9},
+		{"Resolver.PreferGo", Field, 8},
+		{"Resolver.StrictErrors", Field, 9},
+		{"SRV", Type, 0},
+		{"SRV.Port", Field, 0},
+		{"SRV.Priority", Field, 0},
+		{"SRV.Target", Field, 0},
+		{"SRV.Weight", Field, 0},
+		{"SplitHostPort", Func, 0},
+		{"TCPAddr", Type, 0},
+		{"TCPAddr.IP", Field, 0},
+		{"TCPAddr.Port", Field, 0},
+		{"TCPAddr.Zone", Field, 1},
+		{"TCPAddrFromAddrPort", Func, 18},
+		{"TCPConn", Type, 0},
+		{"TCPListener", Type, 0},
+		{"UDPAddr", Type, 0},
+		{"UDPAddr.IP", Field, 0},
+		{"UDPAddr.Port", Field, 0},
+		{"UDPAddr.Zone", Field, 1},
+		{"UDPAddrFromAddrPort", Func, 18},
+		{"UDPConn", Type, 0},
+		{"UnixAddr", Type, 0},
+		{"UnixAddr.Name", Field, 0},
+		{"UnixAddr.Net", Field, 0},
+		{"UnixConn", Type, 0},
+		{"UnixListener", Type, 0},
+		{"UnknownNetworkError", Type, 0},
+	},
+	"net/http": {
+		{"(*Client).CloseIdleConnections", Method, 12},
+		{"(*Client).Do", Method, 0},
+		{"(*Client).Get", Method, 0},
+		{"(*Client).Head", Method, 0},
+		{"(*Client).Post", Method, 0},
+		{"(*Client).PostForm", Method, 0},
+		{"(*Cookie).String", Method, 0},
+		{"(*Cookie).Valid", Method, 18},
+		{"(*MaxBytesError).Error", Method, 19},
+		{"(*ProtocolError).Error", Method, 0},
+		{"(*ProtocolError).Is", Method, 21},
+		{"(*Request).AddCookie", Method, 0},
+		{"(*Request).BasicAuth", Method, 4},
+		{"(*Request).Clone", Method, 13},
+		{"(*Request).Context", Method, 7},
+		{"(*Request).Cookie", Method, 0},
+		{"(*Request).Cookies", Method, 0},
+		{"(*Request).FormFile", Method, 0},
+		{"(*Request).FormValue", Method, 0},
+		{"(*Request).MultipartReader", Method, 0},
+		{"(*Request).ParseForm", Method, 0},
+		{"(*Request).ParseMultipartForm", Method, 0},
+		{"(*Request).PathValue", Method, 22},
+		{"(*Request).PostFormValue", Method, 1},
+		{"(*Request).ProtoAtLeast", Method, 0},
+		{"(*Request).Referer", Method, 0},
+		{"(*Request).SetBasicAuth", Method, 0},
+		{"(*Request).SetPathValue", Method, 22},
+		{"(*Request).UserAgent", Method, 0},
+		{"(*Request).WithContext", Method, 7},
+		{"(*Request).Write", Method, 0},
+		{"(*Request).WriteProxy", Method, 0},
+		{"(*Response).Cookies", Method, 0},
+		{"(*Response).Location", Method, 0},
+		{"(*Response).ProtoAtLeast", Method, 0},
+		{"(*Response).Write", Method, 0},
+		{"(*ResponseController).EnableFullDuplex", Method, 21},
+		{"(*ResponseController).Flush", Method, 20},
+		{"(*ResponseController).Hijack", Method, 20},
+		{"(*ResponseController).SetReadDeadline", Method, 20},
+		{"(*ResponseController).SetWriteDeadline", Method, 20},
+		{"(*ServeMux).Handle", Method, 0},
+		{"(*ServeMux).HandleFunc", Method, 0},
+		{"(*ServeMux).Handler", Method, 1},
+		{"(*ServeMux).ServeHTTP", Method, 0},
+		{"(*Server).Close", Method, 8},
+		{"(*Server).ListenAndServe", Method, 0},
+		{"(*Server).ListenAndServeTLS", Method, 0},
+		{"(*Server).RegisterOnShutdown", Method, 9},
+		{"(*Server).Serve", Method, 0},
+		{"(*Server).ServeTLS", Method, 9},
+		{"(*Server).SetKeepAlivesEnabled", Method, 3},
+		{"(*Server).Shutdown", Method, 8},
+		{"(*Transport).CancelRequest", Method, 1},
+		{"(*Transport).Clone", Method, 13},
+		{"(*Transport).CloseIdleConnections", Method, 0},
+		{"(*Transport).RegisterProtocol", Method, 0},
+		{"(*Transport).RoundTrip", Method, 0},
+		{"(ConnState).String", Method, 3},
+		{"(Dir).Open", Method, 0},
+		{"(HandlerFunc).ServeHTTP", Method, 0},
+		{"(Header).Add", Method, 0},
+		{"(Header).Clone", Method, 13},
+		{"(Header).Del", Method, 0},
+		{"(Header).Get", Method, 0},
+		{"(Header).Set", Method, 0},
+		{"(Header).Values", Method, 14},
+		{"(Header).Write", Method, 0},
+		{"(Header).WriteSubset", Method, 0},
+		{"AllowQuerySemicolons", Func, 17},
+		{"CanonicalHeaderKey", Func, 0},
+		{"Client", Type, 0},
+		{"Client.CheckRedirect", Field, 0},
+		{"Client.Jar", Field, 0},
+		{"Client.Timeout", Field, 3},
+		{"Client.Transport", Field, 0},
+		{"CloseNotifier", Type, 1},
+		{"ConnState", Type, 3},
+		{"Cookie", Type, 0},
+		{"Cookie.Domain", Field, 0},
+		{"Cookie.Expires", Field, 0},
+		{"Cookie.HttpOnly", Field, 0},
+		{"Cookie.MaxAge", Field, 0},
+		{"Cookie.Name", Field, 0},
+		{"Cookie.Path", Field, 0},
+		{"Cookie.Raw", Field, 0},
+		{"Cookie.RawExpires", Field, 0},
+		{"Cookie.SameSite", Field, 11},
+		{"Cookie.Secure", Field, 0},
+		{"Cookie.Unparsed", Field, 0},
+		{"Cookie.Value", Field, 0},
+		{"CookieJar", Type, 0},
+		{"DefaultClient", Var, 0},
+		{"DefaultMaxHeaderBytes", Const, 0},
+		{"DefaultMaxIdleConnsPerHost", Const, 0},
+		{"DefaultServeMux", Var, 0},
+		{"DefaultTransport", Var, 0},
+		{"DetectContentType", Func, 0},
+		{"Dir", Type, 0},
+		{"ErrAbortHandler", Var, 8},
+		{"ErrBodyNotAllowed", Var, 0},
+		{"ErrBodyReadAfterClose", Var, 0},
+		{"ErrContentLength", Var, 0},
+		{"ErrHandlerTimeout", Var, 0},
+		{"ErrHeaderTooLong", Var, 0},
+		{"ErrHijacked", Var, 0},
+		{"ErrLineTooLong", Var, 0},
+		{"ErrMissingBoundary", Var, 0},
+		{"ErrMissingContentLength", Var, 0},
+		{"ErrMissingFile", Var, 0},
+		{"ErrNoCookie", Var, 0},
+		{"ErrNoLocation", Var, 0},
+		{"ErrNotMultipart", Var, 0},
+		{"ErrNotSupported", Var, 0},
+		{"ErrSchemeMismatch", Var, 21},
+		{"ErrServerClosed", Var, 8},
+		{"ErrShortBody", Var, 0},
+		{"ErrSkipAltProtocol", Var, 6},
+		{"ErrUnexpectedTrailer", Var, 0},
+		{"ErrUseLastResponse", Var, 7},
+		{"ErrWriteAfterFlush", Var, 0},
+		{"Error", Func, 0},
+		{"FS", Func, 16},
+		{"File", Type, 0},
+		{"FileServer", Func, 0},
+		{"FileServerFS", Func, 22},
+		{"FileSystem", Type, 0},
+		{"Flusher", Type, 0},
+		{"Get", Func, 0},
+		{"Handle", Func, 0},
+		{"HandleFunc", Func, 0},
+		{"Handler", Type, 0},
+		{"HandlerFunc", Type, 0},
+		{"Head", Func, 0},
+		{"Header", Type, 0},
+		{"Hijacker", Type, 0},
+		{"ListenAndServe", Func, 0},
+		{"ListenAndServeTLS", Func, 0},
+		{"LocalAddrContextKey", Var, 7},
+		{"MaxBytesError", Type, 19},
+		{"MaxBytesError.Limit", Field, 19},
+		{"MaxBytesHandler", Func, 18},
+		{"MaxBytesReader", Func, 0},
+		{"MethodConnect", Const, 6},
+		{"MethodDelete", Const, 6},
+		{"MethodGet", Const, 6},
+		{"MethodHead", Const, 6},
+		{"MethodOptions", Const, 6},
+		{"MethodPatch", Const, 6},
+		{"MethodPost", Const, 6},
+		{"MethodPut", Const, 6},
+		{"MethodTrace", Const, 6},
+		{"NewFileTransport", Func, 0},
+		{"NewFileTransportFS", Func, 22},
+		{"NewRequest", Func, 0},
+		{"NewRequestWithContext", Func, 13},
+		{"NewResponseController", Func, 20},
+		{"NewServeMux", Func, 0},
+		{"NoBody", Var, 8},
+		{"NotFound", Func, 0},
+		{"NotFoundHandler", Func, 0},
+		{"ParseHTTPVersion", Func, 0},
+		{"ParseTime", Func, 1},
+		{"Post", Func, 0},
+		{"PostForm", Func, 0},
+		{"ProtocolError", Type, 0},
+		{"ProtocolError.ErrorString", Field, 0},
+		{"ProxyFromEnvironment", Func, 0},
+		{"ProxyURL", Func, 0},
+		{"PushOptions", Type, 8},
+		{"PushOptions.Header", Field, 8},
+		{"PushOptions.Method", Field, 8},
+		{"Pusher", Type, 8},
+		{"ReadRequest", Func, 0},
+		{"ReadResponse", Func, 0},
+		{"Redirect", Func, 0},
+		{"RedirectHandler", Func, 0},
+		{"Request", Type, 0},
+		{"Request.Body", Field, 0},
+		{"Request.Cancel", Field, 5},
+		{"Request.Close", Field, 0},
+		{"Request.ContentLength", Field, 0},
+		{"Request.Form", Field, 0},
+		{"Request.GetBody", Field, 8},
+		{"Request.Header", Field, 0},
+		{"Request.Host", Field, 0},
+		{"Request.Method", Field, 0},
+		{"Request.MultipartForm", Field, 0},
+		{"Request.PostForm", Field, 1},
+		{"Request.Proto", Field, 0},
+		{"Request.ProtoMajor", Field, 0},
+		{"Request.ProtoMinor", Field, 0},
+		{"Request.RemoteAddr", Field, 0},
+		{"Request.RequestURI", Field, 0},
+		{"Request.Response", Field, 7},
+		{"Request.TLS", Field, 0},
+		{"Request.Trailer", Field, 0},
+		{"Request.TransferEncoding", Field, 0},
+		{"Request.URL", Field, 0},
+		{"Response", Type, 0},
+		{"Response.Body", Field, 0},
+		{"Response.Close", Field, 0},
+		{"Response.ContentLength", Field, 0},
+		{"Response.Header", Field, 0},
+		{"Response.Proto", Field, 0},
+		{"Response.ProtoMajor", Field, 0},
+		{"Response.ProtoMinor", Field, 0},
+		{"Response.Request", Field, 0},
+		{"Response.Status", Field, 0},
+		{"Response.StatusCode", Field, 0},
+		{"Response.TLS", Field, 3},
+		{"Response.Trailer", Field, 0},
+		{"Response.TransferEncoding", Field, 0},
+		{"Response.Uncompressed", Field, 7},
+		{"ResponseController", Type, 20},
+		{"ResponseWriter", Type, 0},
+		{"RoundTripper", Type, 0},
+		{"SameSite", Type, 11},
+		{"SameSiteDefaultMode", Const, 11},
+		{"SameSiteLaxMode", Const, 11},
+		{"SameSiteNoneMode", Const, 13},
+		{"SameSiteStrictMode", Const, 11},
+		{"Serve", Func, 0},
+		{"ServeContent", Func, 0},
+		{"ServeFile", Func, 0},
+		{"ServeFileFS", Func, 22},
+		{"ServeMux", Type, 0},
+		{"ServeTLS", Func, 9},
+		{"Server", Type, 0},
+		{"Server.Addr", Field, 0},
+		{"Server.BaseContext", Field, 13},
+		{"Server.ConnContext", Field, 13},
+		{"Server.ConnState", Field, 3},
+		{"Server.DisableGeneralOptionsHandler", Field, 20},
+		{"Server.ErrorLog", Field, 3},
+		{"Server.Handler", Field, 0},
+		{"Server.IdleTimeout", Field, 8},
+		{"Server.MaxHeaderBytes", Field, 0},
+		{"Server.ReadHeaderTimeout", Field, 8},
+		{"Server.ReadTimeout", Field, 0},
+		{"Server.TLSConfig", Field, 0},
+		{"Server.TLSNextProto", Field, 1},
+		{"Server.WriteTimeout", Field, 0},
+		{"ServerContextKey", Var, 7},
+		{"SetCookie", Func, 0},
+		{"StateActive", Const, 3},
+		{"StateClosed", Const, 3},
+		{"StateHijacked", Const, 3},
+		{"StateIdle", Const, 3},
+		{"StateNew", Const, 3},
+		{"StatusAccepted", Const, 0},
+		{"StatusAlreadyReported", Const, 7},
+		{"StatusBadGateway", Const, 0},
+		{"StatusBadRequest", Const, 0},
+		{"StatusConflict", Const, 0},
+		{"StatusContinue", Const, 0},
+		{"StatusCreated", Const, 0},
+		{"StatusEarlyHints", Const, 13},
+		{"StatusExpectationFailed", Const, 0},
+		{"StatusFailedDependency", Const, 7},
+		{"StatusForbidden", Const, 0},
+		{"StatusFound", Const, 0},
+		{"StatusGatewayTimeout", Const, 0},
+		{"StatusGone", Const, 0},
+		{"StatusHTTPVersionNotSupported", Const, 0},
+		{"StatusIMUsed", Const, 7},
+		{"StatusInsufficientStorage", Const, 7},
+		{"StatusInternalServerError", Const, 0},
+		{"StatusLengthRequired", Const, 0},
+		{"StatusLocked", Const, 7},
+		{"StatusLoopDetected", Const, 7},
+		{"StatusMethodNotAllowed", Const, 0},
+		{"StatusMisdirectedRequest", Const, 11},
+		{"StatusMovedPermanently", Const, 0},
+		{"StatusMultiStatus", Const, 7},
+		{"StatusMultipleChoices", Const, 0},
+		{"StatusNetworkAuthenticationRequired", Const, 6},
+		{"StatusNoContent", Const, 0},
+		{"StatusNonAuthoritativeInfo", Const, 0},
+		{"StatusNotAcceptable", Const, 0},
+		{"StatusNotExtended", Const, 7},
+		{"StatusNotFound", Const, 0},
+		{"StatusNotImplemented", Const, 0},
+		{"StatusNotModified", Const, 0},
+		{"StatusOK", Const, 0},
+		{"StatusPartialContent", Const, 0},
+		{"StatusPaymentRequired", Const, 0},
+		{"StatusPermanentRedirect", Const, 7},
+		{"StatusPreconditionFailed", Const, 0},
+		{"StatusPreconditionRequired", Const, 6},
+		{"StatusProcessing", Const, 7},
+		{"StatusProxyAuthRequired", Const, 0},
+		{"StatusRequestEntityTooLarge", Const, 0},
+		{"StatusRequestHeaderFieldsTooLarge", Const, 6},
+		{"StatusRequestTimeout", Const, 0},
+		{"StatusRequestURITooLong", Const, 0},
+		{"StatusRequestedRangeNotSatisfiable", Const, 0},
+		{"StatusResetContent", Const, 0},
+		{"StatusSeeOther", Const, 0},
+		{"StatusServiceUnavailable", Const, 0},
+		{"StatusSwitchingProtocols", Const, 0},
+		{"StatusTeapot", Const, 0},
+		{"StatusTemporaryRedirect", Const, 0},
+		{"StatusText", Func, 0},
+		{"StatusTooEarly", Const, 12},
+		{"StatusTooManyRequests", Const, 6},
+		{"StatusUnauthorized", Const, 0},
+		{"StatusUnavailableForLegalReasons", Const, 6},
+		{"StatusUnprocessableEntity", Const, 7},
+		{"StatusUnsupportedMediaType", Const, 0},
+		{"StatusUpgradeRequired", Const, 7},
+		{"StatusUseProxy", Const, 0},
+		{"StatusVariantAlsoNegotiates", Const, 7},
+		{"StripPrefix", Func, 0},
+		{"TimeFormat", Const, 0},
+		{"TimeoutHandler", Func, 0},
+		{"TrailerPrefix", Const, 8},
+		{"Transport", Type, 0},
+		{"Transport.Dial", Field, 0},
+		{"Transport.DialContext", Field, 7},
+		{"Transport.DialTLS", Field, 4},
+		{"Transport.DialTLSContext", Field, 14},
+		{"Transport.DisableCompression", Field, 0},
+		{"Transport.DisableKeepAlives", Field, 0},
+		{"Transport.ExpectContinueTimeout", Field, 6},
+		{"Transport.ForceAttemptHTTP2", Field, 13},
+		{"Transport.GetProxyConnectHeader", Field, 16},
+		{"Transport.IdleConnTimeout", Field, 7},
+		{"Transport.MaxConnsPerHost", Field, 11},
+		{"Transport.MaxIdleConns", Field, 7},
+		{"Transport.MaxIdleConnsPerHost", Field, 0},
+		{"Transport.MaxResponseHeaderBytes", Field, 7},
+		{"Transport.OnProxyConnectResponse", Field, 20},
+		{"Transport.Proxy", Field, 0},
+		{"Transport.ProxyConnectHeader", Field, 8},
+		{"Transport.ReadBufferSize", Field, 13},
+		{"Transport.ResponseHeaderTimeout", Field, 1},
+		{"Transport.TLSClientConfig", Field, 0},
+		{"Transport.TLSHandshakeTimeout", Field, 3},
+		{"Transport.TLSNextProto", Field, 6},
+		{"Transport.WriteBufferSize", Field, 13},
+	},
+	"net/http/cgi": {
+		{"(*Handler).ServeHTTP", Method, 0},
+		{"Handler", Type, 0},
+		{"Handler.Args", Field, 0},
+		{"Handler.Dir", Field, 0},
+		{"Handler.Env", Field, 0},
+		{"Handler.InheritEnv", Field, 0},
+		{"Handler.Logger", Field, 0},
+		{"Handler.Path", Field, 0},
+		{"Handler.PathLocationHandler", Field, 0},
+		{"Handler.Root", Field, 0},
+		{"Handler.Stderr", Field, 7},
+		{"Request", Func, 0},
+		{"RequestFromMap", Func, 0},
+		{"Serve", Func, 0},
+	},
+	"net/http/cookiejar": {
+		{"(*Jar).Cookies", Method, 1},
+		{"(*Jar).SetCookies", Method, 1},
+		{"Jar", Type, 1},
+		{"New", Func, 1},
+		{"Options", Type, 1},
+		{"Options.PublicSuffixList", Field, 1},
+		{"PublicSuffixList", Type, 1},
+	},
+	"net/http/fcgi": {
+		{"ErrConnClosed", Var, 5},
+		{"ErrRequestAborted", Var, 5},
+		{"ProcessEnv", Func, 9},
+		{"Serve", Func, 0},
+	},
+	"net/http/httptest": {
+		{"(*ResponseRecorder).Flush", Method, 0},
+		{"(*ResponseRecorder).Header", Method, 0},
+		{"(*ResponseRecorder).Result", Method, 7},
+		{"(*ResponseRecorder).Write", Method, 0},
+		{"(*ResponseRecorder).WriteHeader", Method, 0},
+		{"(*ResponseRecorder).WriteString", Method, 6},
+		{"(*Server).Certificate", Method, 9},
+		{"(*Server).Client", Method, 9},
+		{"(*Server).Close", Method, 0},
+		{"(*Server).CloseClientConnections", Method, 0},
+		{"(*Server).Start", Method, 0},
+		{"(*Server).StartTLS", Method, 0},
+		{"DefaultRemoteAddr", Const, 0},
+		{"NewRecorder", Func, 0},
+		{"NewRequest", Func, 7},
+		{"NewServer", Func, 0},
+		{"NewTLSServer", Func, 0},
+		{"NewUnstartedServer", Func, 0},
+		{"ResponseRecorder", Type, 0},
+		{"ResponseRecorder.Body", Field, 0},
+		{"ResponseRecorder.Code", Field, 0},
+		{"ResponseRecorder.Flushed", Field, 0},
+		{"ResponseRecorder.HeaderMap", Field, 0},
+		{"Server", Type, 0},
+		{"Server.Config", Field, 0},
+		{"Server.EnableHTTP2", Field, 14},
+		{"Server.Listener", Field, 0},
+		{"Server.TLS", Field, 0},
+		{"Server.URL", Field, 0},
+	},
+	"net/http/httptrace": {
+		{"ClientTrace", Type, 7},
+		{"ClientTrace.ConnectDone", Field, 7},
+		{"ClientTrace.ConnectStart", Field, 7},
+		{"ClientTrace.DNSDone", Field, 7},
+		{"ClientTrace.DNSStart", Field, 7},
+		{"ClientTrace.GetConn", Field, 7},
+		{"ClientTrace.Got100Continue", Field, 7},
+		{"ClientTrace.Got1xxResponse", Field, 11},
+		{"ClientTrace.GotConn", Field, 7},
+		{"ClientTrace.GotFirstResponseByte", Field, 7},
+		{"ClientTrace.PutIdleConn", Field, 7},
+		{"ClientTrace.TLSHandshakeDone", Field, 8},
+		{"ClientTrace.TLSHandshakeStart", Field, 8},
+		{"ClientTrace.Wait100Continue", Field, 7},
+		{"ClientTrace.WroteHeaderField", Field, 11},
+		{"ClientTrace.WroteHeaders", Field, 7},
+		{"ClientTrace.WroteRequest", Field, 7},
+		{"ContextClientTrace", Func, 7},
+		{"DNSDoneInfo", Type, 7},
+		{"DNSDoneInfo.Addrs", Field, 7},
+		{"DNSDoneInfo.Coalesced", Field, 7},
+		{"DNSDoneInfo.Err", Field, 7},
+		{"DNSStartInfo", Type, 7},
+		{"DNSStartInfo.Host", Field, 7},
+		{"GotConnInfo", Type, 7},
+		{"GotConnInfo.Conn", Field, 7},
+		{"GotConnInfo.IdleTime", Field, 7},
+		{"GotConnInfo.Reused", Field, 7},
+		{"GotConnInfo.WasIdle", Field, 7},
+		{"WithClientTrace", Func, 7},
+		{"WroteRequestInfo", Type, 7},
+		{"WroteRequestInfo.Err", Field, 7},
+	},
+	"net/http/httputil": {
+		{"(*ClientConn).Close", Method, 0},
+		{"(*ClientConn).Do", Method, 0},
+		{"(*ClientConn).Hijack", Method, 0},
+		{"(*ClientConn).Pending", Method, 0},
+		{"(*ClientConn).Read", Method, 0},
+		{"(*ClientConn).Write", Method, 0},
+		{"(*ProxyRequest).SetURL", Method, 20},
+		{"(*ProxyRequest).SetXForwarded", Method, 20},
+		{"(*ReverseProxy).ServeHTTP", Method, 0},
+		{"(*ServerConn).Close", Method, 0},
+		{"(*ServerConn).Hijack", Method, 0},
+		{"(*ServerConn).Pending", Method, 0},
+		{"(*ServerConn).Read", Method, 0},
+		{"(*ServerConn).Write", Method, 0},
+		{"BufferPool", Type, 6},
+		{"ClientConn", Type, 0},
+		{"DumpRequest", Func, 0},
+		{"DumpRequestOut", Func, 0},
+		{"DumpResponse", Func, 0},
+		{"ErrClosed", Var, 0},
+		{"ErrLineTooLong", Var, 0},
+		{"ErrPersistEOF", Var, 0},
+		{"ErrPipeline", Var, 0},
+		{"NewChunkedReader", Func, 0},
+		{"NewChunkedWriter", Func, 0},
+		{"NewClientConn", Func, 0},
+		{"NewProxyClientConn", Func, 0},
+		{"NewServerConn", Func, 0},
+		{"NewSingleHostReverseProxy", Func, 0},
+		{"ProxyRequest", Type, 20},
+		{"ProxyRequest.In", Field, 20},
+		{"ProxyRequest.Out", Field, 20},
+		{"ReverseProxy", Type, 0},
+		{"ReverseProxy.BufferPool", Field, 6},
+		{"ReverseProxy.Director", Field, 0},
+		{"ReverseProxy.ErrorHandler", Field, 11},
+		{"ReverseProxy.ErrorLog", Field, 4},
+		{"ReverseProxy.FlushInterval", Field, 0},
+		{"ReverseProxy.ModifyResponse", Field, 8},
+		{"ReverseProxy.Rewrite", Field, 20},
+		{"ReverseProxy.Transport", Field, 0},
+		{"ServerConn", Type, 0},
+	},
+	"net/http/pprof": {
+		{"Cmdline", Func, 0},
+		{"Handler", Func, 0},
+		{"Index", Func, 0},
+		{"Profile", Func, 0},
+		{"Symbol", Func, 0},
+		{"Trace", Func, 5},
+	},
+	"net/mail": {
+		{"(*Address).String", Method, 0},
+		{"(*AddressParser).Parse", Method, 5},
+		{"(*AddressParser).ParseList", Method, 5},
+		{"(Header).AddressList", Method, 0},
+		{"(Header).Date", Method, 0},
+		{"(Header).Get", Method, 0},
+		{"Address", Type, 0},
+		{"Address.Address", Field, 0},
+		{"Address.Name", Field, 0},
+		{"AddressParser", Type, 5},
+		{"AddressParser.WordDecoder", Field, 5},
+		{"ErrHeaderNotPresent", Var, 0},
+		{"Header", Type, 0},
+		{"Message", Type, 0},
+		{"Message.Body", Field, 0},
+		{"Message.Header", Field, 0},
+		{"ParseAddress", Func, 1},
+		{"ParseAddressList", Func, 1},
+		{"ParseDate", Func, 8},
+		{"ReadMessage", Func, 0},
+	},
+	"net/netip": {
+		{"(*Addr).UnmarshalBinary", Method, 18},
+		{"(*Addr).UnmarshalText", Method, 18},
+		{"(*AddrPort).UnmarshalBinary", Method, 18},
+		{"(*AddrPort).UnmarshalText", Method, 18},
+		{"(*Prefix).UnmarshalBinary", Method, 18},
+		{"(*Prefix).UnmarshalText", Method, 18},
+		{"(Addr).AppendTo", Method, 18},
+		{"(Addr).As16", Method, 18},
+		{"(Addr).As4", Method, 18},
+		{"(Addr).AsSlice", Method, 18},
+		{"(Addr).BitLen", Method, 18},
+		{"(Addr).Compare", Method, 18},
+		{"(Addr).Is4", Method, 18},
+		{"(Addr).Is4In6", Method, 18},
+		{"(Addr).Is6", Method, 18},
+		{"(Addr).IsGlobalUnicast", Method, 18},
+		{"(Addr).IsInterfaceLocalMulticast", Method, 18},
+		{"(Addr).IsLinkLocalMulticast", Method, 18},
+		{"(Addr).IsLinkLocalUnicast", Method, 18},
+		{"(Addr).IsLoopback", Method, 18},
+		{"(Addr).IsMulticast", Method, 18},
+		{"(Addr).IsPrivate", Method, 18},
+		{"(Addr).IsUnspecified", Method, 18},
+		{"(Addr).IsValid", Method, 18},
+		{"(Addr).Less", Method, 18},
+		{"(Addr).MarshalBinary", Method, 18},
+		{"(Addr).MarshalText", Method, 18},
+		{"(Addr).Next", Method, 18},
+		{"(Addr).Prefix", Method, 18},
+		{"(Addr).Prev", Method, 18},
+		{"(Addr).String", Method, 18},
+		{"(Addr).StringExpanded", Method, 18},
+		{"(Addr).Unmap", Method, 18},
+		{"(Addr).WithZone", Method, 18},
+		{"(Addr).Zone", Method, 18},
+		{"(AddrPort).Addr", Method, 18},
+		{"(AddrPort).AppendTo", Method, 18},
+		{"(AddrPort).Compare", Method, 22},
+		{"(AddrPort).IsValid", Method, 18},
+		{"(AddrPort).MarshalBinary", Method, 18},
+		{"(AddrPort).MarshalText", Method, 18},
+		{"(AddrPort).Port", Method, 18},
+		{"(AddrPort).String", Method, 18},
+		{"(Prefix).Addr", Method, 18},
+		{"(Prefix).AppendTo", Method, 18},
+		{"(Prefix).Bits", Method, 18},
+		{"(Prefix).Contains", Method, 18},
+		{"(Prefix).IsSingleIP", Method, 18},
+		{"(Prefix).IsValid", Method, 18},
+		{"(Prefix).MarshalBinary", Method, 18},
+		{"(Prefix).MarshalText", Method, 18},
+		{"(Prefix).Masked", Method, 18},
+		{"(Prefix).Overlaps", Method, 18},
+		{"(Prefix).String", Method, 18},
+		{"Addr", Type, 18},
+		{"AddrFrom16", Func, 18},
+		{"AddrFrom4", Func, 18},
+		{"AddrFromSlice", Func, 18},
+		{"AddrPort", Type, 18},
+		{"AddrPortFrom", Func, 18},
+		{"IPv4Unspecified", Func, 18},
+		{"IPv6LinkLocalAllNodes", Func, 18},
+		{"IPv6LinkLocalAllRouters", Func, 20},
+		{"IPv6Loopback", Func, 20},
+		{"IPv6Unspecified", Func, 18},
+		{"MustParseAddr", Func, 18},
+		{"MustParseAddrPort", Func, 18},
+		{"MustParsePrefix", Func, 18},
+		{"ParseAddr", Func, 18},
+		{"ParseAddrPort", Func, 18},
+		{"ParsePrefix", Func, 18},
+		{"Prefix", Type, 18},
+		{"PrefixFrom", Func, 18},
+	},
+	"net/rpc": {
+		{"(*Client).Call", Method, 0},
+		{"(*Client).Close", Method, 0},
+		{"(*Client).Go", Method, 0},
+		{"(*Server).Accept", Method, 0},
+		{"(*Server).HandleHTTP", Method, 0},
+		{"(*Server).Register", Method, 0},
+		{"(*Server).RegisterName", Method, 0},
+		{"(*Server).ServeCodec", Method, 0},
+		{"(*Server).ServeConn", Method, 0},
+		{"(*Server).ServeHTTP", Method, 0},
+		{"(*Server).ServeRequest", Method, 0},
+		{"(ServerError).Error", Method, 0},
+		{"Accept", Func, 0},
+		{"Call", Type, 0},
+		{"Call.Args", Field, 0},
+		{"Call.Done", Field, 0},
+		{"Call.Error", Field, 0},
+		{"Call.Reply", Field, 0},
+		{"Call.ServiceMethod", Field, 0},
+		{"Client", Type, 0},
+		{"ClientCodec", Type, 0},
+		{"DefaultDebugPath", Const, 0},
+		{"DefaultRPCPath", Const, 0},
+		{"DefaultServer", Var, 0},
+		{"Dial", Func, 0},
+		{"DialHTTP", Func, 0},
+		{"DialHTTPPath", Func, 0},
+		{"ErrShutdown", Var, 0},
+		{"HandleHTTP", Func, 0},
+		{"NewClient", Func, 0},
+		{"NewClientWithCodec", Func, 0},
+		{"NewServer", Func, 0},
+		{"Register", Func, 0},
+		{"RegisterName", Func, 0},
+		{"Request", Type, 0},
+		{"Request.Seq", Field, 0},
+		{"Request.ServiceMethod", Field, 0},
+		{"Response", Type, 0},
+		{"Response.Error", Field, 0},
+		{"Response.Seq", Field, 0},
+		{"Response.ServiceMethod", Field, 0},
+		{"ServeCodec", Func, 0},
+		{"ServeConn", Func, 0},
+		{"ServeRequest", Func, 0},
+		{"Server", Type, 0},
+		{"ServerCodec", Type, 0},
+		{"ServerError", Type, 0},
+	},
+	"net/rpc/jsonrpc": {
+		{"Dial", Func, 0},
+		{"NewClient", Func, 0},
+		{"NewClientCodec", Func, 0},
+		{"NewServerCodec", Func, 0},
+		{"ServeConn", Func, 0},
+	},
+	"net/smtp": {
+		{"(*Client).Auth", Method, 0},
+		{"(*Client).Close", Method, 2},
+		{"(*Client).Data", Method, 0},
+		{"(*Client).Extension", Method, 0},
+		{"(*Client).Hello", Method, 1},
+		{"(*Client).Mail", Method, 0},
+		{"(*Client).Noop", Method, 10},
+		{"(*Client).Quit", Method, 0},
+		{"(*Client).Rcpt", Method, 0},
+		{"(*Client).Reset", Method, 0},
+		{"(*Client).StartTLS", Method, 0},
+		{"(*Client).TLSConnectionState", Method, 5},
+		{"(*Client).Verify", Method, 0},
+		{"Auth", Type, 0},
+		{"CRAMMD5Auth", Func, 0},
+		{"Client", Type, 0},
+		{"Client.Text", Field, 0},
+		{"Dial", Func, 0},
+		{"NewClient", Func, 0},
+		{"PlainAuth", Func, 0},
+		{"SendMail", Func, 0},
+		{"ServerInfo", Type, 0},
+		{"ServerInfo.Auth", Field, 0},
+		{"ServerInfo.Name", Field, 0},
+		{"ServerInfo.TLS", Field, 0},
+	},
+	"net/textproto": {
+		{"(*Conn).Close", Method, 0},
+		{"(*Conn).Cmd", Method, 0},
+		{"(*Conn).DotReader", Method, 0},
+		{"(*Conn).DotWriter", Method, 0},
+		{"(*Conn).EndRequest", Method, 0},
+		{"(*Conn).EndResponse", Method, 0},
+		{"(*Conn).Next", Method, 0},
+		{"(*Conn).PrintfLine", Method, 0},
+		{"(*Conn).ReadCodeLine", Method, 0},
+		{"(*Conn).ReadContinuedLine", Method, 0},
+		{"(*Conn).ReadContinuedLineBytes", Method, 0},
+		{"(*Conn).ReadDotBytes", Method, 0},
+		{"(*Conn).ReadDotLines", Method, 0},
+		{"(*Conn).ReadLine", Method, 0},
+		{"(*Conn).ReadLineBytes", Method, 0},
+		{"(*Conn).ReadMIMEHeader", Method, 0},
+		{"(*Conn).ReadResponse", Method, 0},
+		{"(*Conn).StartRequest", Method, 0},
+		{"(*Conn).StartResponse", Method, 0},
+		{"(*Error).Error", Method, 0},
+		{"(*Pipeline).EndRequest", Method, 0},
+		{"(*Pipeline).EndResponse", Method, 0},
+		{"(*Pipeline).Next", Method, 0},
+		{"(*Pipeline).StartRequest", Method, 0},
+		{"(*Pipeline).StartResponse", Method, 0},
+		{"(*Reader).DotReader", Method, 0},
+		{"(*Reader).ReadCodeLine", Method, 0},
+		{"(*Reader).ReadContinuedLine", Method, 0},
+		{"(*Reader).ReadContinuedLineBytes", Method, 0},
+		{"(*Reader).ReadDotBytes", Method, 0},
+		{"(*Reader).ReadDotLines", Method, 0},
+		{"(*Reader).ReadLine", Method, 0},
+		{"(*Reader).ReadLineBytes", Method, 0},
+		{"(*Reader).ReadMIMEHeader", Method, 0},
+		{"(*Reader).ReadResponse", Method, 0},
+		{"(*Writer).DotWriter", Method, 0},
+		{"(*Writer).PrintfLine", Method, 0},
+		{"(MIMEHeader).Add", Method, 0},
+		{"(MIMEHeader).Del", Method, 0},
+		{"(MIMEHeader).Get", Method, 0},
+		{"(MIMEHeader).Set", Method, 0},
+		{"(MIMEHeader).Values", Method, 14},
+		{"(ProtocolError).Error", Method, 0},
+		{"CanonicalMIMEHeaderKey", Func, 0},
+		{"Conn", Type, 0},
+		{"Conn.Pipeline", Field, 0},
+		{"Conn.Reader", Field, 0},
+		{"Conn.Writer", Field, 0},
+		{"Dial", Func, 0},
+		{"Error", Type, 0},
+		{"Error.Code", Field, 0},
+		{"Error.Msg", Field, 0},
+		{"MIMEHeader", Type, 0},
+		{"NewConn", Func, 0},
+		{"NewReader", Func, 0},
+		{"NewWriter", Func, 0},
+		{"Pipeline", Type, 0},
+		{"ProtocolError", Type, 0},
+		{"Reader", Type, 0},
+		{"Reader.R", Field, 0},
+		{"TrimBytes", Func, 1},
+		{"TrimString", Func, 1},
+		{"Writer", Type, 0},
+		{"Writer.W", Field, 0},
+	},
+	"net/url": {
+		{"(*Error).Error", Method, 0},
+		{"(*Error).Temporary", Method, 6},
+		{"(*Error).Timeout", Method, 6},
+		{"(*Error).Unwrap", Method, 13},
+		{"(*URL).EscapedFragment", Method, 15},
+		{"(*URL).EscapedPath", Method, 5},
+		{"(*URL).Hostname", Method, 8},
+		{"(*URL).IsAbs", Method, 0},
+		{"(*URL).JoinPath", Method, 19},
+		{"(*URL).MarshalBinary", Method, 8},
+		{"(*URL).Parse", Method, 0},
+		{"(*URL).Port", Method, 8},
+		{"(*URL).Query", Method, 0},
+		{"(*URL).Redacted", Method, 15},
+		{"(*URL).RequestURI", Method, 0},
+		{"(*URL).ResolveReference", Method, 0},
+		{"(*URL).String", Method, 0},
+		{"(*URL).UnmarshalBinary", Method, 8},
+		{"(*Userinfo).Password", Method, 0},
+		{"(*Userinfo).String", Method, 0},
+		{"(*Userinfo).Username", Method, 0},
+		{"(EscapeError).Error", Method, 0},
+		{"(InvalidHostError).Error", Method, 6},
+		{"(Values).Add", Method, 0},
+		{"(Values).Del", Method, 0},
+		{"(Values).Encode", Method, 0},
+		{"(Values).Get", Method, 0},
+		{"(Values).Has", Method, 17},
+		{"(Values).Set", Method, 0},
+		{"Error", Type, 0},
+		{"Error.Err", Field, 0},
+		{"Error.Op", Field, 0},
+		{"Error.URL", Field, 0},
+		{"EscapeError", Type, 0},
+		{"InvalidHostError", Type, 6},
+		{"JoinPath", Func, 19},
+		{"Parse", Func, 0},
+		{"ParseQuery", Func, 0},
+		{"ParseRequestURI", Func, 0},
+		{"PathEscape", Func, 8},
+		{"PathUnescape", Func, 8},
+		{"QueryEscape", Func, 0},
+		{"QueryUnescape", Func, 0},
+		{"URL", Type, 0},
+		{"URL.ForceQuery", Field, 7},
+		{"URL.Fragment", Field, 0},
+		{"URL.Host", Field, 0},
+		{"URL.OmitHost", Field, 19},
+		{"URL.Opaque", Field, 0},
+		{"URL.Path", Field, 0},
+		{"URL.RawFragment", Field, 15},
+		{"URL.RawPath", Field, 5},
+		{"URL.RawQuery", Field, 0},
+		{"URL.Scheme", Field, 0},
+		{"URL.User", Field, 0},
+		{"User", Func, 0},
+		{"UserPassword", Func, 0},
+		{"Userinfo", Type, 0},
+		{"Values", Type, 0},
+	},
+	"os": {
+		{"(*File).Chdir", Method, 0},
+		{"(*File).Chmod", Method, 0},
+		{"(*File).Chown", Method, 0},
+		{"(*File).Close", Method, 0},
+		{"(*File).Fd", Method, 0},
+		{"(*File).Name", Method, 0},
+		{"(*File).Read", Method, 0},
+		{"(*File).ReadAt", Method, 0},
+		{"(*File).ReadDir", Method, 16},
+		{"(*File).ReadFrom", Method, 15},
+		{"(*File).Readdir", Method, 0},
+		{"(*File).Readdirnames", Method, 0},
+		{"(*File).Seek", Method, 0},
+		{"(*File).SetDeadline", Method, 10},
+		{"(*File).SetReadDeadline", Method, 10},
+		{"(*File).SetWriteDeadline", Method, 10},
+		{"(*File).Stat", Method, 0},
+		{"(*File).Sync", Method, 0},
+		{"(*File).SyscallConn", Method, 12},
+		{"(*File).Truncate", Method, 0},
+		{"(*File).Write", Method, 0},
+		{"(*File).WriteAt", Method, 0},
+		{"(*File).WriteString", Method, 0},
+		{"(*File).WriteTo", Method, 22},
+		{"(*LinkError).Error", Method, 0},
+		{"(*LinkError).Unwrap", Method, 13},
+		{"(*PathError).Error", Method, 0},
+		{"(*PathError).Timeout", Method, 10},
+		{"(*PathError).Unwrap", Method, 13},
+		{"(*Process).Kill", Method, 0},
+		{"(*Process).Release", Method, 0},
+		{"(*Process).Signal", Method, 0},
+		{"(*Process).Wait", Method, 0},
+		{"(*ProcessState).ExitCode", Method, 12},
+		{"(*ProcessState).Exited", Method, 0},
+		{"(*ProcessState).Pid", Method, 0},
+		{"(*ProcessState).String", Method, 0},
+		{"(*ProcessState).Success", Method, 0},
+		{"(*ProcessState).Sys", Method, 0},
+		{"(*ProcessState).SysUsage", Method, 0},
+		{"(*ProcessState).SystemTime", Method, 0},
+		{"(*ProcessState).UserTime", Method, 0},
+		{"(*SyscallError).Error", Method, 0},
+		{"(*SyscallError).Timeout", Method, 10},
+		{"(*SyscallError).Unwrap", Method, 13},
+		{"(FileMode).IsDir", Method, 0},
+		{"(FileMode).IsRegular", Method, 1},
+		{"(FileMode).Perm", Method, 0},
+		{"(FileMode).String", Method, 0},
+		{"Args", Var, 0},
+		{"Chdir", Func, 0},
+		{"Chmod", Func, 0},
+		{"Chown", Func, 0},
+		{"Chtimes", Func, 0},
+		{"Clearenv", Func, 0},
+		{"Create", Func, 0},
+		{"CreateTemp", Func, 16},
+		{"DevNull", Const, 0},
+		{"DirEntry", Type, 16},
+		{"DirFS", Func, 16},
+		{"Environ", Func, 0},
+		{"ErrClosed", Var, 8},
+		{"ErrDeadlineExceeded", Var, 15},
+		{"ErrExist", Var, 0},
+		{"ErrInvalid", Var, 0},
+		{"ErrNoDeadline", Var, 10},
+		{"ErrNotExist", Var, 0},
+		{"ErrPermission", Var, 0},
+		{"ErrProcessDone", Var, 16},
+		{"Executable", Func, 8},
+		{"Exit", Func, 0},
+		{"Expand", Func, 0},
+		{"ExpandEnv", Func, 0},
+		{"File", Type, 0},
+		{"FileInfo", Type, 0},
+		{"FileMode", Type, 0},
+		{"FindProcess", Func, 0},
+		{"Getegid", Func, 0},
+		{"Getenv", Func, 0},
+		{"Geteuid", Func, 0},
+		{"Getgid", Func, 0},
+		{"Getgroups", Func, 0},
+		{"Getpagesize", Func, 0},
+		{"Getpid", Func, 0},
+		{"Getppid", Func, 0},
+		{"Getuid", Func, 0},
+		{"Getwd", Func, 0},
+		{"Hostname", Func, 0},
+		{"Interrupt", Var, 0},
+		{"IsExist", Func, 0},
+		{"IsNotExist", Func, 0},
+		{"IsPathSeparator", Func, 0},
+		{"IsPermission", Func, 0},
+		{"IsTimeout", Func, 10},
+		{"Kill", Var, 0},
+		{"Lchown", Func, 0},
+		{"Link", Func, 0},
+		{"LinkError", Type, 0},
+		{"LinkError.Err", Field, 0},
+		{"LinkError.New", Field, 0},
+		{"LinkError.Old", Field, 0},
+		{"LinkError.Op", Field, 0},
+		{"LookupEnv", Func, 5},
+		{"Lstat", Func, 0},
+		{"Mkdir", Func, 0},
+		{"MkdirAll", Func, 0},
+		{"MkdirTemp", Func, 16},
+		{"ModeAppend", Const, 0},
+		{"ModeCharDevice", Const, 0},
+		{"ModeDevice", Const, 0},
+		{"ModeDir", Const, 0},
+		{"ModeExclusive", Const, 0},
+		{"ModeIrregular", Const, 11},
+		{"ModeNamedPipe", Const, 0},
+		{"ModePerm", Const, 0},
+		{"ModeSetgid", Const, 0},
+		{"ModeSetuid", Const, 0},
+		{"ModeSocket", Const, 0},
+		{"ModeSticky", Const, 0},
+		{"ModeSymlink", Const, 0},
+		{"ModeTemporary", Const, 0},
+		{"ModeType", Const, 0},
+		{"NewFile", Func, 0},
+		{"NewSyscallError", Func, 0},
+		{"O_APPEND", Const, 0},
+		{"O_CREATE", Const, 0},
+		{"O_EXCL", Const, 0},
+		{"O_RDONLY", Const, 0},
+		{"O_RDWR", Const, 0},
+		{"O_SYNC", Const, 0},
+		{"O_TRUNC", Const, 0},
+		{"O_WRONLY", Const, 0},
+		{"Open", Func, 0},
+		{"OpenFile", Func, 0},
+		{"PathError", Type, 0},
+		{"PathError.Err", Field, 0},
+		{"PathError.Op", Field, 0},
+		{"PathError.Path", Field, 0},
+		{"PathListSeparator", Const, 0},
+		{"PathSeparator", Const, 0},
+		{"Pipe", Func, 0},
+		{"ProcAttr", Type, 0},
+		{"ProcAttr.Dir", Field, 0},
+		{"ProcAttr.Env", Field, 0},
+		{"ProcAttr.Files", Field, 0},
+		{"ProcAttr.Sys", Field, 0},
+		{"Process", Type, 0},
+		{"Process.Pid", Field, 0},
+		{"ProcessState", Type, 0},
+		{"ReadDir", Func, 16},
+		{"ReadFile", Func, 16},
+		{"Readlink", Func, 0},
+		{"Remove", Func, 0},
+		{"RemoveAll", Func, 0},
+		{"Rename", Func, 0},
+		{"SEEK_CUR", Const, 0},
+		{"SEEK_END", Const, 0},
+		{"SEEK_SET", Const, 0},
+		{"SameFile", Func, 0},
+		{"Setenv", Func, 0},
+		{"Signal", Type, 0},
+		{"StartProcess", Func, 0},
+		{"Stat", Func, 0},
+		{"Stderr", Var, 0},
+		{"Stdin", Var, 0},
+		{"Stdout", Var, 0},
+		{"Symlink", Func, 0},
+		{"SyscallError", Type, 0},
+		{"SyscallError.Err", Field, 0},
+		{"SyscallError.Syscall", Field, 0},
+		{"TempDir", Func, 0},
+		{"Truncate", Func, 0},
+		{"Unsetenv", Func, 4},
+		{"UserCacheDir", Func, 11},
+		{"UserConfigDir", Func, 13},
+		{"UserHomeDir", Func, 12},
+		{"WriteFile", Func, 16},
+	},
+	"os/exec": {
+		{"(*Cmd).CombinedOutput", Method, 0},
+		{"(*Cmd).Environ", Method, 19},
+		{"(*Cmd).Output", Method, 0},
+		{"(*Cmd).Run", Method, 0},
+		{"(*Cmd).Start", Method, 0},
+		{"(*Cmd).StderrPipe", Method, 0},
+		{"(*Cmd).StdinPipe", Method, 0},
+		{"(*Cmd).StdoutPipe", Method, 0},
+		{"(*Cmd).String", Method, 13},
+		{"(*Cmd).Wait", Method, 0},
+		{"(*Error).Error", Method, 0},
+		{"(*Error).Unwrap", Method, 13},
+		{"(*ExitError).Error", Method, 0},
+		{"(ExitError).ExitCode", Method, 12},
+		{"(ExitError).Exited", Method, 0},
+		{"(ExitError).Pid", Method, 0},
+		{"(ExitError).String", Method, 0},
+		{"(ExitError).Success", Method, 0},
+		{"(ExitError).Sys", Method, 0},
+		{"(ExitError).SysUsage", Method, 0},
+		{"(ExitError).SystemTime", Method, 0},
+		{"(ExitError).UserTime", Method, 0},
+		{"Cmd", Type, 0},
+		{"Cmd.Args", Field, 0},
+		{"Cmd.Cancel", Field, 20},
+		{"Cmd.Dir", Field, 0},
+		{"Cmd.Env", Field, 0},
+		{"Cmd.Err", Field, 19},
+		{"Cmd.ExtraFiles", Field, 0},
+		{"Cmd.Path", Field, 0},
+		{"Cmd.Process", Field, 0},
+		{"Cmd.ProcessState", Field, 0},
+		{"Cmd.Stderr", Field, 0},
+		{"Cmd.Stdin", Field, 0},
+		{"Cmd.Stdout", Field, 0},
+		{"Cmd.SysProcAttr", Field, 0},
+		{"Cmd.WaitDelay", Field, 20},
+		{"Command", Func, 0},
+		{"CommandContext", Func, 7},
+		{"ErrDot", Var, 19},
+		{"ErrNotFound", Var, 0},
+		{"ErrWaitDelay", Var, 20},
+		{"Error", Type, 0},
+		{"Error.Err", Field, 0},
+		{"Error.Name", Field, 0},
+		{"ExitError", Type, 0},
+		{"ExitError.ProcessState", Field, 0},
+		{"ExitError.Stderr", Field, 6},
+		{"LookPath", Func, 0},
+	},
+	"os/signal": {
+		{"Ignore", Func, 5},
+		{"Ignored", Func, 11},
+		{"Notify", Func, 0},
+		{"NotifyContext", Func, 16},
+		{"Reset", Func, 5},
+		{"Stop", Func, 1},
+	},
+	"os/user": {
+		{"(*User).GroupIds", Method, 7},
+		{"(UnknownGroupError).Error", Method, 7},
+		{"(UnknownGroupIdError).Error", Method, 7},
+		{"(UnknownUserError).Error", Method, 0},
+		{"(UnknownUserIdError).Error", Method, 0},
+		{"Current", Func, 0},
+		{"Group", Type, 7},
+		{"Group.Gid", Field, 7},
+		{"Group.Name", Field, 7},
+		{"Lookup", Func, 0},
+		{"LookupGroup", Func, 7},
+		{"LookupGroupId", Func, 7},
+		{"LookupId", Func, 0},
+		{"UnknownGroupError", Type, 7},
+		{"UnknownGroupIdError", Type, 7},
+		{"UnknownUserError", Type, 0},
+		{"UnknownUserIdError", Type, 0},
+		{"User", Type, 0},
+		{"User.Gid", Field, 0},
+		{"User.HomeDir", Field, 0},
+		{"User.Name", Field, 0},
+		{"User.Uid", Field, 0},
+		{"User.Username", Field, 0},
+	},
+	"path": {
+		{"Base", Func, 0},
+		{"Clean", Func, 0},
+		{"Dir", Func, 0},
+		{"ErrBadPattern", Var, 0},
+		{"Ext", Func, 0},
+		{"IsAbs", Func, 0},
+		{"Join", Func, 0},
+		{"Match", Func, 0},
+		{"Split", Func, 0},
+	},
+	"path/filepath": {
+		{"Abs", Func, 0},
+		{"Base", Func, 0},
+		{"Clean", Func, 0},
+		{"Dir", Func, 0},
+		{"ErrBadPattern", Var, 0},
+		{"EvalSymlinks", Func, 0},
+		{"Ext", Func, 0},
+		{"FromSlash", Func, 0},
+		{"Glob", Func, 0},
+		{"HasPrefix", Func, 0},
+		{"IsAbs", Func, 0},
+		{"IsLocal", Func, 20},
+		{"Join", Func, 0},
+		{"ListSeparator", Const, 0},
+		{"Match", Func, 0},
+		{"Rel", Func, 0},
+		{"Separator", Const, 0},
+		{"SkipAll", Var, 20},
+		{"SkipDir", Var, 0},
+		{"Split", Func, 0},
+		{"SplitList", Func, 0},
+		{"ToSlash", Func, 0},
+		{"VolumeName", Func, 0},
+		{"Walk", Func, 0},
+		{"WalkDir", Func, 16},
+		{"WalkFunc", Type, 0},
+	},
+	"plugin": {
+		{"(*Plugin).Lookup", Method, 8},
+		{"Open", Func, 8},
+		{"Plugin", Type, 8},
+		{"Symbol", Type, 8},
+	},
+	"reflect": {
+		{"(*MapIter).Key", Method, 12},
+		{"(*MapIter).Next", Method, 12},
+		{"(*MapIter).Reset", Method, 18},
+		{"(*MapIter).Value", Method, 12},
+		{"(*ValueError).Error", Method, 0},
+		{"(ChanDir).String", Method, 0},
+		{"(Kind).String", Method, 0},
+		{"(Method).IsExported", Method, 17},
+		{"(StructField).IsExported", Method, 17},
+		{"(StructTag).Get", Method, 0},
+		{"(StructTag).Lookup", Method, 7},
+		{"(Value).Addr", Method, 0},
+		{"(Value).Bool", Method, 0},
+		{"(Value).Bytes", Method, 0},
+		{"(Value).Call", Method, 0},
+		{"(Value).CallSlice", Method, 0},
+		{"(Value).CanAddr", Method, 0},
+		{"(Value).CanComplex", Method, 18},
+		{"(Value).CanConvert", Method, 17},
+		{"(Value).CanFloat", Method, 18},
+		{"(Value).CanInt", Method, 18},
+		{"(Value).CanInterface", Method, 0},
+		{"(Value).CanSet", Method, 0},
+		{"(Value).CanUint", Method, 18},
+		{"(Value).Cap", Method, 0},
+		{"(Value).Clear", Method, 21},
+		{"(Value).Close", Method, 0},
+		{"(Value).Comparable", Method, 20},
+		{"(Value).Complex", Method, 0},
+		{"(Value).Convert", Method, 1},
+		{"(Value).Elem", Method, 0},
+		{"(Value).Equal", Method, 20},
+		{"(Value).Field", Method, 0},
+		{"(Value).FieldByIndex", Method, 0},
+		{"(Value).FieldByIndexErr", Method, 18},
+		{"(Value).FieldByName", Method, 0},
+		{"(Value).FieldByNameFunc", Method, 0},
+		{"(Value).Float", Method, 0},
+		{"(Value).Grow", Method, 20},
+		{"(Value).Index", Method, 0},
+		{"(Value).Int", Method, 0},
+		{"(Value).Interface", Method, 0},
+		{"(Value).InterfaceData", Method, 0},
+		{"(Value).IsNil", Method, 0},
+		{"(Value).IsValid", Method, 0},
+		{"(Value).IsZero", Method, 13},
+		{"(Value).Kind", Method, 0},
+		{"(Value).Len", Method, 0},
+		{"(Value).MapIndex", Method, 0},
+		{"(Value).MapKeys", Method, 0},
+		{"(Value).MapRange", Method, 12},
+		{"(Value).Method", Method, 0},
+		{"(Value).MethodByName", Method, 0},
+		{"(Value).NumField", Method, 0},
+		{"(Value).NumMethod", Method, 0},
+		{"(Value).OverflowComplex", Method, 0},
+		{"(Value).OverflowFloat", Method, 0},
+		{"(Value).OverflowInt", Method, 0},
+		{"(Value).OverflowUint", Method, 0},
+		{"(Value).Pointer", Method, 0},
+		{"(Value).Recv", Method, 0},
+		{"(Value).Send", Method, 0},
+		{"(Value).Set", Method, 0},
+		{"(Value).SetBool", Method, 0},
+		{"(Value).SetBytes", Method, 0},
+		{"(Value).SetCap", Method, 2},
+		{"(Value).SetComplex", Method, 0},
+		{"(Value).SetFloat", Method, 0},
+		{"(Value).SetInt", Method, 0},
+		{"(Value).SetIterKey", Method, 18},
+		{"(Value).SetIterValue", Method, 18},
+		{"(Value).SetLen", Method, 0},
+		{"(Value).SetMapIndex", Method, 0},
+		{"(Value).SetPointer", Method, 0},
+		{"(Value).SetString", Method, 0},
+		{"(Value).SetUint", Method, 0},
+		{"(Value).SetZero", Method, 20},
+		{"(Value).Slice", Method, 0},
+		{"(Value).Slice3", Method, 2},
+		{"(Value).String", Method, 0},
+		{"(Value).TryRecv", Method, 0},
+		{"(Value).TrySend", Method, 0},
+		{"(Value).Type", Method, 0},
+		{"(Value).Uint", Method, 0},
+		{"(Value).UnsafeAddr", Method, 0},
+		{"(Value).UnsafePointer", Method, 18},
+		{"Append", Func, 0},
+		{"AppendSlice", Func, 0},
+		{"Array", Const, 0},
+		{"ArrayOf", Func, 5},
+		{"Bool", Const, 0},
+		{"BothDir", Const, 0},
+		{"Chan", Const, 0},
+		{"ChanDir", Type, 0},
+		{"ChanOf", Func, 1},
+		{"Complex128", Const, 0},
+		{"Complex64", Const, 0},
+		{"Copy", Func, 0},
+		{"DeepEqual", Func, 0},
+		{"Float32", Const, 0},
+		{"Float64", Const, 0},
+		{"Func", Const, 0},
+		{"FuncOf", Func, 5},
+		{"Indirect", Func, 0},
+		{"Int", Const, 0},
+		{"Int16", Const, 0},
+		{"Int32", Const, 0},
+		{"Int64", Const, 0},
+		{"Int8", Const, 0},
+		{"Interface", Const, 0},
+		{"Invalid", Const, 0},
+		{"Kind", Type, 0},
+		{"MakeChan", Func, 0},
+		{"MakeFunc", Func, 1},
+		{"MakeMap", Func, 0},
+		{"MakeMapWithSize", Func, 9},
+		{"MakeSlice", Func, 0},
+		{"Map", Const, 0},
+		{"MapIter", Type, 12},
+		{"MapOf", Func, 1},
+		{"Method", Type, 0},
+		{"Method.Func", Field, 0},
+		{"Method.Index", Field, 0},
+		{"Method.Name", Field, 0},
+		{"Method.PkgPath", Field, 0},
+		{"Method.Type", Field, 0},
+		{"New", Func, 0},
+		{"NewAt", Func, 0},
+		{"Pointer", Const, 18},
+		{"PointerTo", Func, 18},
+		{"Ptr", Const, 0},
+		{"PtrTo", Func, 0},
+		{"RecvDir", Const, 0},
+		{"Select", Func, 1},
+		{"SelectCase", Type, 1},
+		{"SelectCase.Chan", Field, 1},
+		{"SelectCase.Dir", Field, 1},
+		{"SelectCase.Send", Field, 1},
+		{"SelectDefault", Const, 1},
+		{"SelectDir", Type, 1},
+		{"SelectRecv", Const, 1},
+		{"SelectSend", Const, 1},
+		{"SendDir", Const, 0},
+		{"Slice", Const, 0},
+		{"SliceHeader", Type, 0},
+		{"SliceHeader.Cap", Field, 0},
+		{"SliceHeader.Data", Field, 0},
+		{"SliceHeader.Len", Field, 0},
+		{"SliceOf", Func, 1},
+		{"String", Const, 0},
+		{"StringHeader", Type, 0},
+		{"StringHeader.Data", Field, 0},
+		{"StringHeader.Len", Field, 0},
+		{"Struct", Const, 0},
+		{"StructField", Type, 0},
+		{"StructField.Anonymous", Field, 0},
+		{"StructField.Index", Field, 0},
+		{"StructField.Name", Field, 0},
+		{"StructField.Offset", Field, 0},
+		{"StructField.PkgPath", Field, 0},
+		{"StructField.Tag", Field, 0},
+		{"StructField.Type", Field, 0},
+		{"StructOf", Func, 7},
+		{"StructTag", Type, 0},
+		{"Swapper", Func, 8},
+		{"Type", Type, 0},
+		{"TypeFor", Func, 22},
+		{"TypeOf", Func, 0},
+		{"Uint", Const, 0},
+		{"Uint16", Const, 0},
+		{"Uint32", Const, 0},
+		{"Uint64", Const, 0},
+		{"Uint8", Const, 0},
+		{"Uintptr", Const, 0},
+		{"UnsafePointer", Const, 0},
+		{"Value", Type, 0},
+		{"ValueError", Type, 0},
+		{"ValueError.Kind", Field, 0},
+		{"ValueError.Method", Field, 0},
+		{"ValueOf", Func, 0},
+		{"VisibleFields", Func, 17},
+		{"Zero", Func, 0},
+	},
+	"regexp": {
+		{"(*Regexp).Copy", Method, 6},
+		{"(*Regexp).Expand", Method, 0},
+		{"(*Regexp).ExpandString", Method, 0},
+		{"(*Regexp).Find", Method, 0},
+		{"(*Regexp).FindAll", Method, 0},
+		{"(*Regexp).FindAllIndex", Method, 0},
+		{"(*Regexp).FindAllString", Method, 0},
+		{"(*Regexp).FindAllStringIndex", Method, 0},
+		{"(*Regexp).FindAllStringSubmatch", Method, 0},
+		{"(*Regexp).FindAllStringSubmatchIndex", Method, 0},
+		{"(*Regexp).FindAllSubmatch", Method, 0},
+		{"(*Regexp).FindAllSubmatchIndex", Method, 0},
+		{"(*Regexp).FindIndex", Method, 0},
+		{"(*Regexp).FindReaderIndex", Method, 0},
+		{"(*Regexp).FindReaderSubmatchIndex", Method, 0},
+		{"(*Regexp).FindString", Method, 0},
+		{"(*Regexp).FindStringIndex", Method, 0},
+		{"(*Regexp).FindStringSubmatch", Method, 0},
+		{"(*Regexp).FindStringSubmatchIndex", Method, 0},
+		{"(*Regexp).FindSubmatch", Method, 0},
+		{"(*Regexp).FindSubmatchIndex", Method, 0},
+		{"(*Regexp).LiteralPrefix", Method, 0},
+		{"(*Regexp).Longest", Method, 1},
+		{"(*Regexp).MarshalText", Method, 21},
+		{"(*Regexp).Match", Method, 0},
+		{"(*Regexp).MatchReader", Method, 0},
+		{"(*Regexp).MatchString", Method, 0},
+		{"(*Regexp).NumSubexp", Method, 0},
+		{"(*Regexp).ReplaceAll", Method, 0},
+		{"(*Regexp).ReplaceAllFunc", Method, 0},
+		{"(*Regexp).ReplaceAllLiteral", Method, 0},
+		{"(*Regexp).ReplaceAllLiteralString", Method, 0},
+		{"(*Regexp).ReplaceAllString", Method, 0},
+		{"(*Regexp).ReplaceAllStringFunc", Method, 0},
+		{"(*Regexp).Split", Method, 1},
+		{"(*Regexp).String", Method, 0},
+		{"(*Regexp).SubexpIndex", Method, 15},
+		{"(*Regexp).SubexpNames", Method, 0},
+		{"(*Regexp).UnmarshalText", Method, 21},
+		{"Compile", Func, 0},
+		{"CompilePOSIX", Func, 0},
+		{"Match", Func, 0},
+		{"MatchReader", Func, 0},
+		{"MatchString", Func, 0},
+		{"MustCompile", Func, 0},
+		{"MustCompilePOSIX", Func, 0},
+		{"QuoteMeta", Func, 0},
+		{"Regexp", Type, 0},
+	},
+	"regexp/syntax": {
+		{"(*Error).Error", Method, 0},
+		{"(*Inst).MatchEmptyWidth", Method, 0},
+		{"(*Inst).MatchRune", Method, 0},
+		{"(*Inst).MatchRunePos", Method, 3},
+		{"(*Inst).String", Method, 0},
+		{"(*Prog).Prefix", Method, 0},
+		{"(*Prog).StartCond", Method, 0},
+		{"(*Prog).String", Method, 0},
+		{"(*Regexp).CapNames", Method, 0},
+		{"(*Regexp).Equal", Method, 0},
+		{"(*Regexp).MaxCap", Method, 0},
+		{"(*Regexp).Simplify", Method, 0},
+		{"(*Regexp).String", Method, 0},
+		{"(ErrorCode).String", Method, 0},
+		{"(InstOp).String", Method, 3},
+		{"(Op).String", Method, 11},
+		{"ClassNL", Const, 0},
+		{"Compile", Func, 0},
+		{"DotNL", Const, 0},
+		{"EmptyBeginLine", Const, 0},
+		{"EmptyBeginText", Const, 0},
+		{"EmptyEndLine", Const, 0},
+		{"EmptyEndText", Const, 0},
+		{"EmptyNoWordBoundary", Const, 0},
+		{"EmptyOp", Type, 0},
+		{"EmptyOpContext", Func, 0},
+		{"EmptyWordBoundary", Const, 0},
+		{"ErrInternalError", Const, 0},
+		{"ErrInvalidCharClass", Const, 0},
+		{"ErrInvalidCharRange", Const, 0},
+		{"ErrInvalidEscape", Const, 0},
+		{"ErrInvalidNamedCapture", Const, 0},
+		{"ErrInvalidPerlOp", Const, 0},
+		{"ErrInvalidRepeatOp", Const, 0},
+		{"ErrInvalidRepeatSize", Const, 0},
+		{"ErrInvalidUTF8", Const, 0},
+		{"ErrLarge", Const, 20},
+		{"ErrMissingBracket", Const, 0},
+		{"ErrMissingParen", Const, 0},
+		{"ErrMissingRepeatArgument", Const, 0},
+		{"ErrNestingDepth", Const, 19},
+		{"ErrTrailingBackslash", Const, 0},
+		{"ErrUnexpectedParen", Const, 1},
+		{"Error", Type, 0},
+		{"Error.Code", Field, 0},
+		{"Error.Expr", Field, 0},
+		{"ErrorCode", Type, 0},
+		{"Flags", Type, 0},
+		{"FoldCase", Const, 0},
+		{"Inst", Type, 0},
+		{"Inst.Arg", Field, 0},
+		{"Inst.Op", Field, 0},
+		{"Inst.Out", Field, 0},
+		{"Inst.Rune", Field, 0},
+		{"InstAlt", Const, 0},
+		{"InstAltMatch", Const, 0},
+		{"InstCapture", Const, 0},
+		{"InstEmptyWidth", Const, 0},
+		{"InstFail", Const, 0},
+		{"InstMatch", Const, 0},
+		{"InstNop", Const, 0},
+		{"InstOp", Type, 0},
+		{"InstRune", Const, 0},
+		{"InstRune1", Const, 0},
+		{"InstRuneAny", Const, 0},
+		{"InstRuneAnyNotNL", Const, 0},
+		{"IsWordChar", Func, 0},
+		{"Literal", Const, 0},
+		{"MatchNL", Const, 0},
+		{"NonGreedy", Const, 0},
+		{"OneLine", Const, 0},
+		{"Op", Type, 0},
+		{"OpAlternate", Const, 0},
+		{"OpAnyChar", Const, 0},
+		{"OpAnyCharNotNL", Const, 0},
+		{"OpBeginLine", Const, 0},
+		{"OpBeginText", Const, 0},
+		{"OpCapture", Const, 0},
+		{"OpCharClass", Const, 0},
+		{"OpConcat", Const, 0},
+		{"OpEmptyMatch", Const, 0},
+		{"OpEndLine", Const, 0},
+		{"OpEndText", Const, 0},
+		{"OpLiteral", Const, 0},
+		{"OpNoMatch", Const, 0},
+		{"OpNoWordBoundary", Const, 0},
+		{"OpPlus", Const, 0},
+		{"OpQuest", Const, 0},
+		{"OpRepeat", Const, 0},
+		{"OpStar", Const, 0},
+		{"OpWordBoundary", Const, 0},
+		{"POSIX", Const, 0},
+		{"Parse", Func, 0},
+		{"Perl", Const, 0},
+		{"PerlX", Const, 0},
+		{"Prog", Type, 0},
+		{"Prog.Inst", Field, 0},
+		{"Prog.NumCap", Field, 0},
+		{"Prog.Start", Field, 0},
+		{"Regexp", Type, 0},
+		{"Regexp.Cap", Field, 0},
+		{"Regexp.Flags", Field, 0},
+		{"Regexp.Max", Field, 0},
+		{"Regexp.Min", Field, 0},
+		{"Regexp.Name", Field, 0},
+		{"Regexp.Op", Field, 0},
+		{"Regexp.Rune", Field, 0},
+		{"Regexp.Rune0", Field, 0},
+		{"Regexp.Sub", Field, 0},
+		{"Regexp.Sub0", Field, 0},
+		{"Simple", Const, 0},
+		{"UnicodeGroups", Const, 0},
+		{"WasDollar", Const, 0},
+	},
+	"runtime": {
+		{"(*BlockProfileRecord).Stack", Method, 1},
+		{"(*Frames).Next", Method, 7},
+		{"(*Func).Entry", Method, 0},
+		{"(*Func).FileLine", Method, 0},
+		{"(*Func).Name", Method, 0},
+		{"(*MemProfileRecord).InUseBytes", Method, 0},
+		{"(*MemProfileRecord).InUseObjects", Method, 0},
+		{"(*MemProfileRecord).Stack", Method, 0},
+		{"(*PanicNilError).Error", Method, 21},
+		{"(*PanicNilError).RuntimeError", Method, 21},
+		{"(*Pinner).Pin", Method, 21},
+		{"(*Pinner).Unpin", Method, 21},
+		{"(*StackRecord).Stack", Method, 0},
+		{"(*TypeAssertionError).Error", Method, 0},
+		{"(*TypeAssertionError).RuntimeError", Method, 0},
+		{"BlockProfile", Func, 1},
+		{"BlockProfileRecord", Type, 1},
+		{"BlockProfileRecord.Count", Field, 1},
+		{"BlockProfileRecord.Cycles", Field, 1},
+		{"BlockProfileRecord.StackRecord", Field, 1},
+		{"Breakpoint", Func, 0},
+		{"CPUProfile", Func, 0},
+		{"Caller", Func, 0},
+		{"Callers", Func, 0},
+		{"CallersFrames", Func, 7},
+		{"Compiler", Const, 0},
+		{"Error", Type, 0},
+		{"Frame", Type, 7},
+		{"Frame.Entry", Field, 7},
+		{"Frame.File", Field, 7},
+		{"Frame.Func", Field, 7},
+		{"Frame.Function", Field, 7},
+		{"Frame.Line", Field, 7},
+		{"Frame.PC", Field, 7},
+		{"Frames", Type, 7},
+		{"Func", Type, 0},
+		{"FuncForPC", Func, 0},
+		{"GC", Func, 0},
+		{"GOARCH", Const, 0},
+		{"GOMAXPROCS", Func, 0},
+		{"GOOS", Const, 0},
+		{"GOROOT", Func, 0},
+		{"Goexit", Func, 0},
+		{"GoroutineProfile", Func, 0},
+		{"Gosched", Func, 0},
+		{"KeepAlive", Func, 7},
+		{"LockOSThread", Func, 0},
+		{"MemProfile", Func, 0},
+		{"MemProfileRate", Var, 0},
+		{"MemProfileRecord", Type, 0},
+		{"MemProfileRecord.AllocBytes", Field, 0},
+		{"MemProfileRecord.AllocObjects", Field, 0},
+		{"MemProfileRecord.FreeBytes", Field, 0},
+		{"MemProfileRecord.FreeObjects", Field, 0},
+		{"MemProfileRecord.Stack0", Field, 0},
+		{"MemStats", Type, 0},
+		{"MemStats.Alloc", Field, 0},
+		{"MemStats.BuckHashSys", Field, 0},
+		{"MemStats.BySize", Field, 0},
+		{"MemStats.DebugGC", Field, 0},
+		{"MemStats.EnableGC", Field, 0},
+		{"MemStats.Frees", Field, 0},
+		{"MemStats.GCCPUFraction", Field, 5},
+		{"MemStats.GCSys", Field, 2},
+		{"MemStats.HeapAlloc", Field, 0},
+		{"MemStats.HeapIdle", Field, 0},
+		{"MemStats.HeapInuse", Field, 0},
+		{"MemStats.HeapObjects", Field, 0},
+		{"MemStats.HeapReleased", Field, 0},
+		{"MemStats.HeapSys", Field, 0},
+		{"MemStats.LastGC", Field, 0},
+		{"MemStats.Lookups", Field, 0},
+		{"MemStats.MCacheInuse", Field, 0},
+		{"MemStats.MCacheSys", Field, 0},
+		{"MemStats.MSpanInuse", Field, 0},
+		{"MemStats.MSpanSys", Field, 0},
+		{"MemStats.Mallocs", Field, 0},
+		{"MemStats.NextGC", Field, 0},
+		{"MemStats.NumForcedGC", Field, 8},
+		{"MemStats.NumGC", Field, 0},
+		{"MemStats.OtherSys", Field, 2},
+		{"MemStats.PauseEnd", Field, 4},
+		{"MemStats.PauseNs", Field, 0},
+		{"MemStats.PauseTotalNs", Field, 0},
+		{"MemStats.StackInuse", Field, 0},
+		{"MemStats.StackSys", Field, 0},
+		{"MemStats.Sys", Field, 0},
+		{"MemStats.TotalAlloc", Field, 0},
+		{"MutexProfile", Func, 8},
+		{"NumCPU", Func, 0},
+		{"NumCgoCall", Func, 0},
+		{"NumGoroutine", Func, 0},
+		{"PanicNilError", Type, 21},
+		{"Pinner", Type, 21},
+		{"ReadMemStats", Func, 0},
+		{"ReadTrace", Func, 5},
+		{"SetBlockProfileRate", Func, 1},
+		{"SetCPUProfileRate", Func, 0},
+		{"SetCgoTraceback", Func, 7},
+		{"SetFinalizer", Func, 0},
+		{"SetMutexProfileFraction", Func, 8},
+		{"Stack", Func, 0},
+		{"StackRecord", Type, 0},
+		{"StackRecord.Stack0", Field, 0},
+		{"StartTrace", Func, 5},
+		{"StopTrace", Func, 5},
+		{"ThreadCreateProfile", Func, 0},
+		{"TypeAssertionError", Type, 0},
+		{"UnlockOSThread", Func, 0},
+		{"Version", Func, 0},
+	},
+	"runtime/cgo": {
+		{"(Handle).Delete", Method, 17},
+		{"(Handle).Value", Method, 17},
+		{"Handle", Type, 17},
+		{"Incomplete", Type, 20},
+		{"NewHandle", Func, 17},
+	},
+	"runtime/coverage": {
+		{"ClearCounters", Func, 20},
+		{"WriteCounters", Func, 20},
+		{"WriteCountersDir", Func, 20},
+		{"WriteMeta", Func, 20},
+		{"WriteMetaDir", Func, 20},
+	},
+	"runtime/debug": {
+		{"(*BuildInfo).String", Method, 18},
+		{"BuildInfo", Type, 12},
+		{"BuildInfo.Deps", Field, 12},
+		{"BuildInfo.GoVersion", Field, 18},
+		{"BuildInfo.Main", Field, 12},
+		{"BuildInfo.Path", Field, 12},
+		{"BuildInfo.Settings", Field, 18},
+		{"BuildSetting", Type, 18},
+		{"BuildSetting.Key", Field, 18},
+		{"BuildSetting.Value", Field, 18},
+		{"FreeOSMemory", Func, 1},
+		{"GCStats", Type, 1},
+		{"GCStats.LastGC", Field, 1},
+		{"GCStats.NumGC", Field, 1},
+		{"GCStats.Pause", Field, 1},
+		{"GCStats.PauseEnd", Field, 4},
+		{"GCStats.PauseQuantiles", Field, 1},
+		{"GCStats.PauseTotal", Field, 1},
+		{"Module", Type, 12},
+		{"Module.Path", Field, 12},
+		{"Module.Replace", Field, 12},
+		{"Module.Sum", Field, 12},
+		{"Module.Version", Field, 12},
+		{"ParseBuildInfo", Func, 18},
+		{"PrintStack", Func, 0},
+		{"ReadBuildInfo", Func, 12},
+		{"ReadGCStats", Func, 1},
+		{"SetGCPercent", Func, 1},
+		{"SetMaxStack", Func, 2},
+		{"SetMaxThreads", Func, 2},
+		{"SetMemoryLimit", Func, 19},
+		{"SetPanicOnFault", Func, 3},
+		{"SetTraceback", Func, 6},
+		{"Stack", Func, 0},
+		{"WriteHeapDump", Func, 3},
+	},
+	"runtime/metrics": {
+		{"(Value).Float64", Method, 16},
+		{"(Value).Float64Histogram", Method, 16},
+		{"(Value).Kind", Method, 16},
+		{"(Value).Uint64", Method, 16},
+		{"All", Func, 16},
+		{"Description", Type, 16},
+		{"Description.Cumulative", Field, 16},
+		{"Description.Description", Field, 16},
+		{"Description.Kind", Field, 16},
+		{"Description.Name", Field, 16},
+		{"Float64Histogram", Type, 16},
+		{"Float64Histogram.Buckets", Field, 16},
+		{"Float64Histogram.Counts", Field, 16},
+		{"KindBad", Const, 16},
+		{"KindFloat64", Const, 16},
+		{"KindFloat64Histogram", Const, 16},
+		{"KindUint64", Const, 16},
+		{"Read", Func, 16},
+		{"Sample", Type, 16},
+		{"Sample.Name", Field, 16},
+		{"Sample.Value", Field, 16},
+		{"Value", Type, 16},
+		{"ValueKind", Type, 16},
+	},
+	"runtime/pprof": {
+		{"(*Profile).Add", Method, 0},
+		{"(*Profile).Count", Method, 0},
+		{"(*Profile).Name", Method, 0},
+		{"(*Profile).Remove", Method, 0},
+		{"(*Profile).WriteTo", Method, 0},
+		{"Do", Func, 9},
+		{"ForLabels", Func, 9},
+		{"Label", Func, 9},
+		{"LabelSet", Type, 9},
+		{"Labels", Func, 9},
+		{"Lookup", Func, 0},
+		{"NewProfile", Func, 0},
+		{"Profile", Type, 0},
+		{"Profiles", Func, 0},
+		{"SetGoroutineLabels", Func, 9},
+		{"StartCPUProfile", Func, 0},
+		{"StopCPUProfile", Func, 0},
+		{"WithLabels", Func, 9},
+		{"WriteHeapProfile", Func, 0},
+	},
+	"runtime/trace": {
+		{"(*Region).End", Method, 11},
+		{"(*Task).End", Method, 11},
+		{"IsEnabled", Func, 11},
+		{"Log", Func, 11},
+		{"Logf", Func, 11},
+		{"NewTask", Func, 11},
+		{"Region", Type, 11},
+		{"Start", Func, 5},
+		{"StartRegion", Func, 11},
+		{"Stop", Func, 5},
+		{"Task", Type, 11},
+		{"WithRegion", Func, 11},
+	},
+	"slices": {
+		{"BinarySearch", Func, 21},
+		{"BinarySearchFunc", Func, 21},
+		{"Clip", Func, 21},
+		{"Clone", Func, 21},
+		{"Compact", Func, 21},
+		{"CompactFunc", Func, 21},
+		{"Compare", Func, 21},
+		{"CompareFunc", Func, 21},
+		{"Concat", Func, 22},
+		{"Contains", Func, 21},
+		{"ContainsFunc", Func, 21},
+		{"Delete", Func, 21},
+		{"DeleteFunc", Func, 21},
+		{"Equal", Func, 21},
+		{"EqualFunc", Func, 21},
+		{"Grow", Func, 21},
+		{"Index", Func, 21},
+		{"IndexFunc", Func, 21},
+		{"Insert", Func, 21},
+		{"IsSorted", Func, 21},
+		{"IsSortedFunc", Func, 21},
+		{"Max", Func, 21},
+		{"MaxFunc", Func, 21},
+		{"Min", Func, 21},
+		{"MinFunc", Func, 21},
+		{"Replace", Func, 21},
+		{"Reverse", Func, 21},
+		{"Sort", Func, 21},
+		{"SortFunc", Func, 21},
+		{"SortStableFunc", Func, 21},
+	},
+	"sort": {
+		{"(Float64Slice).Len", Method, 0},
+		{"(Float64Slice).Less", Method, 0},
+		{"(Float64Slice).Search", Method, 0},
+		{"(Float64Slice).Sort", Method, 0},
+		{"(Float64Slice).Swap", Method, 0},
+		{"(IntSlice).Len", Method, 0},
+		{"(IntSlice).Less", Method, 0},
+		{"(IntSlice).Search", Method, 0},
+		{"(IntSlice).Sort", Method, 0},
+		{"(IntSlice).Swap", Method, 0},
+		{"(StringSlice).Len", Method, 0},
+		{"(StringSlice).Less", Method, 0},
+		{"(StringSlice).Search", Method, 0},
+		{"(StringSlice).Sort", Method, 0},
+		{"(StringSlice).Swap", Method, 0},
+		{"Find", Func, 19},
+		{"Float64Slice", Type, 0},
+		{"Float64s", Func, 0},
+		{"Float64sAreSorted", Func, 0},
+		{"IntSlice", Type, 0},
+		{"Interface", Type, 0},
+		{"Ints", Func, 0},
+		{"IntsAreSorted", Func, 0},
+		{"IsSorted", Func, 0},
+		{"Reverse", Func, 1},
+		{"Search", Func, 0},
+		{"SearchFloat64s", Func, 0},
+		{"SearchInts", Func, 0},
+		{"SearchStrings", Func, 0},
+		{"Slice", Func, 8},
+		{"SliceIsSorted", Func, 8},
+		{"SliceStable", Func, 8},
+		{"Sort", Func, 0},
+		{"Stable", Func, 2},
+		{"StringSlice", Type, 0},
+		{"Strings", Func, 0},
+		{"StringsAreSorted", Func, 0},
+	},
+	"strconv": {
+		{"(*NumError).Error", Method, 0},
+		{"(*NumError).Unwrap", Method, 14},
+		{"AppendBool", Func, 0},
+		{"AppendFloat", Func, 0},
+		{"AppendInt", Func, 0},
+		{"AppendQuote", Func, 0},
+		{"AppendQuoteRune", Func, 0},
+		{"AppendQuoteRuneToASCII", Func, 0},
+		{"AppendQuoteRuneToGraphic", Func, 6},
+		{"AppendQuoteToASCII", Func, 0},
+		{"AppendQuoteToGraphic", Func, 6},
+		{"AppendUint", Func, 0},
+		{"Atoi", Func, 0},
+		{"CanBackquote", Func, 0},
+		{"ErrRange", Var, 0},
+		{"ErrSyntax", Var, 0},
+		{"FormatBool", Func, 0},
+		{"FormatComplex", Func, 15},
+		{"FormatFloat", Func, 0},
+		{"FormatInt", Func, 0},
+		{"FormatUint", Func, 0},
+		{"IntSize", Const, 0},
+		{"IsGraphic", Func, 6},
+		{"IsPrint", Func, 0},
+		{"Itoa", Func, 0},
+		{"NumError", Type, 0},
+		{"NumError.Err", Field, 0},
+		{"NumError.Func", Field, 0},
+		{"NumError.Num", Field, 0},
+		{"ParseBool", Func, 0},
+		{"ParseComplex", Func, 15},
+		{"ParseFloat", Func, 0},
+		{"ParseInt", Func, 0},
+		{"ParseUint", Func, 0},
+		{"Quote", Func, 0},
+		{"QuoteRune", Func, 0},
+		{"QuoteRuneToASCII", Func, 0},
+		{"QuoteRuneToGraphic", Func, 6},
+		{"QuoteToASCII", Func, 0},
+		{"QuoteToGraphic", Func, 6},
+		{"QuotedPrefix", Func, 17},
+		{"Unquote", Func, 0},
+		{"UnquoteChar", Func, 0},
+	},
+	"strings": {
+		{"(*Builder).Cap", Method, 12},
+		{"(*Builder).Grow", Method, 10},
+		{"(*Builder).Len", Method, 10},
+		{"(*Builder).Reset", Method, 10},
+		{"(*Builder).String", Method, 10},
+		{"(*Builder).Write", Method, 10},
+		{"(*Builder).WriteByte", Method, 10},
+		{"(*Builder).WriteRune", Method, 10},
+		{"(*Builder).WriteString", Method, 10},
+		{"(*Reader).Len", Method, 0},
+		{"(*Reader).Read", Method, 0},
+		{"(*Reader).ReadAt", Method, 0},
+		{"(*Reader).ReadByte", Method, 0},
+		{"(*Reader).ReadRune", Method, 0},
+		{"(*Reader).Reset", Method, 7},
+		{"(*Reader).Seek", Method, 0},
+		{"(*Reader).Size", Method, 5},
+		{"(*Reader).UnreadByte", Method, 0},
+		{"(*Reader).UnreadRune", Method, 0},
+		{"(*Reader).WriteTo", Method, 1},
+		{"(*Replacer).Replace", Method, 0},
+		{"(*Replacer).WriteString", Method, 0},
+		{"Builder", Type, 10},
+		{"Clone", Func, 18},
+		{"Compare", Func, 5},
+		{"Contains", Func, 0},
+		{"ContainsAny", Func, 0},
+		{"ContainsFunc", Func, 21},
+		{"ContainsRune", Func, 0},
+		{"Count", Func, 0},
+		{"Cut", Func, 18},
+		{"CutPrefix", Func, 20},
+		{"CutSuffix", Func, 20},
+		{"EqualFold", Func, 0},
+		{"Fields", Func, 0},
+		{"FieldsFunc", Func, 0},
+		{"HasPrefix", Func, 0},
+		{"HasSuffix", Func, 0},
+		{"Index", Func, 0},
+		{"IndexAny", Func, 0},
+		{"IndexByte", Func, 2},
+		{"IndexFunc", Func, 0},
+		{"IndexRune", Func, 0},
+		{"Join", Func, 0},
+		{"LastIndex", Func, 0},
+		{"LastIndexAny", Func, 0},
+		{"LastIndexByte", Func, 5},
+		{"LastIndexFunc", Func, 0},
+		{"Map", Func, 0},
+		{"NewReader", Func, 0},
+		{"NewReplacer", Func, 0},
+		{"Reader", Type, 0},
+		{"Repeat", Func, 0},
+		{"Replace", Func, 0},
+		{"ReplaceAll", Func, 12},
+		{"Replacer", Type, 0},
+		{"Split", Func, 0},
+		{"SplitAfter", Func, 0},
+		{"SplitAfterN", Func, 0},
+		{"SplitN", Func, 0},
+		{"Title", Func, 0},
+		{"ToLower", Func, 0},
+		{"ToLowerSpecial", Func, 0},
+		{"ToTitle", Func, 0},
+		{"ToTitleSpecial", Func, 0},
+		{"ToUpper", Func, 0},
+		{"ToUpperSpecial", Func, 0},
+		{"ToValidUTF8", Func, 13},
+		{"Trim", Func, 0},
+		{"TrimFunc", Func, 0},
+		{"TrimLeft", Func, 0},
+		{"TrimLeftFunc", Func, 0},
+		{"TrimPrefix", Func, 1},
+		{"TrimRight", Func, 0},
+		{"TrimRightFunc", Func, 0},
+		{"TrimSpace", Func, 0},
+		{"TrimSuffix", Func, 1},
+	},
+	"sync": {
+		{"(*Cond).Broadcast", Method, 0},
+		{"(*Cond).Signal", Method, 0},
+		{"(*Cond).Wait", Method, 0},
+		{"(*Map).CompareAndDelete", Method, 20},
+		{"(*Map).CompareAndSwap", Method, 20},
+		{"(*Map).Delete", Method, 9},
+		{"(*Map).Load", Method, 9},
+		{"(*Map).LoadAndDelete", Method, 15},
+		{"(*Map).LoadOrStore", Method, 9},
+		{"(*Map).Range", Method, 9},
+		{"(*Map).Store", Method, 9},
+		{"(*Map).Swap", Method, 20},
+		{"(*Mutex).Lock", Method, 0},
+		{"(*Mutex).TryLock", Method, 18},
+		{"(*Mutex).Unlock", Method, 0},
+		{"(*Once).Do", Method, 0},
+		{"(*Pool).Get", Method, 3},
+		{"(*Pool).Put", Method, 3},
+		{"(*RWMutex).Lock", Method, 0},
+		{"(*RWMutex).RLock", Method, 0},
+		{"(*RWMutex).RLocker", Method, 0},
+		{"(*RWMutex).RUnlock", Method, 0},
+		{"(*RWMutex).TryLock", Method, 18},
+		{"(*RWMutex).TryRLock", Method, 18},
+		{"(*RWMutex).Unlock", Method, 0},
+		{"(*WaitGroup).Add", Method, 0},
+		{"(*WaitGroup).Done", Method, 0},
+		{"(*WaitGroup).Wait", Method, 0},
+		{"Cond", Type, 0},
+		{"Cond.L", Field, 0},
+		{"Locker", Type, 0},
+		{"Map", Type, 9},
+		{"Mutex", Type, 0},
+		{"NewCond", Func, 0},
+		{"Once", Type, 0},
+		{"OnceFunc", Func, 21},
+		{"OnceValue", Func, 21},
+		{"OnceValues", Func, 21},
+		{"Pool", Type, 3},
+		{"Pool.New", Field, 3},
+		{"RWMutex", Type, 0},
+		{"WaitGroup", Type, 0},
+	},
+	"sync/atomic": {
+		{"(*Bool).CompareAndSwap", Method, 19},
+		{"(*Bool).Load", Method, 19},
+		{"(*Bool).Store", Method, 19},
+		{"(*Bool).Swap", Method, 19},
+		{"(*Int32).Add", Method, 19},
+		{"(*Int32).CompareAndSwap", Method, 19},
+		{"(*Int32).Load", Method, 19},
+		{"(*Int32).Store", Method, 19},
+		{"(*Int32).Swap", Method, 19},
+		{"(*Int64).Add", Method, 19},
+		{"(*Int64).CompareAndSwap", Method, 19},
+		{"(*Int64).Load", Method, 19},
+		{"(*Int64).Store", Method, 19},
+		{"(*Int64).Swap", Method, 19},
+		{"(*Pointer).CompareAndSwap", Method, 19},
+		{"(*Pointer).Load", Method, 19},
+		{"(*Pointer).Store", Method, 19},
+		{"(*Pointer).Swap", Method, 19},
+		{"(*Uint32).Add", Method, 19},
+		{"(*Uint32).CompareAndSwap", Method, 19},
+		{"(*Uint32).Load", Method, 19},
+		{"(*Uint32).Store", Method, 19},
+		{"(*Uint32).Swap", Method, 19},
+		{"(*Uint64).Add", Method, 19},
+		{"(*Uint64).CompareAndSwap", Method, 19},
+		{"(*Uint64).Load", Method, 19},
+		{"(*Uint64).Store", Method, 19},
+		{"(*Uint64).Swap", Method, 19},
+		{"(*Uintptr).Add", Method, 19},
+		{"(*Uintptr).CompareAndSwap", Method, 19},
+		{"(*Uintptr).Load", Method, 19},
+		{"(*Uintptr).Store", Method, 19},
+		{"(*Uintptr).Swap", Method, 19},
+		{"(*Value).CompareAndSwap", Method, 17},
+		{"(*Value).Load", Method, 4},
+		{"(*Value).Store", Method, 4},
+		{"(*Value).Swap", Method, 17},
+		{"AddInt32", Func, 0},
+		{"AddInt64", Func, 0},
+		{"AddUint32", Func, 0},
+		{"AddUint64", Func, 0},
+		{"AddUintptr", Func, 0},
+		{"Bool", Type, 19},
+		{"CompareAndSwapInt32", Func, 0},
+		{"CompareAndSwapInt64", Func, 0},
+		{"CompareAndSwapPointer", Func, 0},
+		{"CompareAndSwapUint32", Func, 0},
+		{"CompareAndSwapUint64", Func, 0},
+		{"CompareAndSwapUintptr", Func, 0},
+		{"Int32", Type, 19},
+		{"Int64", Type, 19},
+		{"LoadInt32", Func, 0},
+		{"LoadInt64", Func, 0},
+		{"LoadPointer", Func, 0},
+		{"LoadUint32", Func, 0},
+		{"LoadUint64", Func, 0},
+		{"LoadUintptr", Func, 0},
+		{"Pointer", Type, 19},
+		{"StoreInt32", Func, 0},
+		{"StoreInt64", Func, 0},
+		{"StorePointer", Func, 0},
+		{"StoreUint32", Func, 0},
+		{"StoreUint64", Func, 0},
+		{"StoreUintptr", Func, 0},
+		{"SwapInt32", Func, 2},
+		{"SwapInt64", Func, 2},
+		{"SwapPointer", Func, 2},
+		{"SwapUint32", Func, 2},
+		{"SwapUint64", Func, 2},
+		{"SwapUintptr", Func, 2},
+		{"Uint32", Type, 19},
+		{"Uint64", Type, 19},
+		{"Uintptr", Type, 19},
+		{"Value", Type, 4},
+	},
+	"syscall": {
+		{"(*Cmsghdr).SetLen", Method, 0},
+		{"(*DLL).FindProc", Method, 0},
+		{"(*DLL).MustFindProc", Method, 0},
+		{"(*DLL).Release", Method, 0},
+		{"(*DLLError).Error", Method, 0},
+		{"(*DLLError).Unwrap", Method, 16},
+		{"(*Filetime).Nanoseconds", Method, 0},
+		{"(*Iovec).SetLen", Method, 0},
+		{"(*LazyDLL).Handle", Method, 0},
+		{"(*LazyDLL).Load", Method, 0},
+		{"(*LazyDLL).NewProc", Method, 0},
+		{"(*LazyProc).Addr", Method, 0},
+		{"(*LazyProc).Call", Method, 0},
+		{"(*LazyProc).Find", Method, 0},
+		{"(*Msghdr).SetControllen", Method, 0},
+		{"(*Proc).Addr", Method, 0},
+		{"(*Proc).Call", Method, 0},
+		{"(*PtraceRegs).PC", Method, 0},
+		{"(*PtraceRegs).SetPC", Method, 0},
+		{"(*RawSockaddrAny).Sockaddr", Method, 0},
+		{"(*SID).Copy", Method, 0},
+		{"(*SID).Len", Method, 0},
+		{"(*SID).LookupAccount", Method, 0},
+		{"(*SID).String", Method, 0},
+		{"(*Timespec).Nano", Method, 0},
+		{"(*Timespec).Unix", Method, 0},
+		{"(*Timeval).Nano", Method, 0},
+		{"(*Timeval).Nanoseconds", Method, 0},
+		{"(*Timeval).Unix", Method, 0},
+		{"(Errno).Error", Method, 0},
+		{"(Errno).Is", Method, 13},
+		{"(Errno).Temporary", Method, 0},
+		{"(Errno).Timeout", Method, 0},
+		{"(Signal).Signal", Method, 0},
+		{"(Signal).String", Method, 0},
+		{"(Token).Close", Method, 0},
+		{"(Token).GetTokenPrimaryGroup", Method, 0},
+		{"(Token).GetTokenUser", Method, 0},
+		{"(Token).GetUserProfileDirectory", Method, 0},
+		{"(WaitStatus).Continued", Method, 0},
+		{"(WaitStatus).CoreDump", Method, 0},
+		{"(WaitStatus).ExitStatus", Method, 0},
+		{"(WaitStatus).Exited", Method, 0},
+		{"(WaitStatus).Signal", Method, 0},
+		{"(WaitStatus).Signaled", Method, 0},
+		{"(WaitStatus).StopSignal", Method, 0},
+		{"(WaitStatus).Stopped", Method, 0},
+		{"(WaitStatus).TrapCause", Method, 0},
+		{"AF_ALG", Const, 0},
+		{"AF_APPLETALK", Const, 0},
+		{"AF_ARP", Const, 0},
+		{"AF_ASH", Const, 0},
+		{"AF_ATM", Const, 0},
+		{"AF_ATMPVC", Const, 0},
+		{"AF_ATMSVC", Const, 0},
+		{"AF_AX25", Const, 0},
+		{"AF_BLUETOOTH", Const, 0},
+		{"AF_BRIDGE", Const, 0},
+		{"AF_CAIF", Const, 0},
+		{"AF_CAN", Const, 0},
+		{"AF_CCITT", Const, 0},
+		{"AF_CHAOS", Const, 0},
+		{"AF_CNT", Const, 0},
+		{"AF_COIP", Const, 0},
+		{"AF_DATAKIT", Const, 0},
+		{"AF_DECnet", Const, 0},
+		{"AF_DLI", Const, 0},
+		{"AF_E164", Const, 0},
+		{"AF_ECMA", Const, 0},
+		{"AF_ECONET", Const, 0},
+		{"AF_ENCAP", Const, 1},
+		{"AF_FILE", Const, 0},
+		{"AF_HYLINK", Const, 0},
+		{"AF_IEEE80211", Const, 0},
+		{"AF_IEEE802154", Const, 0},
+		{"AF_IMPLINK", Const, 0},
+		{"AF_INET", Const, 0},
+		{"AF_INET6", Const, 0},
+		{"AF_INET6_SDP", Const, 3},
+		{"AF_INET_SDP", Const, 3},
+		{"AF_IPX", Const, 0},
+		{"AF_IRDA", Const, 0},
+		{"AF_ISDN", Const, 0},
+		{"AF_ISO", Const, 0},
+		{"AF_IUCV", Const, 0},
+		{"AF_KEY", Const, 0},
+		{"AF_LAT", Const, 0},
+		{"AF_LINK", Const, 0},
+		{"AF_LLC", Const, 0},
+		{"AF_LOCAL", Const, 0},
+		{"AF_MAX", Const, 0},
+		{"AF_MPLS", Const, 1},
+		{"AF_NATM", Const, 0},
+		{"AF_NDRV", Const, 0},
+		{"AF_NETBEUI", Const, 0},
+		{"AF_NETBIOS", Const, 0},
+		{"AF_NETGRAPH", Const, 0},
+		{"AF_NETLINK", Const, 0},
+		{"AF_NETROM", Const, 0},
+		{"AF_NS", Const, 0},
+		{"AF_OROUTE", Const, 1},
+		{"AF_OSI", Const, 0},
+		{"AF_PACKET", Const, 0},
+		{"AF_PHONET", Const, 0},
+		{"AF_PPP", Const, 0},
+		{"AF_PPPOX", Const, 0},
+		{"AF_PUP", Const, 0},
+		{"AF_RDS", Const, 0},
+		{"AF_RESERVED_36", Const, 0},
+		{"AF_ROSE", Const, 0},
+		{"AF_ROUTE", Const, 0},
+		{"AF_RXRPC", Const, 0},
+		{"AF_SCLUSTER", Const, 0},
+		{"AF_SECURITY", Const, 0},
+		{"AF_SIP", Const, 0},
+		{"AF_SLOW", Const, 0},
+		{"AF_SNA", Const, 0},
+		{"AF_SYSTEM", Const, 0},
+		{"AF_TIPC", Const, 0},
+		{"AF_UNIX", Const, 0},
+		{"AF_UNSPEC", Const, 0},
+		{"AF_UTUN", Const, 16},
+		{"AF_VENDOR00", Const, 0},
+		{"AF_VENDOR01", Const, 0},
+		{"AF_VENDOR02", Const, 0},
+		{"AF_VENDOR03", Const, 0},
+		{"AF_VENDOR04", Const, 0},
+		{"AF_VENDOR05", Const, 0},
+		{"AF_VENDOR06", Const, 0},
+		{"AF_VENDOR07", Const, 0},
+		{"AF_VENDOR08", Const, 0},
+		{"AF_VENDOR09", Const, 0},
+		{"AF_VENDOR10", Const, 0},
+		{"AF_VENDOR11", Const, 0},
+		{"AF_VENDOR12", Const, 0},
+		{"AF_VENDOR13", Const, 0},
+		{"AF_VENDOR14", Const, 0},
+		{"AF_VENDOR15", Const, 0},
+		{"AF_VENDOR16", Const, 0},
+		{"AF_VENDOR17", Const, 0},
+		{"AF_VENDOR18", Const, 0},
+		{"AF_VENDOR19", Const, 0},
+		{"AF_VENDOR20", Const, 0},
+		{"AF_VENDOR21", Const, 0},
+		{"AF_VENDOR22", Const, 0},
+		{"AF_VENDOR23", Const, 0},
+		{"AF_VENDOR24", Const, 0},
+		{"AF_VENDOR25", Const, 0},
+		{"AF_VENDOR26", Const, 0},
+		{"AF_VENDOR27", Const, 0},
+		{"AF_VENDOR28", Const, 0},
+		{"AF_VENDOR29", Const, 0},
+		{"AF_VENDOR30", Const, 0},
+		{"AF_VENDOR31", Const, 0},
+		{"AF_VENDOR32", Const, 0},
+		{"AF_VENDOR33", Const, 0},
+		{"AF_VENDOR34", Const, 0},
+		{"AF_VENDOR35", Const, 0},
+		{"AF_VENDOR36", Const, 0},
+		{"AF_VENDOR37", Const, 0},
+		{"AF_VENDOR38", Const, 0},
+		{"AF_VENDOR39", Const, 0},
+		{"AF_VENDOR40", Const, 0},
+		{"AF_VENDOR41", Const, 0},
+		{"AF_VENDOR42", Const, 0},
+		{"AF_VENDOR43", Const, 0},
+		{"AF_VENDOR44", Const, 0},
+		{"AF_VENDOR45", Const, 0},
+		{"AF_VENDOR46", Const, 0},
+		{"AF_VENDOR47", Const, 0},
+		{"AF_WANPIPE", Const, 0},
+		{"AF_X25", Const, 0},
+		{"AI_CANONNAME", Const, 1},
+		{"AI_NUMERICHOST", Const, 1},
+		{"AI_PASSIVE", Const, 1},
+		{"APPLICATION_ERROR", Const, 0},
+		{"ARPHRD_ADAPT", Const, 0},
+		{"ARPHRD_APPLETLK", Const, 0},
+		{"ARPHRD_ARCNET", Const, 0},
+		{"ARPHRD_ASH", Const, 0},
+		{"ARPHRD_ATM", Const, 0},
+		{"ARPHRD_AX25", Const, 0},
+		{"ARPHRD_BIF", Const, 0},
+		{"ARPHRD_CHAOS", Const, 0},
+		{"ARPHRD_CISCO", Const, 0},
+		{"ARPHRD_CSLIP", Const, 0},
+		{"ARPHRD_CSLIP6", Const, 0},
+		{"ARPHRD_DDCMP", Const, 0},
+		{"ARPHRD_DLCI", Const, 0},
+		{"ARPHRD_ECONET", Const, 0},
+		{"ARPHRD_EETHER", Const, 0},
+		{"ARPHRD_ETHER", Const, 0},
+		{"ARPHRD_EUI64", Const, 0},
+		{"ARPHRD_FCAL", Const, 0},
+		{"ARPHRD_FCFABRIC", Const, 0},
+		{"ARPHRD_FCPL", Const, 0},
+		{"ARPHRD_FCPP", Const, 0},
+		{"ARPHRD_FDDI", Const, 0},
+		{"ARPHRD_FRAD", Const, 0},
+		{"ARPHRD_FRELAY", Const, 1},
+		{"ARPHRD_HDLC", Const, 0},
+		{"ARPHRD_HIPPI", Const, 0},
+		{"ARPHRD_HWX25", Const, 0},
+		{"ARPHRD_IEEE1394", Const, 0},
+		{"ARPHRD_IEEE802", Const, 0},
+		{"ARPHRD_IEEE80211", Const, 0},
+		{"ARPHRD_IEEE80211_PRISM", Const, 0},
+		{"ARPHRD_IEEE80211_RADIOTAP", Const, 0},
+		{"ARPHRD_IEEE802154", Const, 0},
+		{"ARPHRD_IEEE802154_PHY", Const, 0},
+		{"ARPHRD_IEEE802_TR", Const, 0},
+		{"ARPHRD_INFINIBAND", Const, 0},
+		{"ARPHRD_IPDDP", Const, 0},
+		{"ARPHRD_IPGRE", Const, 0},
+		{"ARPHRD_IRDA", Const, 0},
+		{"ARPHRD_LAPB", Const, 0},
+		{"ARPHRD_LOCALTLK", Const, 0},
+		{"ARPHRD_LOOPBACK", Const, 0},
+		{"ARPHRD_METRICOM", Const, 0},
+		{"ARPHRD_NETROM", Const, 0},
+		{"ARPHRD_NONE", Const, 0},
+		{"ARPHRD_PIMREG", Const, 0},
+		{"ARPHRD_PPP", Const, 0},
+		{"ARPHRD_PRONET", Const, 0},
+		{"ARPHRD_RAWHDLC", Const, 0},
+		{"ARPHRD_ROSE", Const, 0},
+		{"ARPHRD_RSRVD", Const, 0},
+		{"ARPHRD_SIT", Const, 0},
+		{"ARPHRD_SKIP", Const, 0},
+		{"ARPHRD_SLIP", Const, 0},
+		{"ARPHRD_SLIP6", Const, 0},
+		{"ARPHRD_STRIP", Const, 1},
+		{"ARPHRD_TUNNEL", Const, 0},
+		{"ARPHRD_TUNNEL6", Const, 0},
+		{"ARPHRD_VOID", Const, 0},
+		{"ARPHRD_X25", Const, 0},
+		{"AUTHTYPE_CLIENT", Const, 0},
+		{"AUTHTYPE_SERVER", Const, 0},
+		{"Accept", Func, 0},
+		{"Accept4", Func, 1},
+		{"AcceptEx", Func, 0},
+		{"Access", Func, 0},
+		{"Acct", Func, 0},
+		{"AddrinfoW", Type, 1},
+		{"AddrinfoW.Addr", Field, 1},
+		{"AddrinfoW.Addrlen", Field, 1},
+		{"AddrinfoW.Canonname", Field, 1},
+		{"AddrinfoW.Family", Field, 1},
+		{"AddrinfoW.Flags", Field, 1},
+		{"AddrinfoW.Next", Field, 1},
+		{"AddrinfoW.Protocol", Field, 1},
+		{"AddrinfoW.Socktype", Field, 1},
+		{"Adjtime", Func, 0},
+		{"Adjtimex", Func, 0},
+		{"AllThreadsSyscall", Func, 16},
+		{"AllThreadsSyscall6", Func, 16},
+		{"AttachLsf", Func, 0},
+		{"B0", Const, 0},
+		{"B1000000", Const, 0},
+		{"B110", Const, 0},
+		{"B115200", Const, 0},
+		{"B1152000", Const, 0},
+		{"B1200", Const, 0},
+		{"B134", Const, 0},
+		{"B14400", Const, 1},
+		{"B150", Const, 0},
+		{"B1500000", Const, 0},
+		{"B1800", Const, 0},
+		{"B19200", Const, 0},
+		{"B200", Const, 0},
+		{"B2000000", Const, 0},
+		{"B230400", Const, 0},
+		{"B2400", Const, 0},
+		{"B2500000", Const, 0},
+		{"B28800", Const, 1},
+		{"B300", Const, 0},
+		{"B3000000", Const, 0},
+		{"B3500000", Const, 0},
+		{"B38400", Const, 0},
+		{"B4000000", Const, 0},
+		{"B460800", Const, 0},
+		{"B4800", Const, 0},
+		{"B50", Const, 0},
+		{"B500000", Const, 0},
+		{"B57600", Const, 0},
+		{"B576000", Const, 0},
+		{"B600", Const, 0},
+		{"B7200", Const, 1},
+		{"B75", Const, 0},
+		{"B76800", Const, 1},
+		{"B921600", Const, 0},
+		{"B9600", Const, 0},
+		{"BASE_PROTOCOL", Const, 2},
+		{"BIOCFEEDBACK", Const, 0},
+		{"BIOCFLUSH", Const, 0},
+		{"BIOCGBLEN", Const, 0},
+		{"BIOCGDIRECTION", Const, 0},
+		{"BIOCGDIRFILT", Const, 1},
+		{"BIOCGDLT", Const, 0},
+		{"BIOCGDLTLIST", Const, 0},
+		{"BIOCGETBUFMODE", Const, 0},
+		{"BIOCGETIF", Const, 0},
+		{"BIOCGETZMAX", Const, 0},
+		{"BIOCGFEEDBACK", Const, 1},
+		{"BIOCGFILDROP", Const, 1},
+		{"BIOCGHDRCMPLT", Const, 0},
+		{"BIOCGRSIG", Const, 0},
+		{"BIOCGRTIMEOUT", Const, 0},
+		{"BIOCGSEESENT", Const, 0},
+		{"BIOCGSTATS", Const, 0},
+		{"BIOCGSTATSOLD", Const, 1},
+		{"BIOCGTSTAMP", Const, 1},
+		{"BIOCIMMEDIATE", Const, 0},
+		{"BIOCLOCK", Const, 0},
+		{"BIOCPROMISC", Const, 0},
+		{"BIOCROTZBUF", Const, 0},
+		{"BIOCSBLEN", Const, 0},
+		{"BIOCSDIRECTION", Const, 0},
+		{"BIOCSDIRFILT", Const, 1},
+		{"BIOCSDLT", Const, 0},
+		{"BIOCSETBUFMODE", Const, 0},
+		{"BIOCSETF", Const, 0},
+		{"BIOCSETFNR", Const, 0},
+		{"BIOCSETIF", Const, 0},
+		{"BIOCSETWF", Const, 0},
+		{"BIOCSETZBUF", Const, 0},
+		{"BIOCSFEEDBACK", Const, 1},
+		{"BIOCSFILDROP", Const, 1},
+		{"BIOCSHDRCMPLT", Const, 0},
+		{"BIOCSRSIG", Const, 0},
+		{"BIOCSRTIMEOUT", Const, 0},
+		{"BIOCSSEESENT", Const, 0},
+		{"BIOCSTCPF", Const, 1},
+		{"BIOCSTSTAMP", Const, 1},
+		{"BIOCSUDPF", Const, 1},
+		{"BIOCVERSION", Const, 0},
+		{"BPF_A", Const, 0},
+		{"BPF_ABS", Const, 0},
+		{"BPF_ADD", Const, 0},
+		{"BPF_ALIGNMENT", Const, 0},
+		{"BPF_ALIGNMENT32", Const, 1},
+		{"BPF_ALU", Const, 0},
+		{"BPF_AND", Const, 0},
+		{"BPF_B", Const, 0},
+		{"BPF_BUFMODE_BUFFER", Const, 0},
+		{"BPF_BUFMODE_ZBUF", Const, 0},
+		{"BPF_DFLTBUFSIZE", Const, 1},
+		{"BPF_DIRECTION_IN", Const, 1},
+		{"BPF_DIRECTION_OUT", Const, 1},
+		{"BPF_DIV", Const, 0},
+		{"BPF_H", Const, 0},
+		{"BPF_IMM", Const, 0},
+		{"BPF_IND", Const, 0},
+		{"BPF_JA", Const, 0},
+		{"BPF_JEQ", Const, 0},
+		{"BPF_JGE", Const, 0},
+		{"BPF_JGT", Const, 0},
+		{"BPF_JMP", Const, 0},
+		{"BPF_JSET", Const, 0},
+		{"BPF_K", Const, 0},
+		{"BPF_LD", Const, 0},
+		{"BPF_LDX", Const, 0},
+		{"BPF_LEN", Const, 0},
+		{"BPF_LSH", Const, 0},
+		{"BPF_MAJOR_VERSION", Const, 0},
+		{"BPF_MAXBUFSIZE", Const, 0},
+		{"BPF_MAXINSNS", Const, 0},
+		{"BPF_MEM", Const, 0},
+		{"BPF_MEMWORDS", Const, 0},
+		{"BPF_MINBUFSIZE", Const, 0},
+		{"BPF_MINOR_VERSION", Const, 0},
+		{"BPF_MISC", Const, 0},
+		{"BPF_MSH", Const, 0},
+		{"BPF_MUL", Const, 0},
+		{"BPF_NEG", Const, 0},
+		{"BPF_OR", Const, 0},
+		{"BPF_RELEASE", Const, 0},
+		{"BPF_RET", Const, 0},
+		{"BPF_RSH", Const, 0},
+		{"BPF_ST", Const, 0},
+		{"BPF_STX", Const, 0},
+		{"BPF_SUB", Const, 0},
+		{"BPF_TAX", Const, 0},
+		{"BPF_TXA", Const, 0},
+		{"BPF_T_BINTIME", Const, 1},
+		{"BPF_T_BINTIME_FAST", Const, 1},
+		{"BPF_T_BINTIME_MONOTONIC", Const, 1},
+		{"BPF_T_BINTIME_MONOTONIC_FAST", Const, 1},
+		{"BPF_T_FAST", Const, 1},
+		{"BPF_T_FLAG_MASK", Const, 1},
+		{"BPF_T_FORMAT_MASK", Const, 1},
+		{"BPF_T_MICROTIME", Const, 1},
+		{"BPF_T_MICROTIME_FAST", Const, 1},
+		{"BPF_T_MICROTIME_MONOTONIC", Const, 1},
+		{"BPF_T_MICROTIME_MONOTONIC_FAST", Const, 1},
+		{"BPF_T_MONOTONIC", Const, 1},
+		{"BPF_T_MONOTONIC_FAST", Const, 1},
+		{"BPF_T_NANOTIME", Const, 1},
+		{"BPF_T_NANOTIME_FAST", Const, 1},
+		{"BPF_T_NANOTIME_MONOTONIC", Const, 1},
+		{"BPF_T_NANOTIME_MONOTONIC_FAST", Const, 1},
+		{"BPF_T_NONE", Const, 1},
+		{"BPF_T_NORMAL", Const, 1},
+		{"BPF_W", Const, 0},
+		{"BPF_X", Const, 0},
+		{"BRKINT", Const, 0},
+		{"Bind", Func, 0},
+		{"BindToDevice", Func, 0},
+		{"BpfBuflen", Func, 0},
+		{"BpfDatalink", Func, 0},
+		{"BpfHdr", Type, 0},
+		{"BpfHdr.Caplen", Field, 0},
+		{"BpfHdr.Datalen", Field, 0},
+		{"BpfHdr.Hdrlen", Field, 0},
+		{"BpfHdr.Pad_cgo_0", Field, 0},
+		{"BpfHdr.Tstamp", Field, 0},
+		{"BpfHeadercmpl", Func, 0},
+		{"BpfInsn", Type, 0},
+		{"BpfInsn.Code", Field, 0},
+		{"BpfInsn.Jf", Field, 0},
+		{"BpfInsn.Jt", Field, 0},
+		{"BpfInsn.K", Field, 0},
+		{"BpfInterface", Func, 0},
+		{"BpfJump", Func, 0},
+		{"BpfProgram", Type, 0},
+		{"BpfProgram.Insns", Field, 0},
+		{"BpfProgram.Len", Field, 0},
+		{"BpfProgram.Pad_cgo_0", Field, 0},
+		{"BpfStat", Type, 0},
+		{"BpfStat.Capt", Field, 2},
+		{"BpfStat.Drop", Field, 0},
+		{"BpfStat.Padding", Field, 2},
+		{"BpfStat.Recv", Field, 0},
+		{"BpfStats", Func, 0},
+		{"BpfStmt", Func, 0},
+		{"BpfTimeout", Func, 0},
+		{"BpfTimeval", Type, 2},
+		{"BpfTimeval.Sec", Field, 2},
+		{"BpfTimeval.Usec", Field, 2},
+		{"BpfVersion", Type, 0},
+		{"BpfVersion.Major", Field, 0},
+		{"BpfVersion.Minor", Field, 0},
+		{"BpfZbuf", Type, 0},
+		{"BpfZbuf.Bufa", Field, 0},
+		{"BpfZbuf.Bufb", Field, 0},
+		{"BpfZbuf.Buflen", Field, 0},
+		{"BpfZbufHeader", Type, 0},
+		{"BpfZbufHeader.Kernel_gen", Field, 0},
+		{"BpfZbufHeader.Kernel_len", Field, 0},
+		{"BpfZbufHeader.User_gen", Field, 0},
+		{"BpfZbufHeader.X_bzh_pad", Field, 0},
+		{"ByHandleFileInformation", Type, 0},
+		{"ByHandleFileInformation.CreationTime", Field, 0},
+		{"ByHandleFileInformation.FileAttributes", Field, 0},
+		{"ByHandleFileInformation.FileIndexHigh", Field, 0},
+		{"ByHandleFileInformation.FileIndexLow", Field, 0},
+		{"ByHandleFileInformation.FileSizeHigh", Field, 0},
+		{"ByHandleFileInformation.FileSizeLow", Field, 0},
+		{"ByHandleFileInformation.LastAccessTime", Field, 0},
+		{"ByHandleFileInformation.LastWriteTime", Field, 0},
+		{"ByHandleFileInformation.NumberOfLinks", Field, 0},
+		{"ByHandleFileInformation.VolumeSerialNumber", Field, 0},
+		{"BytePtrFromString", Func, 1},
+		{"ByteSliceFromString", Func, 1},
+		{"CCR0_FLUSH", Const, 1},
+		{"CERT_CHAIN_POLICY_AUTHENTICODE", Const, 0},
+		{"CERT_CHAIN_POLICY_AUTHENTICODE_TS", Const, 0},
+		{"CERT_CHAIN_POLICY_BASE", Const, 0},
+		{"CERT_CHAIN_POLICY_BASIC_CONSTRAINTS", Const, 0},
+		{"CERT_CHAIN_POLICY_EV", Const, 0},
+		{"CERT_CHAIN_POLICY_MICROSOFT_ROOT", Const, 0},
+		{"CERT_CHAIN_POLICY_NT_AUTH", Const, 0},
+		{"CERT_CHAIN_POLICY_SSL", Const, 0},
+		{"CERT_E_CN_NO_MATCH", Const, 0},
+		{"CERT_E_EXPIRED", Const, 0},
+		{"CERT_E_PURPOSE", Const, 0},
+		{"CERT_E_ROLE", Const, 0},
+		{"CERT_E_UNTRUSTEDROOT", Const, 0},
+		{"CERT_STORE_ADD_ALWAYS", Const, 0},
+		{"CERT_STORE_DEFER_CLOSE_UNTIL_LAST_FREE_FLAG", Const, 0},
+		{"CERT_STORE_PROV_MEMORY", Const, 0},
+		{"CERT_TRUST_HAS_EXCLUDED_NAME_CONSTRAINT", Const, 0},
+		{"CERT_TRUST_HAS_NOT_DEFINED_NAME_CONSTRAINT", Const, 0},
+		{"CERT_TRUST_HAS_NOT_PERMITTED_NAME_CONSTRAINT", Const, 0},
+		{"CERT_TRUST_HAS_NOT_SUPPORTED_CRITICAL_EXT", Const, 0},
+		{"CERT_TRUST_HAS_NOT_SUPPORTED_NAME_CONSTRAINT", Const, 0},
+		{"CERT_TRUST_INVALID_BASIC_CONSTRAINTS", Const, 0},
+		{"CERT_TRUST_INVALID_EXTENSION", Const, 0},
+		{"CERT_TRUST_INVALID_NAME_CONSTRAINTS", Const, 0},
+		{"CERT_TRUST_INVALID_POLICY_CONSTRAINTS", Const, 0},
+		{"CERT_TRUST_IS_CYCLIC", Const, 0},
+		{"CERT_TRUST_IS_EXPLICIT_DISTRUST", Const, 0},
+		{"CERT_TRUST_IS_NOT_SIGNATURE_VALID", Const, 0},
+		{"CERT_TRUST_IS_NOT_TIME_VALID", Const, 0},
+		{"CERT_TRUST_IS_NOT_VALID_FOR_USAGE", Const, 0},
+		{"CERT_TRUST_IS_OFFLINE_REVOCATION", Const, 0},
+		{"CERT_TRUST_IS_REVOKED", Const, 0},
+		{"CERT_TRUST_IS_UNTRUSTED_ROOT", Const, 0},
+		{"CERT_TRUST_NO_ERROR", Const, 0},
+		{"CERT_TRUST_NO_ISSUANCE_CHAIN_POLICY", Const, 0},
+		{"CERT_TRUST_REVOCATION_STATUS_UNKNOWN", Const, 0},
+		{"CFLUSH", Const, 1},
+		{"CLOCAL", Const, 0},
+		{"CLONE_CHILD_CLEARTID", Const, 2},
+		{"CLONE_CHILD_SETTID", Const, 2},
+		{"CLONE_CLEAR_SIGHAND", Const, 20},
+		{"CLONE_CSIGNAL", Const, 3},
+		{"CLONE_DETACHED", Const, 2},
+		{"CLONE_FILES", Const, 2},
+		{"CLONE_FS", Const, 2},
+		{"CLONE_INTO_CGROUP", Const, 20},
+		{"CLONE_IO", Const, 2},
+		{"CLONE_NEWCGROUP", Const, 20},
+		{"CLONE_NEWIPC", Const, 2},
+		{"CLONE_NEWNET", Const, 2},
+		{"CLONE_NEWNS", Const, 2},
+		{"CLONE_NEWPID", Const, 2},
+		{"CLONE_NEWTIME", Const, 20},
+		{"CLONE_NEWUSER", Const, 2},
+		{"CLONE_NEWUTS", Const, 2},
+		{"CLONE_PARENT", Const, 2},
+		{"CLONE_PARENT_SETTID", Const, 2},
+		{"CLONE_PID", Const, 3},
+		{"CLONE_PIDFD", Const, 20},
+		{"CLONE_PTRACE", Const, 2},
+		{"CLONE_SETTLS", Const, 2},
+		{"CLONE_SIGHAND", Const, 2},
+		{"CLONE_SYSVSEM", Const, 2},
+		{"CLONE_THREAD", Const, 2},
+		{"CLONE_UNTRACED", Const, 2},
+		{"CLONE_VFORK", Const, 2},
+		{"CLONE_VM", Const, 2},
+		{"CPUID_CFLUSH", Const, 1},
+		{"CREAD", Const, 0},
+		{"CREATE_ALWAYS", Const, 0},
+		{"CREATE_NEW", Const, 0},
+		{"CREATE_NEW_PROCESS_GROUP", Const, 1},
+		{"CREATE_UNICODE_ENVIRONMENT", Const, 0},
+		{"CRYPT_DEFAULT_CONTAINER_OPTIONAL", Const, 0},
+		{"CRYPT_DELETEKEYSET", Const, 0},
+		{"CRYPT_MACHINE_KEYSET", Const, 0},
+		{"CRYPT_NEWKEYSET", Const, 0},
+		{"CRYPT_SILENT", Const, 0},
+		{"CRYPT_VERIFYCONTEXT", Const, 0},
+		{"CS5", Const, 0},
+		{"CS6", Const, 0},
+		{"CS7", Const, 0},
+		{"CS8", Const, 0},
+		{"CSIZE", Const, 0},
+		{"CSTART", Const, 1},
+		{"CSTATUS", Const, 1},
+		{"CSTOP", Const, 1},
+		{"CSTOPB", Const, 0},
+		{"CSUSP", Const, 1},
+		{"CTL_MAXNAME", Const, 0},
+		{"CTL_NET", Const, 0},
+		{"CTL_QUERY", Const, 1},
+		{"CTRL_BREAK_EVENT", Const, 1},
+		{"CTRL_CLOSE_EVENT", Const, 14},
+		{"CTRL_C_EVENT", Const, 1},
+		{"CTRL_LOGOFF_EVENT", Const, 14},
+		{"CTRL_SHUTDOWN_EVENT", Const, 14},
+		{"CancelIo", Func, 0},
+		{"CancelIoEx", Func, 1},
+		{"CertAddCertificateContextToStore", Func, 0},
+		{"CertChainContext", Type, 0},
+		{"CertChainContext.ChainCount", Field, 0},
+		{"CertChainContext.Chains", Field, 0},
+		{"CertChainContext.HasRevocationFreshnessTime", Field, 0},
+		{"CertChainContext.LowerQualityChainCount", Field, 0},
+		{"CertChainContext.LowerQualityChains", Field, 0},
+		{"CertChainContext.RevocationFreshnessTime", Field, 0},
+		{"CertChainContext.Size", Field, 0},
+		{"CertChainContext.TrustStatus", Field, 0},
+		{"CertChainElement", Type, 0},
+		{"CertChainElement.ApplicationUsage", Field, 0},
+		{"CertChainElement.CertContext", Field, 0},
+		{"CertChainElement.ExtendedErrorInfo", Field, 0},
+		{"CertChainElement.IssuanceUsage", Field, 0},
+		{"CertChainElement.RevocationInfo", Field, 0},
+		{"CertChainElement.Size", Field, 0},
+		{"CertChainElement.TrustStatus", Field, 0},
+		{"CertChainPara", Type, 0},
+		{"CertChainPara.CacheResync", Field, 0},
+		{"CertChainPara.CheckRevocationFreshnessTime", Field, 0},
+		{"CertChainPara.RequestedUsage", Field, 0},
+		{"CertChainPara.RequstedIssuancePolicy", Field, 0},
+		{"CertChainPara.RevocationFreshnessTime", Field, 0},
+		{"CertChainPara.Size", Field, 0},
+		{"CertChainPara.URLRetrievalTimeout", Field, 0},
+		{"CertChainPolicyPara", Type, 0},
+		{"CertChainPolicyPara.ExtraPolicyPara", Field, 0},
+		{"CertChainPolicyPara.Flags", Field, 0},
+		{"CertChainPolicyPara.Size", Field, 0},
+		{"CertChainPolicyStatus", Type, 0},
+		{"CertChainPolicyStatus.ChainIndex", Field, 0},
+		{"CertChainPolicyStatus.ElementIndex", Field, 0},
+		{"CertChainPolicyStatus.Error", Field, 0},
+		{"CertChainPolicyStatus.ExtraPolicyStatus", Field, 0},
+		{"CertChainPolicyStatus.Size", Field, 0},
+		{"CertCloseStore", Func, 0},
+		{"CertContext", Type, 0},
+		{"CertContext.CertInfo", Field, 0},
+		{"CertContext.EncodedCert", Field, 0},
+		{"CertContext.EncodingType", Field, 0},
+		{"CertContext.Length", Field, 0},
+		{"CertContext.Store", Field, 0},
+		{"CertCreateCertificateContext", Func, 0},
+		{"CertEnhKeyUsage", Type, 0},
+		{"CertEnhKeyUsage.Length", Field, 0},
+		{"CertEnhKeyUsage.UsageIdentifiers", Field, 0},
+		{"CertEnumCertificatesInStore", Func, 0},
+		{"CertFreeCertificateChain", Func, 0},
+		{"CertFreeCertificateContext", Func, 0},
+		{"CertGetCertificateChain", Func, 0},
+		{"CertInfo", Type, 11},
+		{"CertOpenStore", Func, 0},
+		{"CertOpenSystemStore", Func, 0},
+		{"CertRevocationCrlInfo", Type, 11},
+		{"CertRevocationInfo", Type, 0},
+		{"CertRevocationInfo.CrlInfo", Field, 0},
+		{"CertRevocationInfo.FreshnessTime", Field, 0},
+		{"CertRevocationInfo.HasFreshnessTime", Field, 0},
+		{"CertRevocationInfo.OidSpecificInfo", Field, 0},
+		{"CertRevocationInfo.RevocationOid", Field, 0},
+		{"CertRevocationInfo.RevocationResult", Field, 0},
+		{"CertRevocationInfo.Size", Field, 0},
+		{"CertSimpleChain", Type, 0},
+		{"CertSimpleChain.Elements", Field, 0},
+		{"CertSimpleChain.HasRevocationFreshnessTime", Field, 0},
+		{"CertSimpleChain.NumElements", Field, 0},
+		{"CertSimpleChain.RevocationFreshnessTime", Field, 0},
+		{"CertSimpleChain.Size", Field, 0},
+		{"CertSimpleChain.TrustListInfo", Field, 0},
+		{"CertSimpleChain.TrustStatus", Field, 0},
+		{"CertTrustListInfo", Type, 11},
+		{"CertTrustStatus", Type, 0},
+		{"CertTrustStatus.ErrorStatus", Field, 0},
+		{"CertTrustStatus.InfoStatus", Field, 0},
+		{"CertUsageMatch", Type, 0},
+		{"CertUsageMatch.Type", Field, 0},
+		{"CertUsageMatch.Usage", Field, 0},
+		{"CertVerifyCertificateChainPolicy", Func, 0},
+		{"Chdir", Func, 0},
+		{"CheckBpfVersion", Func, 0},
+		{"Chflags", Func, 0},
+		{"Chmod", Func, 0},
+		{"Chown", Func, 0},
+		{"Chroot", Func, 0},
+		{"Clearenv", Func, 0},
+		{"Close", Func, 0},
+		{"CloseHandle", Func, 0},
+		{"CloseOnExec", Func, 0},
+		{"Closesocket", Func, 0},
+		{"CmsgLen", Func, 0},
+		{"CmsgSpace", Func, 0},
+		{"Cmsghdr", Type, 0},
+		{"Cmsghdr.Len", Field, 0},
+		{"Cmsghdr.Level", Field, 0},
+		{"Cmsghdr.Type", Field, 0},
+		{"Cmsghdr.X__cmsg_data", Field, 0},
+		{"CommandLineToArgv", Func, 0},
+		{"ComputerName", Func, 0},
+		{"Conn", Type, 9},
+		{"Connect", Func, 0},
+		{"ConnectEx", Func, 1},
+		{"ConvertSidToStringSid", Func, 0},
+		{"ConvertStringSidToSid", Func, 0},
+		{"CopySid", Func, 0},
+		{"Creat", Func, 0},
+		{"CreateDirectory", Func, 0},
+		{"CreateFile", Func, 0},
+		{"CreateFileMapping", Func, 0},
+		{"CreateHardLink", Func, 4},
+		{"CreateIoCompletionPort", Func, 0},
+		{"CreatePipe", Func, 0},
+		{"CreateProcess", Func, 0},
+		{"CreateProcessAsUser", Func, 10},
+		{"CreateSymbolicLink", Func, 4},
+		{"CreateToolhelp32Snapshot", Func, 4},
+		{"Credential", Type, 0},
+		{"Credential.Gid", Field, 0},
+		{"Credential.Groups", Field, 0},
+		{"Credential.NoSetGroups", Field, 9},
+		{"Credential.Uid", Field, 0},
+		{"CryptAcquireContext", Func, 0},
+		{"CryptGenRandom", Func, 0},
+		{"CryptReleaseContext", Func, 0},
+		{"DIOCBSFLUSH", Const, 1},
+		{"DIOCOSFPFLUSH", Const, 1},
+		{"DLL", Type, 0},
+		{"DLL.Handle", Field, 0},
+		{"DLL.Name", Field, 0},
+		{"DLLError", Type, 0},
+		{"DLLError.Err", Field, 0},
+		{"DLLError.Msg", Field, 0},
+		{"DLLError.ObjName", Field, 0},
+		{"DLT_A429", Const, 0},
+		{"DLT_A653_ICM", Const, 0},
+		{"DLT_AIRONET_HEADER", Const, 0},
+		{"DLT_AOS", Const, 1},
+		{"DLT_APPLE_IP_OVER_IEEE1394", Const, 0},
+		{"DLT_ARCNET", Const, 0},
+		{"DLT_ARCNET_LINUX", Const, 0},
+		{"DLT_ATM_CLIP", Const, 0},
+		{"DLT_ATM_RFC1483", Const, 0},
+		{"DLT_AURORA", Const, 0},
+		{"DLT_AX25", Const, 0},
+		{"DLT_AX25_KISS", Const, 0},
+		{"DLT_BACNET_MS_TP", Const, 0},
+		{"DLT_BLUETOOTH_HCI_H4", Const, 0},
+		{"DLT_BLUETOOTH_HCI_H4_WITH_PHDR", Const, 0},
+		{"DLT_CAN20B", Const, 0},
+		{"DLT_CAN_SOCKETCAN", Const, 1},
+		{"DLT_CHAOS", Const, 0},
+		{"DLT_CHDLC", Const, 0},
+		{"DLT_CISCO_IOS", Const, 0},
+		{"DLT_C_HDLC", Const, 0},
+		{"DLT_C_HDLC_WITH_DIR", Const, 0},
+		{"DLT_DBUS", Const, 1},
+		{"DLT_DECT", Const, 1},
+		{"DLT_DOCSIS", Const, 0},
+		{"DLT_DVB_CI", Const, 1},
+		{"DLT_ECONET", Const, 0},
+		{"DLT_EN10MB", Const, 0},
+		{"DLT_EN3MB", Const, 0},
+		{"DLT_ENC", Const, 0},
+		{"DLT_ERF", Const, 0},
+		{"DLT_ERF_ETH", Const, 0},
+		{"DLT_ERF_POS", Const, 0},
+		{"DLT_FC_2", Const, 1},
+		{"DLT_FC_2_WITH_FRAME_DELIMS", Const, 1},
+		{"DLT_FDDI", Const, 0},
+		{"DLT_FLEXRAY", Const, 0},
+		{"DLT_FRELAY", Const, 0},
+		{"DLT_FRELAY_WITH_DIR", Const, 0},
+		{"DLT_GCOM_SERIAL", Const, 0},
+		{"DLT_GCOM_T1E1", Const, 0},
+		{"DLT_GPF_F", Const, 0},
+		{"DLT_GPF_T", Const, 0},
+		{"DLT_GPRS_LLC", Const, 0},
+		{"DLT_GSMTAP_ABIS", Const, 1},
+		{"DLT_GSMTAP_UM", Const, 1},
+		{"DLT_HDLC", Const, 1},
+		{"DLT_HHDLC", Const, 0},
+		{"DLT_HIPPI", Const, 1},
+		{"DLT_IBM_SN", Const, 0},
+		{"DLT_IBM_SP", Const, 0},
+		{"DLT_IEEE802", Const, 0},
+		{"DLT_IEEE802_11", Const, 0},
+		{"DLT_IEEE802_11_RADIO", Const, 0},
+		{"DLT_IEEE802_11_RADIO_AVS", Const, 0},
+		{"DLT_IEEE802_15_4", Const, 0},
+		{"DLT_IEEE802_15_4_LINUX", Const, 0},
+		{"DLT_IEEE802_15_4_NOFCS", Const, 1},
+		{"DLT_IEEE802_15_4_NONASK_PHY", Const, 0},
+		{"DLT_IEEE802_16_MAC_CPS", Const, 0},
+		{"DLT_IEEE802_16_MAC_CPS_RADIO", Const, 0},
+		{"DLT_IPFILTER", Const, 0},
+		{"DLT_IPMB", Const, 0},
+		{"DLT_IPMB_LINUX", Const, 0},
+		{"DLT_IPNET", Const, 1},
+		{"DLT_IPOIB", Const, 1},
+		{"DLT_IPV4", Const, 1},
+		{"DLT_IPV6", Const, 1},
+		{"DLT_IP_OVER_FC", Const, 0},
+		{"DLT_JUNIPER_ATM1", Const, 0},
+		{"DLT_JUNIPER_ATM2", Const, 0},
+		{"DLT_JUNIPER_ATM_CEMIC", Const, 1},
+		{"DLT_JUNIPER_CHDLC", Const, 0},
+		{"DLT_JUNIPER_ES", Const, 0},
+		{"DLT_JUNIPER_ETHER", Const, 0},
+		{"DLT_JUNIPER_FIBRECHANNEL", Const, 1},
+		{"DLT_JUNIPER_FRELAY", Const, 0},
+		{"DLT_JUNIPER_GGSN", Const, 0},
+		{"DLT_JUNIPER_ISM", Const, 0},
+		{"DLT_JUNIPER_MFR", Const, 0},
+		{"DLT_JUNIPER_MLFR", Const, 0},
+		{"DLT_JUNIPER_MLPPP", Const, 0},
+		{"DLT_JUNIPER_MONITOR", Const, 0},
+		{"DLT_JUNIPER_PIC_PEER", Const, 0},
+		{"DLT_JUNIPER_PPP", Const, 0},
+		{"DLT_JUNIPER_PPPOE", Const, 0},
+		{"DLT_JUNIPER_PPPOE_ATM", Const, 0},
+		{"DLT_JUNIPER_SERVICES", Const, 0},
+		{"DLT_JUNIPER_SRX_E2E", Const, 1},
+		{"DLT_JUNIPER_ST", Const, 0},
+		{"DLT_JUNIPER_VP", Const, 0},
+		{"DLT_JUNIPER_VS", Const, 1},
+		{"DLT_LAPB_WITH_DIR", Const, 0},
+		{"DLT_LAPD", Const, 0},
+		{"DLT_LIN", Const, 0},
+		{"DLT_LINUX_EVDEV", Const, 1},
+		{"DLT_LINUX_IRDA", Const, 0},
+		{"DLT_LINUX_LAPD", Const, 0},
+		{"DLT_LINUX_PPP_WITHDIRECTION", Const, 0},
+		{"DLT_LINUX_SLL", Const, 0},
+		{"DLT_LOOP", Const, 0},
+		{"DLT_LTALK", Const, 0},
+		{"DLT_MATCHING_MAX", Const, 1},
+		{"DLT_MATCHING_MIN", Const, 1},
+		{"DLT_MFR", Const, 0},
+		{"DLT_MOST", Const, 0},
+		{"DLT_MPEG_2_TS", Const, 1},
+		{"DLT_MPLS", Const, 1},
+		{"DLT_MTP2", Const, 0},
+		{"DLT_MTP2_WITH_PHDR", Const, 0},
+		{"DLT_MTP3", Const, 0},
+		{"DLT_MUX27010", Const, 1},
+		{"DLT_NETANALYZER", Const, 1},
+		{"DLT_NETANALYZER_TRANSPARENT", Const, 1},
+		{"DLT_NFC_LLCP", Const, 1},
+		{"DLT_NFLOG", Const, 1},
+		{"DLT_NG40", Const, 1},
+		{"DLT_NULL", Const, 0},
+		{"DLT_PCI_EXP", Const, 0},
+		{"DLT_PFLOG", Const, 0},
+		{"DLT_PFSYNC", Const, 0},
+		{"DLT_PPI", Const, 0},
+		{"DLT_PPP", Const, 0},
+		{"DLT_PPP_BSDOS", Const, 0},
+		{"DLT_PPP_ETHER", Const, 0},
+		{"DLT_PPP_PPPD", Const, 0},
+		{"DLT_PPP_SERIAL", Const, 0},
+		{"DLT_PPP_WITH_DIR", Const, 0},
+		{"DLT_PPP_WITH_DIRECTION", Const, 0},
+		{"DLT_PRISM_HEADER", Const, 0},
+		{"DLT_PRONET", Const, 0},
+		{"DLT_RAIF1", Const, 0},
+		{"DLT_RAW", Const, 0},
+		{"DLT_RAWAF_MASK", Const, 1},
+		{"DLT_RIO", Const, 0},
+		{"DLT_SCCP", Const, 0},
+		{"DLT_SITA", Const, 0},
+		{"DLT_SLIP", Const, 0},
+		{"DLT_SLIP_BSDOS", Const, 0},
+		{"DLT_STANAG_5066_D_PDU", Const, 1},
+		{"DLT_SUNATM", Const, 0},
+		{"DLT_SYMANTEC_FIREWALL", Const, 0},
+		{"DLT_TZSP", Const, 0},
+		{"DLT_USB", Const, 0},
+		{"DLT_USB_LINUX", Const, 0},
+		{"DLT_USB_LINUX_MMAPPED", Const, 1},
+		{"DLT_USER0", Const, 0},
+		{"DLT_USER1", Const, 0},
+		{"DLT_USER10", Const, 0},
+		{"DLT_USER11", Const, 0},
+		{"DLT_USER12", Const, 0},
+		{"DLT_USER13", Const, 0},
+		{"DLT_USER14", Const, 0},
+		{"DLT_USER15", Const, 0},
+		{"DLT_USER2", Const, 0},
+		{"DLT_USER3", Const, 0},
+		{"DLT_USER4", Const, 0},
+		{"DLT_USER5", Const, 0},
+		{"DLT_USER6", Const, 0},
+		{"DLT_USER7", Const, 0},
+		{"DLT_USER8", Const, 0},
+		{"DLT_USER9", Const, 0},
+		{"DLT_WIHART", Const, 1},
+		{"DLT_X2E_SERIAL", Const, 0},
+		{"DLT_X2E_XORAYA", Const, 0},
+		{"DNSMXData", Type, 0},
+		{"DNSMXData.NameExchange", Field, 0},
+		{"DNSMXData.Pad", Field, 0},
+		{"DNSMXData.Preference", Field, 0},
+		{"DNSPTRData", Type, 0},
+		{"DNSPTRData.Host", Field, 0},
+		{"DNSRecord", Type, 0},
+		{"DNSRecord.Data", Field, 0},
+		{"DNSRecord.Dw", Field, 0},
+		{"DNSRecord.Length", Field, 0},
+		{"DNSRecord.Name", Field, 0},
+		{"DNSRecord.Next", Field, 0},
+		{"DNSRecord.Reserved", Field, 0},
+		{"DNSRecord.Ttl", Field, 0},
+		{"DNSRecord.Type", Field, 0},
+		{"DNSSRVData", Type, 0},
+		{"DNSSRVData.Pad", Field, 0},
+		{"DNSSRVData.Port", Field, 0},
+		{"DNSSRVData.Priority", Field, 0},
+		{"DNSSRVData.Target", Field, 0},
+		{"DNSSRVData.Weight", Field, 0},
+		{"DNSTXTData", Type, 0},
+		{"DNSTXTData.StringArray", Field, 0},
+		{"DNSTXTData.StringCount", Field, 0},
+		{"DNS_INFO_NO_RECORDS", Const, 4},
+		{"DNS_TYPE_A", Const, 0},
+		{"DNS_TYPE_A6", Const, 0},
+		{"DNS_TYPE_AAAA", Const, 0},
+		{"DNS_TYPE_ADDRS", Const, 0},
+		{"DNS_TYPE_AFSDB", Const, 0},
+		{"DNS_TYPE_ALL", Const, 0},
+		{"DNS_TYPE_ANY", Const, 0},
+		{"DNS_TYPE_ATMA", Const, 0},
+		{"DNS_TYPE_AXFR", Const, 0},
+		{"DNS_TYPE_CERT", Const, 0},
+		{"DNS_TYPE_CNAME", Const, 0},
+		{"DNS_TYPE_DHCID", Const, 0},
+		{"DNS_TYPE_DNAME", Const, 0},
+		{"DNS_TYPE_DNSKEY", Const, 0},
+		{"DNS_TYPE_DS", Const, 0},
+		{"DNS_TYPE_EID", Const, 0},
+		{"DNS_TYPE_GID", Const, 0},
+		{"DNS_TYPE_GPOS", Const, 0},
+		{"DNS_TYPE_HINFO", Const, 0},
+		{"DNS_TYPE_ISDN", Const, 0},
+		{"DNS_TYPE_IXFR", Const, 0},
+		{"DNS_TYPE_KEY", Const, 0},
+		{"DNS_TYPE_KX", Const, 0},
+		{"DNS_TYPE_LOC", Const, 0},
+		{"DNS_TYPE_MAILA", Const, 0},
+		{"DNS_TYPE_MAILB", Const, 0},
+		{"DNS_TYPE_MB", Const, 0},
+		{"DNS_TYPE_MD", Const, 0},
+		{"DNS_TYPE_MF", Const, 0},
+		{"DNS_TYPE_MG", Const, 0},
+		{"DNS_TYPE_MINFO", Const, 0},
+		{"DNS_TYPE_MR", Const, 0},
+		{"DNS_TYPE_MX", Const, 0},
+		{"DNS_TYPE_NAPTR", Const, 0},
+		{"DNS_TYPE_NBSTAT", Const, 0},
+		{"DNS_TYPE_NIMLOC", Const, 0},
+		{"DNS_TYPE_NS", Const, 0},
+		{"DNS_TYPE_NSAP", Const, 0},
+		{"DNS_TYPE_NSAPPTR", Const, 0},
+		{"DNS_TYPE_NSEC", Const, 0},
+		{"DNS_TYPE_NULL", Const, 0},
+		{"DNS_TYPE_NXT", Const, 0},
+		{"DNS_TYPE_OPT", Const, 0},
+		{"DNS_TYPE_PTR", Const, 0},
+		{"DNS_TYPE_PX", Const, 0},
+		{"DNS_TYPE_RP", Const, 0},
+		{"DNS_TYPE_RRSIG", Const, 0},
+		{"DNS_TYPE_RT", Const, 0},
+		{"DNS_TYPE_SIG", Const, 0},
+		{"DNS_TYPE_SINK", Const, 0},
+		{"DNS_TYPE_SOA", Const, 0},
+		{"DNS_TYPE_SRV", Const, 0},
+		{"DNS_TYPE_TEXT", Const, 0},
+		{"DNS_TYPE_TKEY", Const, 0},
+		{"DNS_TYPE_TSIG", Const, 0},
+		{"DNS_TYPE_UID", Const, 0},
+		{"DNS_TYPE_UINFO", Const, 0},
+		{"DNS_TYPE_UNSPEC", Const, 0},
+		{"DNS_TYPE_WINS", Const, 0},
+		{"DNS_TYPE_WINSR", Const, 0},
+		{"DNS_TYPE_WKS", Const, 0},
+		{"DNS_TYPE_X25", Const, 0},
+		{"DT_BLK", Const, 0},
+		{"DT_CHR", Const, 0},
+		{"DT_DIR", Const, 0},
+		{"DT_FIFO", Const, 0},
+		{"DT_LNK", Const, 0},
+		{"DT_REG", Const, 0},
+		{"DT_SOCK", Const, 0},
+		{"DT_UNKNOWN", Const, 0},
+		{"DT_WHT", Const, 0},
+		{"DUPLICATE_CLOSE_SOURCE", Const, 0},
+		{"DUPLICATE_SAME_ACCESS", Const, 0},
+		{"DeleteFile", Func, 0},
+		{"DetachLsf", Func, 0},
+		{"DeviceIoControl", Func, 4},
+		{"Dirent", Type, 0},
+		{"Dirent.Fileno", Field, 0},
+		{"Dirent.Ino", Field, 0},
+		{"Dirent.Name", Field, 0},
+		{"Dirent.Namlen", Field, 0},
+		{"Dirent.Off", Field, 0},
+		{"Dirent.Pad0", Field, 12},
+		{"Dirent.Pad1", Field, 12},
+		{"Dirent.Pad_cgo_0", Field, 0},
+		{"Dirent.Reclen", Field, 0},
+		{"Dirent.Seekoff", Field, 0},
+		{"Dirent.Type", Field, 0},
+		{"Dirent.X__d_padding", Field, 3},
+		{"DnsNameCompare", Func, 4},
+		{"DnsQuery", Func, 0},
+		{"DnsRecordListFree", Func, 0},
+		{"DnsSectionAdditional", Const, 4},
+		{"DnsSectionAnswer", Const, 4},
+		{"DnsSectionAuthority", Const, 4},
+		{"DnsSectionQuestion", Const, 4},
+		{"Dup", Func, 0},
+		{"Dup2", Func, 0},
+		{"Dup3", Func, 2},
+		{"DuplicateHandle", Func, 0},
+		{"E2BIG", Const, 0},
+		{"EACCES", Const, 0},
+		{"EADDRINUSE", Const, 0},
+		{"EADDRNOTAVAIL", Const, 0},
+		{"EADV", Const, 0},
+		{"EAFNOSUPPORT", Const, 0},
+		{"EAGAIN", Const, 0},
+		{"EALREADY", Const, 0},
+		{"EAUTH", Const, 0},
+		{"EBADARCH", Const, 0},
+		{"EBADE", Const, 0},
+		{"EBADEXEC", Const, 0},
+		{"EBADF", Const, 0},
+		{"EBADFD", Const, 0},
+		{"EBADMACHO", Const, 0},
+		{"EBADMSG", Const, 0},
+		{"EBADR", Const, 0},
+		{"EBADRPC", Const, 0},
+		{"EBADRQC", Const, 0},
+		{"EBADSLT", Const, 0},
+		{"EBFONT", Const, 0},
+		{"EBUSY", Const, 0},
+		{"ECANCELED", Const, 0},
+		{"ECAPMODE", Const, 1},
+		{"ECHILD", Const, 0},
+		{"ECHO", Const, 0},
+		{"ECHOCTL", Const, 0},
+		{"ECHOE", Const, 0},
+		{"ECHOK", Const, 0},
+		{"ECHOKE", Const, 0},
+		{"ECHONL", Const, 0},
+		{"ECHOPRT", Const, 0},
+		{"ECHRNG", Const, 0},
+		{"ECOMM", Const, 0},
+		{"ECONNABORTED", Const, 0},
+		{"ECONNREFUSED", Const, 0},
+		{"ECONNRESET", Const, 0},
+		{"EDEADLK", Const, 0},
+		{"EDEADLOCK", Const, 0},
+		{"EDESTADDRREQ", Const, 0},
+		{"EDEVERR", Const, 0},
+		{"EDOM", Const, 0},
+		{"EDOOFUS", Const, 0},
+		{"EDOTDOT", Const, 0},
+		{"EDQUOT", Const, 0},
+		{"EEXIST", Const, 0},
+		{"EFAULT", Const, 0},
+		{"EFBIG", Const, 0},
+		{"EFER_LMA", Const, 1},
+		{"EFER_LME", Const, 1},
+		{"EFER_NXE", Const, 1},
+		{"EFER_SCE", Const, 1},
+		{"EFTYPE", Const, 0},
+		{"EHOSTDOWN", Const, 0},
+		{"EHOSTUNREACH", Const, 0},
+		{"EHWPOISON", Const, 0},
+		{"EIDRM", Const, 0},
+		{"EILSEQ", Const, 0},
+		{"EINPROGRESS", Const, 0},
+		{"EINTR", Const, 0},
+		{"EINVAL", Const, 0},
+		{"EIO", Const, 0},
+		{"EIPSEC", Const, 1},
+		{"EISCONN", Const, 0},
+		{"EISDIR", Const, 0},
+		{"EISNAM", Const, 0},
+		{"EKEYEXPIRED", Const, 0},
+		{"EKEYREJECTED", Const, 0},
+		{"EKEYREVOKED", Const, 0},
+		{"EL2HLT", Const, 0},
+		{"EL2NSYNC", Const, 0},
+		{"EL3HLT", Const, 0},
+		{"EL3RST", Const, 0},
+		{"ELAST", Const, 0},
+		{"ELF_NGREG", Const, 0},
+		{"ELF_PRARGSZ", Const, 0},
+		{"ELIBACC", Const, 0},
+		{"ELIBBAD", Const, 0},
+		{"ELIBEXEC", Const, 0},
+		{"ELIBMAX", Const, 0},
+		{"ELIBSCN", Const, 0},
+		{"ELNRNG", Const, 0},
+		{"ELOOP", Const, 0},
+		{"EMEDIUMTYPE", Const, 0},
+		{"EMFILE", Const, 0},
+		{"EMLINK", Const, 0},
+		{"EMSGSIZE", Const, 0},
+		{"EMT_TAGOVF", Const, 1},
+		{"EMULTIHOP", Const, 0},
+		{"EMUL_ENABLED", Const, 1},
+		{"EMUL_LINUX", Const, 1},
+		{"EMUL_LINUX32", Const, 1},
+		{"EMUL_MAXID", Const, 1},
+		{"EMUL_NATIVE", Const, 1},
+		{"ENAMETOOLONG", Const, 0},
+		{"ENAVAIL", Const, 0},
+		{"ENDRUNDISC", Const, 1},
+		{"ENEEDAUTH", Const, 0},
+		{"ENETDOWN", Const, 0},
+		{"ENETRESET", Const, 0},
+		{"ENETUNREACH", Const, 0},
+		{"ENFILE", Const, 0},
+		{"ENOANO", Const, 0},
+		{"ENOATTR", Const, 0},
+		{"ENOBUFS", Const, 0},
+		{"ENOCSI", Const, 0},
+		{"ENODATA", Const, 0},
+		{"ENODEV", Const, 0},
+		{"ENOENT", Const, 0},
+		{"ENOEXEC", Const, 0},
+		{"ENOKEY", Const, 0},
+		{"ENOLCK", Const, 0},
+		{"ENOLINK", Const, 0},
+		{"ENOMEDIUM", Const, 0},
+		{"ENOMEM", Const, 0},
+		{"ENOMSG", Const, 0},
+		{"ENONET", Const, 0},
+		{"ENOPKG", Const, 0},
+		{"ENOPOLICY", Const, 0},
+		{"ENOPROTOOPT", Const, 0},
+		{"ENOSPC", Const, 0},
+		{"ENOSR", Const, 0},
+		{"ENOSTR", Const, 0},
+		{"ENOSYS", Const, 0},
+		{"ENOTBLK", Const, 0},
+		{"ENOTCAPABLE", Const, 0},
+		{"ENOTCONN", Const, 0},
+		{"ENOTDIR", Const, 0},
+		{"ENOTEMPTY", Const, 0},
+		{"ENOTNAM", Const, 0},
+		{"ENOTRECOVERABLE", Const, 0},
+		{"ENOTSOCK", Const, 0},
+		{"ENOTSUP", Const, 0},
+		{"ENOTTY", Const, 0},
+		{"ENOTUNIQ", Const, 0},
+		{"ENXIO", Const, 0},
+		{"EN_SW_CTL_INF", Const, 1},
+		{"EN_SW_CTL_PREC", Const, 1},
+		{"EN_SW_CTL_ROUND", Const, 1},
+		{"EN_SW_DATACHAIN", Const, 1},
+		{"EN_SW_DENORM", Const, 1},
+		{"EN_SW_INVOP", Const, 1},
+		{"EN_SW_OVERFLOW", Const, 1},
+		{"EN_SW_PRECLOSS", Const, 1},
+		{"EN_SW_UNDERFLOW", Const, 1},
+		{"EN_SW_ZERODIV", Const, 1},
+		{"EOPNOTSUPP", Const, 0},
+		{"EOVERFLOW", Const, 0},
+		{"EOWNERDEAD", Const, 0},
+		{"EPERM", Const, 0},
+		{"EPFNOSUPPORT", Const, 0},
+		{"EPIPE", Const, 0},
+		{"EPOLLERR", Const, 0},
+		{"EPOLLET", Const, 0},
+		{"EPOLLHUP", Const, 0},
+		{"EPOLLIN", Const, 0},
+		{"EPOLLMSG", Const, 0},
+		{"EPOLLONESHOT", Const, 0},
+		{"EPOLLOUT", Const, 0},
+		{"EPOLLPRI", Const, 0},
+		{"EPOLLRDBAND", Const, 0},
+		{"EPOLLRDHUP", Const, 0},
+		{"EPOLLRDNORM", Const, 0},
+		{"EPOLLWRBAND", Const, 0},
+		{"EPOLLWRNORM", Const, 0},
+		{"EPOLL_CLOEXEC", Const, 0},
+		{"EPOLL_CTL_ADD", Const, 0},
+		{"EPOLL_CTL_DEL", Const, 0},
+		{"EPOLL_CTL_MOD", Const, 0},
+		{"EPOLL_NONBLOCK", Const, 0},
+		{"EPROCLIM", Const, 0},
+		{"EPROCUNAVAIL", Const, 0},
+		{"EPROGMISMATCH", Const, 0},
+		{"EPROGUNAVAIL", Const, 0},
+		{"EPROTO", Const, 0},
+		{"EPROTONOSUPPORT", Const, 0},
+		{"EPROTOTYPE", Const, 0},
+		{"EPWROFF", Const, 0},
+		{"EQFULL", Const, 16},
+		{"ERANGE", Const, 0},
+		{"EREMCHG", Const, 0},
+		{"EREMOTE", Const, 0},
+		{"EREMOTEIO", Const, 0},
+		{"ERESTART", Const, 0},
+		{"ERFKILL", Const, 0},
+		{"EROFS", Const, 0},
+		{"ERPCMISMATCH", Const, 0},
+		{"ERROR_ACCESS_DENIED", Const, 0},
+		{"ERROR_ALREADY_EXISTS", Const, 0},
+		{"ERROR_BROKEN_PIPE", Const, 0},
+		{"ERROR_BUFFER_OVERFLOW", Const, 0},
+		{"ERROR_DIR_NOT_EMPTY", Const, 8},
+		{"ERROR_ENVVAR_NOT_FOUND", Const, 0},
+		{"ERROR_FILE_EXISTS", Const, 0},
+		{"ERROR_FILE_NOT_FOUND", Const, 0},
+		{"ERROR_HANDLE_EOF", Const, 2},
+		{"ERROR_INSUFFICIENT_BUFFER", Const, 0},
+		{"ERROR_IO_PENDING", Const, 0},
+		{"ERROR_MOD_NOT_FOUND", Const, 0},
+		{"ERROR_MORE_DATA", Const, 3},
+		{"ERROR_NETNAME_DELETED", Const, 3},
+		{"ERROR_NOT_FOUND", Const, 1},
+		{"ERROR_NO_MORE_FILES", Const, 0},
+		{"ERROR_OPERATION_ABORTED", Const, 0},
+		{"ERROR_PATH_NOT_FOUND", Const, 0},
+		{"ERROR_PRIVILEGE_NOT_HELD", Const, 4},
+		{"ERROR_PROC_NOT_FOUND", Const, 0},
+		{"ESHLIBVERS", Const, 0},
+		{"ESHUTDOWN", Const, 0},
+		{"ESOCKTNOSUPPORT", Const, 0},
+		{"ESPIPE", Const, 0},
+		{"ESRCH", Const, 0},
+		{"ESRMNT", Const, 0},
+		{"ESTALE", Const, 0},
+		{"ESTRPIPE", Const, 0},
+		{"ETHERCAP_JUMBO_MTU", Const, 1},
+		{"ETHERCAP_VLAN_HWTAGGING", Const, 1},
+		{"ETHERCAP_VLAN_MTU", Const, 1},
+		{"ETHERMIN", Const, 1},
+		{"ETHERMTU", Const, 1},
+		{"ETHERMTU_JUMBO", Const, 1},
+		{"ETHERTYPE_8023", Const, 1},
+		{"ETHERTYPE_AARP", Const, 1},
+		{"ETHERTYPE_ACCTON", Const, 1},
+		{"ETHERTYPE_AEONIC", Const, 1},
+		{"ETHERTYPE_ALPHA", Const, 1},
+		{"ETHERTYPE_AMBER", Const, 1},
+		{"ETHERTYPE_AMOEBA", Const, 1},
+		{"ETHERTYPE_AOE", Const, 1},
+		{"ETHERTYPE_APOLLO", Const, 1},
+		{"ETHERTYPE_APOLLODOMAIN", Const, 1},
+		{"ETHERTYPE_APPLETALK", Const, 1},
+		{"ETHERTYPE_APPLITEK", Const, 1},
+		{"ETHERTYPE_ARGONAUT", Const, 1},
+		{"ETHERTYPE_ARP", Const, 1},
+		{"ETHERTYPE_AT", Const, 1},
+		{"ETHERTYPE_ATALK", Const, 1},
+		{"ETHERTYPE_ATOMIC", Const, 1},
+		{"ETHERTYPE_ATT", Const, 1},
+		{"ETHERTYPE_ATTSTANFORD", Const, 1},
+		{"ETHERTYPE_AUTOPHON", Const, 1},
+		{"ETHERTYPE_AXIS", Const, 1},
+		{"ETHERTYPE_BCLOOP", Const, 1},
+		{"ETHERTYPE_BOFL", Const, 1},
+		{"ETHERTYPE_CABLETRON", Const, 1},
+		{"ETHERTYPE_CHAOS", Const, 1},
+		{"ETHERTYPE_COMDESIGN", Const, 1},
+		{"ETHERTYPE_COMPUGRAPHIC", Const, 1},
+		{"ETHERTYPE_COUNTERPOINT", Const, 1},
+		{"ETHERTYPE_CRONUS", Const, 1},
+		{"ETHERTYPE_CRONUSVLN", Const, 1},
+		{"ETHERTYPE_DCA", Const, 1},
+		{"ETHERTYPE_DDE", Const, 1},
+		{"ETHERTYPE_DEBNI", Const, 1},
+		{"ETHERTYPE_DECAM", Const, 1},
+		{"ETHERTYPE_DECCUST", Const, 1},
+		{"ETHERTYPE_DECDIAG", Const, 1},
+		{"ETHERTYPE_DECDNS", Const, 1},
+		{"ETHERTYPE_DECDTS", Const, 1},
+		{"ETHERTYPE_DECEXPER", Const, 1},
+		{"ETHERTYPE_DECLAST", Const, 1},
+		{"ETHERTYPE_DECLTM", Const, 1},
+		{"ETHERTYPE_DECMUMPS", Const, 1},
+		{"ETHERTYPE_DECNETBIOS", Const, 1},
+		{"ETHERTYPE_DELTACON", Const, 1},
+		{"ETHERTYPE_DIDDLE", Const, 1},
+		{"ETHERTYPE_DLOG1", Const, 1},
+		{"ETHERTYPE_DLOG2", Const, 1},
+		{"ETHERTYPE_DN", Const, 1},
+		{"ETHERTYPE_DOGFIGHT", Const, 1},
+		{"ETHERTYPE_DSMD", Const, 1},
+		{"ETHERTYPE_ECMA", Const, 1},
+		{"ETHERTYPE_ENCRYPT", Const, 1},
+		{"ETHERTYPE_ES", Const, 1},
+		{"ETHERTYPE_EXCELAN", Const, 1},
+		{"ETHERTYPE_EXPERDATA", Const, 1},
+		{"ETHERTYPE_FLIP", Const, 1},
+		{"ETHERTYPE_FLOWCONTROL", Const, 1},
+		{"ETHERTYPE_FRARP", Const, 1},
+		{"ETHERTYPE_GENDYN", Const, 1},
+		{"ETHERTYPE_HAYES", Const, 1},
+		{"ETHERTYPE_HIPPI_FP", Const, 1},
+		{"ETHERTYPE_HITACHI", Const, 1},
+		{"ETHERTYPE_HP", Const, 1},
+		{"ETHERTYPE_IEEEPUP", Const, 1},
+		{"ETHERTYPE_IEEEPUPAT", Const, 1},
+		{"ETHERTYPE_IMLBL", Const, 1},
+		{"ETHERTYPE_IMLBLDIAG", Const, 1},
+		{"ETHERTYPE_IP", Const, 1},
+		{"ETHERTYPE_IPAS", Const, 1},
+		{"ETHERTYPE_IPV6", Const, 1},
+		{"ETHERTYPE_IPX", Const, 1},
+		{"ETHERTYPE_IPXNEW", Const, 1},
+		{"ETHERTYPE_KALPANA", Const, 1},
+		{"ETHERTYPE_LANBRIDGE", Const, 1},
+		{"ETHERTYPE_LANPROBE", Const, 1},
+		{"ETHERTYPE_LAT", Const, 1},
+		{"ETHERTYPE_LBACK", Const, 1},
+		{"ETHERTYPE_LITTLE", Const, 1},
+		{"ETHERTYPE_LLDP", Const, 1},
+		{"ETHERTYPE_LOGICRAFT", Const, 1},
+		{"ETHERTYPE_LOOPBACK", Const, 1},
+		{"ETHERTYPE_MATRA", Const, 1},
+		{"ETHERTYPE_MAX", Const, 1},
+		{"ETHERTYPE_MERIT", Const, 1},
+		{"ETHERTYPE_MICP", Const, 1},
+		{"ETHERTYPE_MOPDL", Const, 1},
+		{"ETHERTYPE_MOPRC", Const, 1},
+		{"ETHERTYPE_MOTOROLA", Const, 1},
+		{"ETHERTYPE_MPLS", Const, 1},
+		{"ETHERTYPE_MPLS_MCAST", Const, 1},
+		{"ETHERTYPE_MUMPS", Const, 1},
+		{"ETHERTYPE_NBPCC", Const, 1},
+		{"ETHERTYPE_NBPCLAIM", Const, 1},
+		{"ETHERTYPE_NBPCLREQ", Const, 1},
+		{"ETHERTYPE_NBPCLRSP", Const, 1},
+		{"ETHERTYPE_NBPCREQ", Const, 1},
+		{"ETHERTYPE_NBPCRSP", Const, 1},
+		{"ETHERTYPE_NBPDG", Const, 1},
+		{"ETHERTYPE_NBPDGB", Const, 1},
+		{"ETHERTYPE_NBPDLTE", Const, 1},
+		{"ETHERTYPE_NBPRAR", Const, 1},
+		{"ETHERTYPE_NBPRAS", Const, 1},
+		{"ETHERTYPE_NBPRST", Const, 1},
+		{"ETHERTYPE_NBPSCD", Const, 1},
+		{"ETHERTYPE_NBPVCD", Const, 1},
+		{"ETHERTYPE_NBS", Const, 1},
+		{"ETHERTYPE_NCD", Const, 1},
+		{"ETHERTYPE_NESTAR", Const, 1},
+		{"ETHERTYPE_NETBEUI", Const, 1},
+		{"ETHERTYPE_NOVELL", Const, 1},
+		{"ETHERTYPE_NS", Const, 1},
+		{"ETHERTYPE_NSAT", Const, 1},
+		{"ETHERTYPE_NSCOMPAT", Const, 1},
+		{"ETHERTYPE_NTRAILER", Const, 1},
+		{"ETHERTYPE_OS9", Const, 1},
+		{"ETHERTYPE_OS9NET", Const, 1},
+		{"ETHERTYPE_PACER", Const, 1},
+		{"ETHERTYPE_PAE", Const, 1},
+		{"ETHERTYPE_PCS", Const, 1},
+		{"ETHERTYPE_PLANNING", Const, 1},
+		{"ETHERTYPE_PPP", Const, 1},
+		{"ETHERTYPE_PPPOE", Const, 1},
+		{"ETHERTYPE_PPPOEDISC", Const, 1},
+		{"ETHERTYPE_PRIMENTS", Const, 1},
+		{"ETHERTYPE_PUP", Const, 1},
+		{"ETHERTYPE_PUPAT", Const, 1},
+		{"ETHERTYPE_QINQ", Const, 1},
+		{"ETHERTYPE_RACAL", Const, 1},
+		{"ETHERTYPE_RATIONAL", Const, 1},
+		{"ETHERTYPE_RAWFR", Const, 1},
+		{"ETHERTYPE_RCL", Const, 1},
+		{"ETHERTYPE_RDP", Const, 1},
+		{"ETHERTYPE_RETIX", Const, 1},
+		{"ETHERTYPE_REVARP", Const, 1},
+		{"ETHERTYPE_SCA", Const, 1},
+		{"ETHERTYPE_SECTRA", Const, 1},
+		{"ETHERTYPE_SECUREDATA", Const, 1},
+		{"ETHERTYPE_SGITW", Const, 1},
+		{"ETHERTYPE_SG_BOUNCE", Const, 1},
+		{"ETHERTYPE_SG_DIAG", Const, 1},
+		{"ETHERTYPE_SG_NETGAMES", Const, 1},
+		{"ETHERTYPE_SG_RESV", Const, 1},
+		{"ETHERTYPE_SIMNET", Const, 1},
+		{"ETHERTYPE_SLOW", Const, 1},
+		{"ETHERTYPE_SLOWPROTOCOLS", Const, 1},
+		{"ETHERTYPE_SNA", Const, 1},
+		{"ETHERTYPE_SNMP", Const, 1},
+		{"ETHERTYPE_SONIX", Const, 1},
+		{"ETHERTYPE_SPIDER", Const, 1},
+		{"ETHERTYPE_SPRITE", Const, 1},
+		{"ETHERTYPE_STP", Const, 1},
+		{"ETHERTYPE_TALARIS", Const, 1},
+		{"ETHERTYPE_TALARISMC", Const, 1},
+		{"ETHERTYPE_TCPCOMP", Const, 1},
+		{"ETHERTYPE_TCPSM", Const, 1},
+		{"ETHERTYPE_TEC", Const, 1},
+		{"ETHERTYPE_TIGAN", Const, 1},
+		{"ETHERTYPE_TRAIL", Const, 1},
+		{"ETHERTYPE_TRANSETHER", Const, 1},
+		{"ETHERTYPE_TYMSHARE", Const, 1},
+		{"ETHERTYPE_UBBST", Const, 1},
+		{"ETHERTYPE_UBDEBUG", Const, 1},
+		{"ETHERTYPE_UBDIAGLOOP", Const, 1},
+		{"ETHERTYPE_UBDL", Const, 1},
+		{"ETHERTYPE_UBNIU", Const, 1},
+		{"ETHERTYPE_UBNMC", Const, 1},
+		{"ETHERTYPE_VALID", Const, 1},
+		{"ETHERTYPE_VARIAN", Const, 1},
+		{"ETHERTYPE_VAXELN", Const, 1},
+		{"ETHERTYPE_VEECO", Const, 1},
+		{"ETHERTYPE_VEXP", Const, 1},
+		{"ETHERTYPE_VGLAB", Const, 1},
+		{"ETHERTYPE_VINES", Const, 1},
+		{"ETHERTYPE_VINESECHO", Const, 1},
+		{"ETHERTYPE_VINESLOOP", Const, 1},
+		{"ETHERTYPE_VITAL", Const, 1},
+		{"ETHERTYPE_VLAN", Const, 1},
+		{"ETHERTYPE_VLTLMAN", Const, 1},
+		{"ETHERTYPE_VPROD", Const, 1},
+		{"ETHERTYPE_VURESERVED", Const, 1},
+		{"ETHERTYPE_WATERLOO", Const, 1},
+		{"ETHERTYPE_WELLFLEET", Const, 1},
+		{"ETHERTYPE_X25", Const, 1},
+		{"ETHERTYPE_X75", Const, 1},
+		{"ETHERTYPE_XNSSM", Const, 1},
+		{"ETHERTYPE_XTP", Const, 1},
+		{"ETHER_ADDR_LEN", Const, 1},
+		{"ETHER_ALIGN", Const, 1},
+		{"ETHER_CRC_LEN", Const, 1},
+		{"ETHER_CRC_POLY_BE", Const, 1},
+		{"ETHER_CRC_POLY_LE", Const, 1},
+		{"ETHER_HDR_LEN", Const, 1},
+		{"ETHER_MAX_DIX_LEN", Const, 1},
+		{"ETHER_MAX_LEN", Const, 1},
+		{"ETHER_MAX_LEN_JUMBO", Const, 1},
+		{"ETHER_MIN_LEN", Const, 1},
+		{"ETHER_PPPOE_ENCAP_LEN", Const, 1},
+		{"ETHER_TYPE_LEN", Const, 1},
+		{"ETHER_VLAN_ENCAP_LEN", Const, 1},
+		{"ETH_P_1588", Const, 0},
+		{"ETH_P_8021Q", Const, 0},
+		{"ETH_P_802_2", Const, 0},
+		{"ETH_P_802_3", Const, 0},
+		{"ETH_P_AARP", Const, 0},
+		{"ETH_P_ALL", Const, 0},
+		{"ETH_P_AOE", Const, 0},
+		{"ETH_P_ARCNET", Const, 0},
+		{"ETH_P_ARP", Const, 0},
+		{"ETH_P_ATALK", Const, 0},
+		{"ETH_P_ATMFATE", Const, 0},
+		{"ETH_P_ATMMPOA", Const, 0},
+		{"ETH_P_AX25", Const, 0},
+		{"ETH_P_BPQ", Const, 0},
+		{"ETH_P_CAIF", Const, 0},
+		{"ETH_P_CAN", Const, 0},
+		{"ETH_P_CONTROL", Const, 0},
+		{"ETH_P_CUST", Const, 0},
+		{"ETH_P_DDCMP", Const, 0},
+		{"ETH_P_DEC", Const, 0},
+		{"ETH_P_DIAG", Const, 0},
+		{"ETH_P_DNA_DL", Const, 0},
+		{"ETH_P_DNA_RC", Const, 0},
+		{"ETH_P_DNA_RT", Const, 0},
+		{"ETH_P_DSA", Const, 0},
+		{"ETH_P_ECONET", Const, 0},
+		{"ETH_P_EDSA", Const, 0},
+		{"ETH_P_FCOE", Const, 0},
+		{"ETH_P_FIP", Const, 0},
+		{"ETH_P_HDLC", Const, 0},
+		{"ETH_P_IEEE802154", Const, 0},
+		{"ETH_P_IEEEPUP", Const, 0},
+		{"ETH_P_IEEEPUPAT", Const, 0},
+		{"ETH_P_IP", Const, 0},
+		{"ETH_P_IPV6", Const, 0},
+		{"ETH_P_IPX", Const, 0},
+		{"ETH_P_IRDA", Const, 0},
+		{"ETH_P_LAT", Const, 0},
+		{"ETH_P_LINK_CTL", Const, 0},
+		{"ETH_P_LOCALTALK", Const, 0},
+		{"ETH_P_LOOP", Const, 0},
+		{"ETH_P_MOBITEX", Const, 0},
+		{"ETH_P_MPLS_MC", Const, 0},
+		{"ETH_P_MPLS_UC", Const, 0},
+		{"ETH_P_PAE", Const, 0},
+		{"ETH_P_PAUSE", Const, 0},
+		{"ETH_P_PHONET", Const, 0},
+		{"ETH_P_PPPTALK", Const, 0},
+		{"ETH_P_PPP_DISC", Const, 0},
+		{"ETH_P_PPP_MP", Const, 0},
+		{"ETH_P_PPP_SES", Const, 0},
+		{"ETH_P_PUP", Const, 0},
+		{"ETH_P_PUPAT", Const, 0},
+		{"ETH_P_RARP", Const, 0},
+		{"ETH_P_SCA", Const, 0},
+		{"ETH_P_SLOW", Const, 0},
+		{"ETH_P_SNAP", Const, 0},
+		{"ETH_P_TEB", Const, 0},
+		{"ETH_P_TIPC", Const, 0},
+		{"ETH_P_TRAILER", Const, 0},
+		{"ETH_P_TR_802_2", Const, 0},
+		{"ETH_P_WAN_PPP", Const, 0},
+		{"ETH_P_WCCP", Const, 0},
+		{"ETH_P_X25", Const, 0},
+		{"ETIME", Const, 0},
+		{"ETIMEDOUT", Const, 0},
+		{"ETOOMANYREFS", Const, 0},
+		{"ETXTBSY", Const, 0},
+		{"EUCLEAN", Const, 0},
+		{"EUNATCH", Const, 0},
+		{"EUSERS", Const, 0},
+		{"EVFILT_AIO", Const, 0},
+		{"EVFILT_FS", Const, 0},
+		{"EVFILT_LIO", Const, 0},
+		{"EVFILT_MACHPORT", Const, 0},
+		{"EVFILT_PROC", Const, 0},
+		{"EVFILT_READ", Const, 0},
+		{"EVFILT_SIGNAL", Const, 0},
+		{"EVFILT_SYSCOUNT", Const, 0},
+		{"EVFILT_THREADMARKER", Const, 0},
+		{"EVFILT_TIMER", Const, 0},
+		{"EVFILT_USER", Const, 0},
+		{"EVFILT_VM", Const, 0},
+		{"EVFILT_VNODE", Const, 0},
+		{"EVFILT_WRITE", Const, 0},
+		{"EV_ADD", Const, 0},
+		{"EV_CLEAR", Const, 0},
+		{"EV_DELETE", Const, 0},
+		{"EV_DISABLE", Const, 0},
+		{"EV_DISPATCH", Const, 0},
+		{"EV_DROP", Const, 3},
+		{"EV_ENABLE", Const, 0},
+		{"EV_EOF", Const, 0},
+		{"EV_ERROR", Const, 0},
+		{"EV_FLAG0", Const, 0},
+		{"EV_FLAG1", Const, 0},
+		{"EV_ONESHOT", Const, 0},
+		{"EV_OOBAND", Const, 0},
+		{"EV_POLL", Const, 0},
+		{"EV_RECEIPT", Const, 0},
+		{"EV_SYSFLAGS", Const, 0},
+		{"EWINDOWS", Const, 0},
+		{"EWOULDBLOCK", Const, 0},
+		{"EXDEV", Const, 0},
+		{"EXFULL", Const, 0},
+		{"EXTA", Const, 0},
+		{"EXTB", Const, 0},
+		{"EXTPROC", Const, 0},
+		{"Environ", Func, 0},
+		{"EpollCreate", Func, 0},
+		{"EpollCreate1", Func, 0},
+		{"EpollCtl", Func, 0},
+		{"EpollEvent", Type, 0},
+		{"EpollEvent.Events", Field, 0},
+		{"EpollEvent.Fd", Field, 0},
+		{"EpollEvent.Pad", Field, 0},
+		{"EpollEvent.PadFd", Field, 0},
+		{"EpollWait", Func, 0},
+		{"Errno", Type, 0},
+		{"EscapeArg", Func, 0},
+		{"Exchangedata", Func, 0},
+		{"Exec", Func, 0},
+		{"Exit", Func, 0},
+		{"ExitProcess", Func, 0},
+		{"FD_CLOEXEC", Const, 0},
+		{"FD_SETSIZE", Const, 0},
+		{"FILE_ACTION_ADDED", Const, 0},
+		{"FILE_ACTION_MODIFIED", Const, 0},
+		{"FILE_ACTION_REMOVED", Const, 0},
+		{"FILE_ACTION_RENAMED_NEW_NAME", Const, 0},
+		{"FILE_ACTION_RENAMED_OLD_NAME", Const, 0},
+		{"FILE_APPEND_DATA", Const, 0},
+		{"FILE_ATTRIBUTE_ARCHIVE", Const, 0},
+		{"FILE_ATTRIBUTE_DIRECTORY", Const, 0},
+		{"FILE_ATTRIBUTE_HIDDEN", Const, 0},
+		{"FILE_ATTRIBUTE_NORMAL", Const, 0},
+		{"FILE_ATTRIBUTE_READONLY", Const, 0},
+		{"FILE_ATTRIBUTE_REPARSE_POINT", Const, 4},
+		{"FILE_ATTRIBUTE_SYSTEM", Const, 0},
+		{"FILE_BEGIN", Const, 0},
+		{"FILE_CURRENT", Const, 0},
+		{"FILE_END", Const, 0},
+		{"FILE_FLAG_BACKUP_SEMANTICS", Const, 0},
+		{"FILE_FLAG_OPEN_REPARSE_POINT", Const, 4},
+		{"FILE_FLAG_OVERLAPPED", Const, 0},
+		{"FILE_LIST_DIRECTORY", Const, 0},
+		{"FILE_MAP_COPY", Const, 0},
+		{"FILE_MAP_EXECUTE", Const, 0},
+		{"FILE_MAP_READ", Const, 0},
+		{"FILE_MAP_WRITE", Const, 0},
+		{"FILE_NOTIFY_CHANGE_ATTRIBUTES", Const, 0},
+		{"FILE_NOTIFY_CHANGE_CREATION", Const, 0},
+		{"FILE_NOTIFY_CHANGE_DIR_NAME", Const, 0},
+		{"FILE_NOTIFY_CHANGE_FILE_NAME", Const, 0},
+		{"FILE_NOTIFY_CHANGE_LAST_ACCESS", Const, 0},
+		{"FILE_NOTIFY_CHANGE_LAST_WRITE", Const, 0},
+		{"FILE_NOTIFY_CHANGE_SIZE", Const, 0},
+		{"FILE_SHARE_DELETE", Const, 0},
+		{"FILE_SHARE_READ", Const, 0},
+		{"FILE_SHARE_WRITE", Const, 0},
+		{"FILE_SKIP_COMPLETION_PORT_ON_SUCCESS", Const, 2},
+		{"FILE_SKIP_SET_EVENT_ON_HANDLE", Const, 2},
+		{"FILE_TYPE_CHAR", Const, 0},
+		{"FILE_TYPE_DISK", Const, 0},
+		{"FILE_TYPE_PIPE", Const, 0},
+		{"FILE_TYPE_REMOTE", Const, 0},
+		{"FILE_TYPE_UNKNOWN", Const, 0},
+		{"FILE_WRITE_ATTRIBUTES", Const, 0},
+		{"FLUSHO", Const, 0},
+		{"FORMAT_MESSAGE_ALLOCATE_BUFFER", Const, 0},
+		{"FORMAT_MESSAGE_ARGUMENT_ARRAY", Const, 0},
+		{"FORMAT_MESSAGE_FROM_HMODULE", Const, 0},
+		{"FORMAT_MESSAGE_FROM_STRING", Const, 0},
+		{"FORMAT_MESSAGE_FROM_SYSTEM", Const, 0},
+		{"FORMAT_MESSAGE_IGNORE_INSERTS", Const, 0},
+		{"FORMAT_MESSAGE_MAX_WIDTH_MASK", Const, 0},
+		{"FSCTL_GET_REPARSE_POINT", Const, 4},
+		{"F_ADDFILESIGS", Const, 0},
+		{"F_ADDSIGS", Const, 0},
+		{"F_ALLOCATEALL", Const, 0},
+		{"F_ALLOCATECONTIG", Const, 0},
+		{"F_CANCEL", Const, 0},
+		{"F_CHKCLEAN", Const, 0},
+		{"F_CLOSEM", Const, 1},
+		{"F_DUP2FD", Const, 0},
+		{"F_DUP2FD_CLOEXEC", Const, 1},
+		{"F_DUPFD", Const, 0},
+		{"F_DUPFD_CLOEXEC", Const, 0},
+		{"F_EXLCK", Const, 0},
+		{"F_FINDSIGS", Const, 16},
+		{"F_FLUSH_DATA", Const, 0},
+		{"F_FREEZE_FS", Const, 0},
+		{"F_FSCTL", Const, 1},
+		{"F_FSDIRMASK", Const, 1},
+		{"F_FSIN", Const, 1},
+		{"F_FSINOUT", Const, 1},
+		{"F_FSOUT", Const, 1},
+		{"F_FSPRIV", Const, 1},
+		{"F_FSVOID", Const, 1},
+		{"F_FULLFSYNC", Const, 0},
+		{"F_GETCODEDIR", Const, 16},
+		{"F_GETFD", Const, 0},
+		{"F_GETFL", Const, 0},
+		{"F_GETLEASE", Const, 0},
+		{"F_GETLK", Const, 0},
+		{"F_GETLK64", Const, 0},
+		{"F_GETLKPID", Const, 0},
+		{"F_GETNOSIGPIPE", Const, 0},
+		{"F_GETOWN", Const, 0},
+		{"F_GETOWN_EX", Const, 0},
+		{"F_GETPATH", Const, 0},
+		{"F_GETPATH_MTMINFO", Const, 0},
+		{"F_GETPIPE_SZ", Const, 0},
+		{"F_GETPROTECTIONCLASS", Const, 0},
+		{"F_GETPROTECTIONLEVEL", Const, 16},
+		{"F_GETSIG", Const, 0},
+		{"F_GLOBAL_NOCACHE", Const, 0},
+		{"F_LOCK", Const, 0},
+		{"F_LOG2PHYS", Const, 0},
+		{"F_LOG2PHYS_EXT", Const, 0},
+		{"F_MARKDEPENDENCY", Const, 0},
+		{"F_MAXFD", Const, 1},
+		{"F_NOCACHE", Const, 0},
+		{"F_NODIRECT", Const, 0},
+		{"F_NOTIFY", Const, 0},
+		{"F_OGETLK", Const, 0},
+		{"F_OK", Const, 0},
+		{"F_OSETLK", Const, 0},
+		{"F_OSETLKW", Const, 0},
+		{"F_PARAM_MASK", Const, 1},
+		{"F_PARAM_MAX", Const, 1},
+		{"F_PATHPKG_CHECK", Const, 0},
+		{"F_PEOFPOSMODE", Const, 0},
+		{"F_PREALLOCATE", Const, 0},
+		{"F_RDADVISE", Const, 0},
+		{"F_RDAHEAD", Const, 0},
+		{"F_RDLCK", Const, 0},
+		{"F_READAHEAD", Const, 0},
+		{"F_READBOOTSTRAP", Const, 0},
+		{"F_SETBACKINGSTORE", Const, 0},
+		{"F_SETFD", Const, 0},
+		{"F_SETFL", Const, 0},
+		{"F_SETLEASE", Const, 0},
+		{"F_SETLK", Const, 0},
+		{"F_SETLK64", Const, 0},
+		{"F_SETLKW", Const, 0},
+		{"F_SETLKW64", Const, 0},
+		{"F_SETLKWTIMEOUT", Const, 16},
+		{"F_SETLK_REMOTE", Const, 0},
+		{"F_SETNOSIGPIPE", Const, 0},
+		{"F_SETOWN", Const, 0},
+		{"F_SETOWN_EX", Const, 0},
+		{"F_SETPIPE_SZ", Const, 0},
+		{"F_SETPROTECTIONCLASS", Const, 0},
+		{"F_SETSIG", Const, 0},
+		{"F_SETSIZE", Const, 0},
+		{"F_SHLCK", Const, 0},
+		{"F_SINGLE_WRITER", Const, 16},
+		{"F_TEST", Const, 0},
+		{"F_THAW_FS", Const, 0},
+		{"F_TLOCK", Const, 0},
+		{"F_TRANSCODEKEY", Const, 16},
+		{"F_ULOCK", Const, 0},
+		{"F_UNLCK", Const, 0},
+		{"F_UNLCKSYS", Const, 0},
+		{"F_VOLPOSMODE", Const, 0},
+		{"F_WRITEBOOTSTRAP", Const, 0},
+		{"F_WRLCK", Const, 0},
+		{"Faccessat", Func, 0},
+		{"Fallocate", Func, 0},
+		{"Fbootstraptransfer_t", Type, 0},
+		{"Fbootstraptransfer_t.Buffer", Field, 0},
+		{"Fbootstraptransfer_t.Length", Field, 0},
+		{"Fbootstraptransfer_t.Offset", Field, 0},
+		{"Fchdir", Func, 0},
+		{"Fchflags", Func, 0},
+		{"Fchmod", Func, 0},
+		{"Fchmodat", Func, 0},
+		{"Fchown", Func, 0},
+		{"Fchownat", Func, 0},
+		{"FcntlFlock", Func, 3},
+		{"FdSet", Type, 0},
+		{"FdSet.Bits", Field, 0},
+		{"FdSet.X__fds_bits", Field, 0},
+		{"Fdatasync", Func, 0},
+		{"FileNotifyInformation", Type, 0},
+		{"FileNotifyInformation.Action", Field, 0},
+		{"FileNotifyInformation.FileName", Field, 0},
+		{"FileNotifyInformation.FileNameLength", Field, 0},
+		{"FileNotifyInformation.NextEntryOffset", Field, 0},
+		{"Filetime", Type, 0},
+		{"Filetime.HighDateTime", Field, 0},
+		{"Filetime.LowDateTime", Field, 0},
+		{"FindClose", Func, 0},
+		{"FindFirstFile", Func, 0},
+		{"FindNextFile", Func, 0},
+		{"Flock", Func, 0},
+		{"Flock_t", Type, 0},
+		{"Flock_t.Len", Field, 0},
+		{"Flock_t.Pad_cgo_0", Field, 0},
+		{"Flock_t.Pad_cgo_1", Field, 3},
+		{"Flock_t.Pid", Field, 0},
+		{"Flock_t.Start", Field, 0},
+		{"Flock_t.Sysid", Field, 0},
+		{"Flock_t.Type", Field, 0},
+		{"Flock_t.Whence", Field, 0},
+		{"FlushBpf", Func, 0},
+		{"FlushFileBuffers", Func, 0},
+		{"FlushViewOfFile", Func, 0},
+		{"ForkExec", Func, 0},
+		{"ForkLock", Var, 0},
+		{"FormatMessage", Func, 0},
+		{"Fpathconf", Func, 0},
+		{"FreeAddrInfoW", Func, 1},
+		{"FreeEnvironmentStrings", Func, 0},
+		{"FreeLibrary", Func, 0},
+		{"Fsid", Type, 0},
+		{"Fsid.Val", Field, 0},
+		{"Fsid.X__fsid_val", Field, 2},
+		{"Fsid.X__val", Field, 0},
+		{"Fstat", Func, 0},
+		{"Fstatat", Func, 12},
+		{"Fstatfs", Func, 0},
+		{"Fstore_t", Type, 0},
+		{"Fstore_t.Bytesalloc", Field, 0},
+		{"Fstore_t.Flags", Field, 0},
+		{"Fstore_t.Length", Field, 0},
+		{"Fstore_t.Offset", Field, 0},
+		{"Fstore_t.Posmode", Field, 0},
+		{"Fsync", Func, 0},
+		{"Ftruncate", Func, 0},
+		{"FullPath", Func, 4},
+		{"Futimes", Func, 0},
+		{"Futimesat", Func, 0},
+		{"GENERIC_ALL", Const, 0},
+		{"GENERIC_EXECUTE", Const, 0},
+		{"GENERIC_READ", Const, 0},
+		{"GENERIC_WRITE", Const, 0},
+		{"GUID", Type, 1},
+		{"GUID.Data1", Field, 1},
+		{"GUID.Data2", Field, 1},
+		{"GUID.Data3", Field, 1},
+		{"GUID.Data4", Field, 1},
+		{"GetAcceptExSockaddrs", Func, 0},
+		{"GetAdaptersInfo", Func, 0},
+		{"GetAddrInfoW", Func, 1},
+		{"GetCommandLine", Func, 0},
+		{"GetComputerName", Func, 0},
+		{"GetConsoleMode", Func, 1},
+		{"GetCurrentDirectory", Func, 0},
+		{"GetCurrentProcess", Func, 0},
+		{"GetEnvironmentStrings", Func, 0},
+		{"GetEnvironmentVariable", Func, 0},
+		{"GetExitCodeProcess", Func, 0},
+		{"GetFileAttributes", Func, 0},
+		{"GetFileAttributesEx", Func, 0},
+		{"GetFileExInfoStandard", Const, 0},
+		{"GetFileExMaxInfoLevel", Const, 0},
+		{"GetFileInformationByHandle", Func, 0},
+		{"GetFileType", Func, 0},
+		{"GetFullPathName", Func, 0},
+		{"GetHostByName", Func, 0},
+		{"GetIfEntry", Func, 0},
+		{"GetLastError", Func, 0},
+		{"GetLengthSid", Func, 0},
+		{"GetLongPathName", Func, 0},
+		{"GetProcAddress", Func, 0},
+		{"GetProcessTimes", Func, 0},
+		{"GetProtoByName", Func, 0},
+		{"GetQueuedCompletionStatus", Func, 0},
+		{"GetServByName", Func, 0},
+		{"GetShortPathName", Func, 0},
+		{"GetStartupInfo", Func, 0},
+		{"GetStdHandle", Func, 0},
+		{"GetSystemTimeAsFileTime", Func, 0},
+		{"GetTempPath", Func, 0},
+		{"GetTimeZoneInformation", Func, 0},
+		{"GetTokenInformation", Func, 0},
+		{"GetUserNameEx", Func, 0},
+		{"GetUserProfileDirectory", Func, 0},
+		{"GetVersion", Func, 0},
+		{"Getcwd", Func, 0},
+		{"Getdents", Func, 0},
+		{"Getdirentries", Func, 0},
+		{"Getdtablesize", Func, 0},
+		{"Getegid", Func, 0},
+		{"Getenv", Func, 0},
+		{"Geteuid", Func, 0},
+		{"Getfsstat", Func, 0},
+		{"Getgid", Func, 0},
+		{"Getgroups", Func, 0},
+		{"Getpagesize", Func, 0},
+		{"Getpeername", Func, 0},
+		{"Getpgid", Func, 0},
+		{"Getpgrp", Func, 0},
+		{"Getpid", Func, 0},
+		{"Getppid", Func, 0},
+		{"Getpriority", Func, 0},
+		{"Getrlimit", Func, 0},
+		{"Getrusage", Func, 0},
+		{"Getsid", Func, 0},
+		{"Getsockname", Func, 0},
+		{"Getsockopt", Func, 1},
+		{"GetsockoptByte", Func, 0},
+		{"GetsockoptICMPv6Filter", Func, 2},
+		{"GetsockoptIPMreq", Func, 0},
+		{"GetsockoptIPMreqn", Func, 0},
+		{"GetsockoptIPv6MTUInfo", Func, 2},
+		{"GetsockoptIPv6Mreq", Func, 0},
+		{"GetsockoptInet4Addr", Func, 0},
+		{"GetsockoptInt", Func, 0},
+		{"GetsockoptUcred", Func, 1},
+		{"Gettid", Func, 0},
+		{"Gettimeofday", Func, 0},
+		{"Getuid", Func, 0},
+		{"Getwd", Func, 0},
+		{"Getxattr", Func, 1},
+		{"HANDLE_FLAG_INHERIT", Const, 0},
+		{"HKEY_CLASSES_ROOT", Const, 0},
+		{"HKEY_CURRENT_CONFIG", Const, 0},
+		{"HKEY_CURRENT_USER", Const, 0},
+		{"HKEY_DYN_DATA", Const, 0},
+		{"HKEY_LOCAL_MACHINE", Const, 0},
+		{"HKEY_PERFORMANCE_DATA", Const, 0},
+		{"HKEY_USERS", Const, 0},
+		{"HUPCL", Const, 0},
+		{"Handle", Type, 0},
+		{"Hostent", Type, 0},
+		{"Hostent.AddrList", Field, 0},
+		{"Hostent.AddrType", Field, 0},
+		{"Hostent.Aliases", Field, 0},
+		{"Hostent.Length", Field, 0},
+		{"Hostent.Name", Field, 0},
+		{"ICANON", Const, 0},
+		{"ICMP6_FILTER", Const, 2},
+		{"ICMPV6_FILTER", Const, 2},
+		{"ICMPv6Filter", Type, 2},
+		{"ICMPv6Filter.Data", Field, 2},
+		{"ICMPv6Filter.Filt", Field, 2},
+		{"ICRNL", Const, 0},
+		{"IEXTEN", Const, 0},
+		{"IFAN_ARRIVAL", Const, 1},
+		{"IFAN_DEPARTURE", Const, 1},
+		{"IFA_ADDRESS", Const, 0},
+		{"IFA_ANYCAST", Const, 0},
+		{"IFA_BROADCAST", Const, 0},
+		{"IFA_CACHEINFO", Const, 0},
+		{"IFA_F_DADFAILED", Const, 0},
+		{"IFA_F_DEPRECATED", Const, 0},
+		{"IFA_F_HOMEADDRESS", Const, 0},
+		{"IFA_F_NODAD", Const, 0},
+		{"IFA_F_OPTIMISTIC", Const, 0},
+		{"IFA_F_PERMANENT", Const, 0},
+		{"IFA_F_SECONDARY", Const, 0},
+		{"IFA_F_TEMPORARY", Const, 0},
+		{"IFA_F_TENTATIVE", Const, 0},
+		{"IFA_LABEL", Const, 0},
+		{"IFA_LOCAL", Const, 0},
+		{"IFA_MAX", Const, 0},
+		{"IFA_MULTICAST", Const, 0},
+		{"IFA_ROUTE", Const, 1},
+		{"IFA_UNSPEC", Const, 0},
+		{"IFF_ALLMULTI", Const, 0},
+		{"IFF_ALTPHYS", Const, 0},
+		{"IFF_AUTOMEDIA", Const, 0},
+		{"IFF_BROADCAST", Const, 0},
+		{"IFF_CANTCHANGE", Const, 0},
+		{"IFF_CANTCONFIG", Const, 1},
+		{"IFF_DEBUG", Const, 0},
+		{"IFF_DRV_OACTIVE", Const, 0},
+		{"IFF_DRV_RUNNING", Const, 0},
+		{"IFF_DYING", Const, 0},
+		{"IFF_DYNAMIC", Const, 0},
+		{"IFF_LINK0", Const, 0},
+		{"IFF_LINK1", Const, 0},
+		{"IFF_LINK2", Const, 0},
+		{"IFF_LOOPBACK", Const, 0},
+		{"IFF_MASTER", Const, 0},
+		{"IFF_MONITOR", Const, 0},
+		{"IFF_MULTICAST", Const, 0},
+		{"IFF_NOARP", Const, 0},
+		{"IFF_NOTRAILERS", Const, 0},
+		{"IFF_NO_PI", Const, 0},
+		{"IFF_OACTIVE", Const, 0},
+		{"IFF_ONE_QUEUE", Const, 0},
+		{"IFF_POINTOPOINT", Const, 0},
+		{"IFF_POINTTOPOINT", Const, 0},
+		{"IFF_PORTSEL", Const, 0},
+		{"IFF_PPROMISC", Const, 0},
+		{"IFF_PROMISC", Const, 0},
+		{"IFF_RENAMING", Const, 0},
+		{"IFF_RUNNING", Const, 0},
+		{"IFF_SIMPLEX", Const, 0},
+		{"IFF_SLAVE", Const, 0},
+		{"IFF_SMART", Const, 0},
+		{"IFF_STATICARP", Const, 0},
+		{"IFF_TAP", Const, 0},
+		{"IFF_TUN", Const, 0},
+		{"IFF_TUN_EXCL", Const, 0},
+		{"IFF_UP", Const, 0},
+		{"IFF_VNET_HDR", Const, 0},
+		{"IFLA_ADDRESS", Const, 0},
+		{"IFLA_BROADCAST", Const, 0},
+		{"IFLA_COST", Const, 0},
+		{"IFLA_IFALIAS", Const, 0},
+		{"IFLA_IFNAME", Const, 0},
+		{"IFLA_LINK", Const, 0},
+		{"IFLA_LINKINFO", Const, 0},
+		{"IFLA_LINKMODE", Const, 0},
+		{"IFLA_MAP", Const, 0},
+		{"IFLA_MASTER", Const, 0},
+		{"IFLA_MAX", Const, 0},
+		{"IFLA_MTU", Const, 0},
+		{"IFLA_NET_NS_PID", Const, 0},
+		{"IFLA_OPERSTATE", Const, 0},
+		{"IFLA_PRIORITY", Const, 0},
+		{"IFLA_PROTINFO", Const, 0},
+		{"IFLA_QDISC", Const, 0},
+		{"IFLA_STATS", Const, 0},
+		{"IFLA_TXQLEN", Const, 0},
+		{"IFLA_UNSPEC", Const, 0},
+		{"IFLA_WEIGHT", Const, 0},
+		{"IFLA_WIRELESS", Const, 0},
+		{"IFNAMSIZ", Const, 0},
+		{"IFT_1822", Const, 0},
+		{"IFT_A12MPPSWITCH", Const, 0},
+		{"IFT_AAL2", Const, 0},
+		{"IFT_AAL5", Const, 0},
+		{"IFT_ADSL", Const, 0},
+		{"IFT_AFLANE8023", Const, 0},
+		{"IFT_AFLANE8025", Const, 0},
+		{"IFT_ARAP", Const, 0},
+		{"IFT_ARCNET", Const, 0},
+		{"IFT_ARCNETPLUS", Const, 0},
+		{"IFT_ASYNC", Const, 0},
+		{"IFT_ATM", Const, 0},
+		{"IFT_ATMDXI", Const, 0},
+		{"IFT_ATMFUNI", Const, 0},
+		{"IFT_ATMIMA", Const, 0},
+		{"IFT_ATMLOGICAL", Const, 0},
+		{"IFT_ATMRADIO", Const, 0},
+		{"IFT_ATMSUBINTERFACE", Const, 0},
+		{"IFT_ATMVCIENDPT", Const, 0},
+		{"IFT_ATMVIRTUAL", Const, 0},
+		{"IFT_BGPPOLICYACCOUNTING", Const, 0},
+		{"IFT_BLUETOOTH", Const, 1},
+		{"IFT_BRIDGE", Const, 0},
+		{"IFT_BSC", Const, 0},
+		{"IFT_CARP", Const, 0},
+		{"IFT_CCTEMUL", Const, 0},
+		{"IFT_CELLULAR", Const, 0},
+		{"IFT_CEPT", Const, 0},
+		{"IFT_CES", Const, 0},
+		{"IFT_CHANNEL", Const, 0},
+		{"IFT_CNR", Const, 0},
+		{"IFT_COFFEE", Const, 0},
+		{"IFT_COMPOSITELINK", Const, 0},
+		{"IFT_DCN", Const, 0},
+		{"IFT_DIGITALPOWERLINE", Const, 0},
+		{"IFT_DIGITALWRAPPEROVERHEADCHANNEL", Const, 0},
+		{"IFT_DLSW", Const, 0},
+		{"IFT_DOCSCABLEDOWNSTREAM", Const, 0},
+		{"IFT_DOCSCABLEMACLAYER", Const, 0},
+		{"IFT_DOCSCABLEUPSTREAM", Const, 0},
+		{"IFT_DOCSCABLEUPSTREAMCHANNEL", Const, 1},
+		{"IFT_DS0", Const, 0},
+		{"IFT_DS0BUNDLE", Const, 0},
+		{"IFT_DS1FDL", Const, 0},
+		{"IFT_DS3", Const, 0},
+		{"IFT_DTM", Const, 0},
+		{"IFT_DUMMY", Const, 1},
+		{"IFT_DVBASILN", Const, 0},
+		{"IFT_DVBASIOUT", Const, 0},
+		{"IFT_DVBRCCDOWNSTREAM", Const, 0},
+		{"IFT_DVBRCCMACLAYER", Const, 0},
+		{"IFT_DVBRCCUPSTREAM", Const, 0},
+		{"IFT_ECONET", Const, 1},
+		{"IFT_ENC", Const, 0},
+		{"IFT_EON", Const, 0},
+		{"IFT_EPLRS", Const, 0},
+		{"IFT_ESCON", Const, 0},
+		{"IFT_ETHER", Const, 0},
+		{"IFT_FAITH", Const, 0},
+		{"IFT_FAST", Const, 0},
+		{"IFT_FASTETHER", Const, 0},
+		{"IFT_FASTETHERFX", Const, 0},
+		{"IFT_FDDI", Const, 0},
+		{"IFT_FIBRECHANNEL", Const, 0},
+		{"IFT_FRAMERELAYINTERCONNECT", Const, 0},
+		{"IFT_FRAMERELAYMPI", Const, 0},
+		{"IFT_FRDLCIENDPT", Const, 0},
+		{"IFT_FRELAY", Const, 0},
+		{"IFT_FRELAYDCE", Const, 0},
+		{"IFT_FRF16MFRBUNDLE", Const, 0},
+		{"IFT_FRFORWARD", Const, 0},
+		{"IFT_G703AT2MB", Const, 0},
+		{"IFT_G703AT64K", Const, 0},
+		{"IFT_GIF", Const, 0},
+		{"IFT_GIGABITETHERNET", Const, 0},
+		{"IFT_GR303IDT", Const, 0},
+		{"IFT_GR303RDT", Const, 0},
+		{"IFT_H323GATEKEEPER", Const, 0},
+		{"IFT_H323PROXY", Const, 0},
+		{"IFT_HDH1822", Const, 0},
+		{"IFT_HDLC", Const, 0},
+		{"IFT_HDSL2", Const, 0},
+		{"IFT_HIPERLAN2", Const, 0},
+		{"IFT_HIPPI", Const, 0},
+		{"IFT_HIPPIINTERFACE", Const, 0},
+		{"IFT_HOSTPAD", Const, 0},
+		{"IFT_HSSI", Const, 0},
+		{"IFT_HY", Const, 0},
+		{"IFT_IBM370PARCHAN", Const, 0},
+		{"IFT_IDSL", Const, 0},
+		{"IFT_IEEE1394", Const, 0},
+		{"IFT_IEEE80211", Const, 0},
+		{"IFT_IEEE80212", Const, 0},
+		{"IFT_IEEE8023ADLAG", Const, 0},
+		{"IFT_IFGSN", Const, 0},
+		{"IFT_IMT", Const, 0},
+		{"IFT_INFINIBAND", Const, 1},
+		{"IFT_INTERLEAVE", Const, 0},
+		{"IFT_IP", Const, 0},
+		{"IFT_IPFORWARD", Const, 0},
+		{"IFT_IPOVERATM", Const, 0},
+		{"IFT_IPOVERCDLC", Const, 0},
+		{"IFT_IPOVERCLAW", Const, 0},
+		{"IFT_IPSWITCH", Const, 0},
+		{"IFT_IPXIP", Const, 0},
+		{"IFT_ISDN", Const, 0},
+		{"IFT_ISDNBASIC", Const, 0},
+		{"IFT_ISDNPRIMARY", Const, 0},
+		{"IFT_ISDNS", Const, 0},
+		{"IFT_ISDNU", Const, 0},
+		{"IFT_ISO88022LLC", Const, 0},
+		{"IFT_ISO88023", Const, 0},
+		{"IFT_ISO88024", Const, 0},
+		{"IFT_ISO88025", Const, 0},
+		{"IFT_ISO88025CRFPINT", Const, 0},
+		{"IFT_ISO88025DTR", Const, 0},
+		{"IFT_ISO88025FIBER", Const, 0},
+		{"IFT_ISO88026", Const, 0},
+		{"IFT_ISUP", Const, 0},
+		{"IFT_L2VLAN", Const, 0},
+		{"IFT_L3IPVLAN", Const, 0},
+		{"IFT_L3IPXVLAN", Const, 0},
+		{"IFT_LAPB", Const, 0},
+		{"IFT_LAPD", Const, 0},
+		{"IFT_LAPF", Const, 0},
+		{"IFT_LINEGROUP", Const, 1},
+		{"IFT_LOCALTALK", Const, 0},
+		{"IFT_LOOP", Const, 0},
+		{"IFT_MEDIAMAILOVERIP", Const, 0},
+		{"IFT_MFSIGLINK", Const, 0},
+		{"IFT_MIOX25", Const, 0},
+		{"IFT_MODEM", Const, 0},
+		{"IFT_MPC", Const, 0},
+		{"IFT_MPLS", Const, 0},
+		{"IFT_MPLSTUNNEL", Const, 0},
+		{"IFT_MSDSL", Const, 0},
+		{"IFT_MVL", Const, 0},
+		{"IFT_MYRINET", Const, 0},
+		{"IFT_NFAS", Const, 0},
+		{"IFT_NSIP", Const, 0},
+		{"IFT_OPTICALCHANNEL", Const, 0},
+		{"IFT_OPTICALTRANSPORT", Const, 0},
+		{"IFT_OTHER", Const, 0},
+		{"IFT_P10", Const, 0},
+		{"IFT_P80", Const, 0},
+		{"IFT_PARA", Const, 0},
+		{"IFT_PDP", Const, 0},
+		{"IFT_PFLOG", Const, 0},
+		{"IFT_PFLOW", Const, 1},
+		{"IFT_PFSYNC", Const, 0},
+		{"IFT_PLC", Const, 0},
+		{"IFT_PON155", Const, 1},
+		{"IFT_PON622", Const, 1},
+		{"IFT_POS", Const, 0},
+		{"IFT_PPP", Const, 0},
+		{"IFT_PPPMULTILINKBUNDLE", Const, 0},
+		{"IFT_PROPATM", Const, 1},
+		{"IFT_PROPBWAP2MP", Const, 0},
+		{"IFT_PROPCNLS", Const, 0},
+		{"IFT_PROPDOCSWIRELESSDOWNSTREAM", Const, 0},
+		{"IFT_PROPDOCSWIRELESSMACLAYER", Const, 0},
+		{"IFT_PROPDOCSWIRELESSUPSTREAM", Const, 0},
+		{"IFT_PROPMUX", Const, 0},
+		{"IFT_PROPVIRTUAL", Const, 0},
+		{"IFT_PROPWIRELESSP2P", Const, 0},
+		{"IFT_PTPSERIAL", Const, 0},
+		{"IFT_PVC", Const, 0},
+		{"IFT_Q2931", Const, 1},
+		{"IFT_QLLC", Const, 0},
+		{"IFT_RADIOMAC", Const, 0},
+		{"IFT_RADSL", Const, 0},
+		{"IFT_REACHDSL", Const, 0},
+		{"IFT_RFC1483", Const, 0},
+		{"IFT_RS232", Const, 0},
+		{"IFT_RSRB", Const, 0},
+		{"IFT_SDLC", Const, 0},
+		{"IFT_SDSL", Const, 0},
+		{"IFT_SHDSL", Const, 0},
+		{"IFT_SIP", Const, 0},
+		{"IFT_SIPSIG", Const, 1},
+		{"IFT_SIPTG", Const, 1},
+		{"IFT_SLIP", Const, 0},
+		{"IFT_SMDSDXI", Const, 0},
+		{"IFT_SMDSICIP", Const, 0},
+		{"IFT_SONET", Const, 0},
+		{"IFT_SONETOVERHEADCHANNEL", Const, 0},
+		{"IFT_SONETPATH", Const, 0},
+		{"IFT_SONETVT", Const, 0},
+		{"IFT_SRP", Const, 0},
+		{"IFT_SS7SIGLINK", Const, 0},
+		{"IFT_STACKTOSTACK", Const, 0},
+		{"IFT_STARLAN", Const, 0},
+		{"IFT_STF", Const, 0},
+		{"IFT_T1", Const, 0},
+		{"IFT_TDLC", Const, 0},
+		{"IFT_TELINK", Const, 1},
+		{"IFT_TERMPAD", Const, 0},
+		{"IFT_TR008", Const, 0},
+		{"IFT_TRANSPHDLC", Const, 0},
+		{"IFT_TUNNEL", Const, 0},
+		{"IFT_ULTRA", Const, 0},
+		{"IFT_USB", Const, 0},
+		{"IFT_V11", Const, 0},
+		{"IFT_V35", Const, 0},
+		{"IFT_V36", Const, 0},
+		{"IFT_V37", Const, 0},
+		{"IFT_VDSL", Const, 0},
+		{"IFT_VIRTUALIPADDRESS", Const, 0},
+		{"IFT_VIRTUALTG", Const, 1},
+		{"IFT_VOICEDID", Const, 1},
+		{"IFT_VOICEEM", Const, 0},
+		{"IFT_VOICEEMFGD", Const, 1},
+		{"IFT_VOICEENCAP", Const, 0},
+		{"IFT_VOICEFGDEANA", Const, 1},
+		{"IFT_VOICEFXO", Const, 0},
+		{"IFT_VOICEFXS", Const, 0},
+		{"IFT_VOICEOVERATM", Const, 0},
+		{"IFT_VOICEOVERCABLE", Const, 1},
+		{"IFT_VOICEOVERFRAMERELAY", Const, 0},
+		{"IFT_VOICEOVERIP", Const, 0},
+		{"IFT_X213", Const, 0},
+		{"IFT_X25", Const, 0},
+		{"IFT_X25DDN", Const, 0},
+		{"IFT_X25HUNTGROUP", Const, 0},
+		{"IFT_X25MLP", Const, 0},
+		{"IFT_X25PLE", Const, 0},
+		{"IFT_XETHER", Const, 0},
+		{"IGNBRK", Const, 0},
+		{"IGNCR", Const, 0},
+		{"IGNORE", Const, 0},
+		{"IGNPAR", Const, 0},
+		{"IMAXBEL", Const, 0},
+		{"INFINITE", Const, 0},
+		{"INLCR", Const, 0},
+		{"INPCK", Const, 0},
+		{"INVALID_FILE_ATTRIBUTES", Const, 0},
+		{"IN_ACCESS", Const, 0},
+		{"IN_ALL_EVENTS", Const, 0},
+		{"IN_ATTRIB", Const, 0},
+		{"IN_CLASSA_HOST", Const, 0},
+		{"IN_CLASSA_MAX", Const, 0},
+		{"IN_CLASSA_NET", Const, 0},
+		{"IN_CLASSA_NSHIFT", Const, 0},
+		{"IN_CLASSB_HOST", Const, 0},
+		{"IN_CLASSB_MAX", Const, 0},
+		{"IN_CLASSB_NET", Const, 0},
+		{"IN_CLASSB_NSHIFT", Const, 0},
+		{"IN_CLASSC_HOST", Const, 0},
+		{"IN_CLASSC_NET", Const, 0},
+		{"IN_CLASSC_NSHIFT", Const, 0},
+		{"IN_CLASSD_HOST", Const, 0},
+		{"IN_CLASSD_NET", Const, 0},
+		{"IN_CLASSD_NSHIFT", Const, 0},
+		{"IN_CLOEXEC", Const, 0},
+		{"IN_CLOSE", Const, 0},
+		{"IN_CLOSE_NOWRITE", Const, 0},
+		{"IN_CLOSE_WRITE", Const, 0},
+		{"IN_CREATE", Const, 0},
+		{"IN_DELETE", Const, 0},
+		{"IN_DELETE_SELF", Const, 0},
+		{"IN_DONT_FOLLOW", Const, 0},
+		{"IN_EXCL_UNLINK", Const, 0},
+		{"IN_IGNORED", Const, 0},
+		{"IN_ISDIR", Const, 0},
+		{"IN_LINKLOCALNETNUM", Const, 0},
+		{"IN_LOOPBACKNET", Const, 0},
+		{"IN_MASK_ADD", Const, 0},
+		{"IN_MODIFY", Const, 0},
+		{"IN_MOVE", Const, 0},
+		{"IN_MOVED_FROM", Const, 0},
+		{"IN_MOVED_TO", Const, 0},
+		{"IN_MOVE_SELF", Const, 0},
+		{"IN_NONBLOCK", Const, 0},
+		{"IN_ONESHOT", Const, 0},
+		{"IN_ONLYDIR", Const, 0},
+		{"IN_OPEN", Const, 0},
+		{"IN_Q_OVERFLOW", Const, 0},
+		{"IN_RFC3021_HOST", Const, 1},
+		{"IN_RFC3021_MASK", Const, 1},
+		{"IN_RFC3021_NET", Const, 1},
+		{"IN_RFC3021_NSHIFT", Const, 1},
+		{"IN_UNMOUNT", Const, 0},
+		{"IOC_IN", Const, 1},
+		{"IOC_INOUT", Const, 1},
+		{"IOC_OUT", Const, 1},
+		{"IOC_VENDOR", Const, 3},
+		{"IOC_WS2", Const, 1},
+		{"IO_REPARSE_TAG_SYMLINK", Const, 4},
+		{"IPMreq", Type, 0},
+		{"IPMreq.Interface", Field, 0},
+		{"IPMreq.Multiaddr", Field, 0},
+		{"IPMreqn", Type, 0},
+		{"IPMreqn.Address", Field, 0},
+		{"IPMreqn.Ifindex", Field, 0},
+		{"IPMreqn.Multiaddr", Field, 0},
+		{"IPPROTO_3PC", Const, 0},
+		{"IPPROTO_ADFS", Const, 0},
+		{"IPPROTO_AH", Const, 0},
+		{"IPPROTO_AHIP", Const, 0},
+		{"IPPROTO_APES", Const, 0},
+		{"IPPROTO_ARGUS", Const, 0},
+		{"IPPROTO_AX25", Const, 0},
+		{"IPPROTO_BHA", Const, 0},
+		{"IPPROTO_BLT", Const, 0},
+		{"IPPROTO_BRSATMON", Const, 0},
+		{"IPPROTO_CARP", Const, 0},
+		{"IPPROTO_CFTP", Const, 0},
+		{"IPPROTO_CHAOS", Const, 0},
+		{"IPPROTO_CMTP", Const, 0},
+		{"IPPROTO_COMP", Const, 0},
+		{"IPPROTO_CPHB", Const, 0},
+		{"IPPROTO_CPNX", Const, 0},
+		{"IPPROTO_DCCP", Const, 0},
+		{"IPPROTO_DDP", Const, 0},
+		{"IPPROTO_DGP", Const, 0},
+		{"IPPROTO_DIVERT", Const, 0},
+		{"IPPROTO_DIVERT_INIT", Const, 3},
+		{"IPPROTO_DIVERT_RESP", Const, 3},
+		{"IPPROTO_DONE", Const, 0},
+		{"IPPROTO_DSTOPTS", Const, 0},
+		{"IPPROTO_EGP", Const, 0},
+		{"IPPROTO_EMCON", Const, 0},
+		{"IPPROTO_ENCAP", Const, 0},
+		{"IPPROTO_EON", Const, 0},
+		{"IPPROTO_ESP", Const, 0},
+		{"IPPROTO_ETHERIP", Const, 0},
+		{"IPPROTO_FRAGMENT", Const, 0},
+		{"IPPROTO_GGP", Const, 0},
+		{"IPPROTO_GMTP", Const, 0},
+		{"IPPROTO_GRE", Const, 0},
+		{"IPPROTO_HELLO", Const, 0},
+		{"IPPROTO_HMP", Const, 0},
+		{"IPPROTO_HOPOPTS", Const, 0},
+		{"IPPROTO_ICMP", Const, 0},
+		{"IPPROTO_ICMPV6", Const, 0},
+		{"IPPROTO_IDP", Const, 0},
+		{"IPPROTO_IDPR", Const, 0},
+		{"IPPROTO_IDRP", Const, 0},
+		{"IPPROTO_IGMP", Const, 0},
+		{"IPPROTO_IGP", Const, 0},
+		{"IPPROTO_IGRP", Const, 0},
+		{"IPPROTO_IL", Const, 0},
+		{"IPPROTO_INLSP", Const, 0},
+		{"IPPROTO_INP", Const, 0},
+		{"IPPROTO_IP", Const, 0},
+		{"IPPROTO_IPCOMP", Const, 0},
+		{"IPPROTO_IPCV", Const, 0},
+		{"IPPROTO_IPEIP", Const, 0},
+		{"IPPROTO_IPIP", Const, 0},
+		{"IPPROTO_IPPC", Const, 0},
+		{"IPPROTO_IPV4", Const, 0},
+		{"IPPROTO_IPV6", Const, 0},
+		{"IPPROTO_IPV6_ICMP", Const, 1},
+		{"IPPROTO_IRTP", Const, 0},
+		{"IPPROTO_KRYPTOLAN", Const, 0},
+		{"IPPROTO_LARP", Const, 0},
+		{"IPPROTO_LEAF1", Const, 0},
+		{"IPPROTO_LEAF2", Const, 0},
+		{"IPPROTO_MAX", Const, 0},
+		{"IPPROTO_MAXID", Const, 0},
+		{"IPPROTO_MEAS", Const, 0},
+		{"IPPROTO_MH", Const, 1},
+		{"IPPROTO_MHRP", Const, 0},
+		{"IPPROTO_MICP", Const, 0},
+		{"IPPROTO_MOBILE", Const, 0},
+		{"IPPROTO_MPLS", Const, 1},
+		{"IPPROTO_MTP", Const, 0},
+		{"IPPROTO_MUX", Const, 0},
+		{"IPPROTO_ND", Const, 0},
+		{"IPPROTO_NHRP", Const, 0},
+		{"IPPROTO_NONE", Const, 0},
+		{"IPPROTO_NSP", Const, 0},
+		{"IPPROTO_NVPII", Const, 0},
+		{"IPPROTO_OLD_DIVERT", Const, 0},
+		{"IPPROTO_OSPFIGP", Const, 0},
+		{"IPPROTO_PFSYNC", Const, 0},
+		{"IPPROTO_PGM", Const, 0},
+		{"IPPROTO_PIGP", Const, 0},
+		{"IPPROTO_PIM", Const, 0},
+		{"IPPROTO_PRM", Const, 0},
+		{"IPPROTO_PUP", Const, 0},
+		{"IPPROTO_PVP", Const, 0},
+		{"IPPROTO_RAW", Const, 0},
+		{"IPPROTO_RCCMON", Const, 0},
+		{"IPPROTO_RDP", Const, 0},
+		{"IPPROTO_ROUTING", Const, 0},
+		{"IPPROTO_RSVP", Const, 0},
+		{"IPPROTO_RVD", Const, 0},
+		{"IPPROTO_SATEXPAK", Const, 0},
+		{"IPPROTO_SATMON", Const, 0},
+		{"IPPROTO_SCCSP", Const, 0},
+		{"IPPROTO_SCTP", Const, 0},
+		{"IPPROTO_SDRP", Const, 0},
+		{"IPPROTO_SEND", Const, 1},
+		{"IPPROTO_SEP", Const, 0},
+		{"IPPROTO_SKIP", Const, 0},
+		{"IPPROTO_SPACER", Const, 0},
+		{"IPPROTO_SRPC", Const, 0},
+		{"IPPROTO_ST", Const, 0},
+		{"IPPROTO_SVMTP", Const, 0},
+		{"IPPROTO_SWIPE", Const, 0},
+		{"IPPROTO_TCF", Const, 0},
+		{"IPPROTO_TCP", Const, 0},
+		{"IPPROTO_TLSP", Const, 0},
+		{"IPPROTO_TP", Const, 0},
+		{"IPPROTO_TPXX", Const, 0},
+		{"IPPROTO_TRUNK1", Const, 0},
+		{"IPPROTO_TRUNK2", Const, 0},
+		{"IPPROTO_TTP", Const, 0},
+		{"IPPROTO_UDP", Const, 0},
+		{"IPPROTO_UDPLITE", Const, 0},
+		{"IPPROTO_VINES", Const, 0},
+		{"IPPROTO_VISA", Const, 0},
+		{"IPPROTO_VMTP", Const, 0},
+		{"IPPROTO_VRRP", Const, 1},
+		{"IPPROTO_WBEXPAK", Const, 0},
+		{"IPPROTO_WBMON", Const, 0},
+		{"IPPROTO_WSN", Const, 0},
+		{"IPPROTO_XNET", Const, 0},
+		{"IPPROTO_XTP", Const, 0},
+		{"IPV6_2292DSTOPTS", Const, 0},
+		{"IPV6_2292HOPLIMIT", Const, 0},
+		{"IPV6_2292HOPOPTS", Const, 0},
+		{"IPV6_2292NEXTHOP", Const, 0},
+		{"IPV6_2292PKTINFO", Const, 0},
+		{"IPV6_2292PKTOPTIONS", Const, 0},
+		{"IPV6_2292RTHDR", Const, 0},
+		{"IPV6_ADDRFORM", Const, 0},
+		{"IPV6_ADD_MEMBERSHIP", Const, 0},
+		{"IPV6_AUTHHDR", Const, 0},
+		{"IPV6_AUTH_LEVEL", Const, 1},
+		{"IPV6_AUTOFLOWLABEL", Const, 0},
+		{"IPV6_BINDANY", Const, 0},
+		{"IPV6_BINDV6ONLY", Const, 0},
+		{"IPV6_BOUND_IF", Const, 0},
+		{"IPV6_CHECKSUM", Const, 0},
+		{"IPV6_DEFAULT_MULTICAST_HOPS", Const, 0},
+		{"IPV6_DEFAULT_MULTICAST_LOOP", Const, 0},
+		{"IPV6_DEFHLIM", Const, 0},
+		{"IPV6_DONTFRAG", Const, 0},
+		{"IPV6_DROP_MEMBERSHIP", Const, 0},
+		{"IPV6_DSTOPTS", Const, 0},
+		{"IPV6_ESP_NETWORK_LEVEL", Const, 1},
+		{"IPV6_ESP_TRANS_LEVEL", Const, 1},
+		{"IPV6_FAITH", Const, 0},
+		{"IPV6_FLOWINFO_MASK", Const, 0},
+		{"IPV6_FLOWLABEL_MASK", Const, 0},
+		{"IPV6_FRAGTTL", Const, 0},
+		{"IPV6_FW_ADD", Const, 0},
+		{"IPV6_FW_DEL", Const, 0},
+		{"IPV6_FW_FLUSH", Const, 0},
+		{"IPV6_FW_GET", Const, 0},
+		{"IPV6_FW_ZERO", Const, 0},
+		{"IPV6_HLIMDEC", Const, 0},
+		{"IPV6_HOPLIMIT", Const, 0},
+		{"IPV6_HOPOPTS", Const, 0},
+		{"IPV6_IPCOMP_LEVEL", Const, 1},
+		{"IPV6_IPSEC_POLICY", Const, 0},
+		{"IPV6_JOIN_ANYCAST", Const, 0},
+		{"IPV6_JOIN_GROUP", Const, 0},
+		{"IPV6_LEAVE_ANYCAST", Const, 0},
+		{"IPV6_LEAVE_GROUP", Const, 0},
+		{"IPV6_MAXHLIM", Const, 0},
+		{"IPV6_MAXOPTHDR", Const, 0},
+		{"IPV6_MAXPACKET", Const, 0},
+		{"IPV6_MAX_GROUP_SRC_FILTER", Const, 0},
+		{"IPV6_MAX_MEMBERSHIPS", Const, 0},
+		{"IPV6_MAX_SOCK_SRC_FILTER", Const, 0},
+		{"IPV6_MIN_MEMBERSHIPS", Const, 0},
+		{"IPV6_MMTU", Const, 0},
+		{"IPV6_MSFILTER", Const, 0},
+		{"IPV6_MTU", Const, 0},
+		{"IPV6_MTU_DISCOVER", Const, 0},
+		{"IPV6_MULTICAST_HOPS", Const, 0},
+		{"IPV6_MULTICAST_IF", Const, 0},
+		{"IPV6_MULTICAST_LOOP", Const, 0},
+		{"IPV6_NEXTHOP", Const, 0},
+		{"IPV6_OPTIONS", Const, 1},
+		{"IPV6_PATHMTU", Const, 0},
+		{"IPV6_PIPEX", Const, 1},
+		{"IPV6_PKTINFO", Const, 0},
+		{"IPV6_PMTUDISC_DO", Const, 0},
+		{"IPV6_PMTUDISC_DONT", Const, 0},
+		{"IPV6_PMTUDISC_PROBE", Const, 0},
+		{"IPV6_PMTUDISC_WANT", Const, 0},
+		{"IPV6_PORTRANGE", Const, 0},
+		{"IPV6_PORTRANGE_DEFAULT", Const, 0},
+		{"IPV6_PORTRANGE_HIGH", Const, 0},
+		{"IPV6_PORTRANGE_LOW", Const, 0},
+		{"IPV6_PREFER_TEMPADDR", Const, 0},
+		{"IPV6_RECVDSTOPTS", Const, 0},
+		{"IPV6_RECVDSTPORT", Const, 3},
+		{"IPV6_RECVERR", Const, 0},
+		{"IPV6_RECVHOPLIMIT", Const, 0},
+		{"IPV6_RECVHOPOPTS", Const, 0},
+		{"IPV6_RECVPATHMTU", Const, 0},
+		{"IPV6_RECVPKTINFO", Const, 0},
+		{"IPV6_RECVRTHDR", Const, 0},
+		{"IPV6_RECVTCLASS", Const, 0},
+		{"IPV6_ROUTER_ALERT", Const, 0},
+		{"IPV6_RTABLE", Const, 1},
+		{"IPV6_RTHDR", Const, 0},
+		{"IPV6_RTHDRDSTOPTS", Const, 0},
+		{"IPV6_RTHDR_LOOSE", Const, 0},
+		{"IPV6_RTHDR_STRICT", Const, 0},
+		{"IPV6_RTHDR_TYPE_0", Const, 0},
+		{"IPV6_RXDSTOPTS", Const, 0},
+		{"IPV6_RXHOPOPTS", Const, 0},
+		{"IPV6_SOCKOPT_RESERVED1", Const, 0},
+		{"IPV6_TCLASS", Const, 0},
+		{"IPV6_UNICAST_HOPS", Const, 0},
+		{"IPV6_USE_MIN_MTU", Const, 0},
+		{"IPV6_V6ONLY", Const, 0},
+		{"IPV6_VERSION", Const, 0},
+		{"IPV6_VERSION_MASK", Const, 0},
+		{"IPV6_XFRM_POLICY", Const, 0},
+		{"IP_ADD_MEMBERSHIP", Const, 0},
+		{"IP_ADD_SOURCE_MEMBERSHIP", Const, 0},
+		{"IP_AUTH_LEVEL", Const, 1},
+		{"IP_BINDANY", Const, 0},
+		{"IP_BLOCK_SOURCE", Const, 0},
+		{"IP_BOUND_IF", Const, 0},
+		{"IP_DEFAULT_MULTICAST_LOOP", Const, 0},
+		{"IP_DEFAULT_MULTICAST_TTL", Const, 0},
+		{"IP_DF", Const, 0},
+		{"IP_DIVERTFL", Const, 3},
+		{"IP_DONTFRAG", Const, 0},
+		{"IP_DROP_MEMBERSHIP", Const, 0},
+		{"IP_DROP_SOURCE_MEMBERSHIP", Const, 0},
+		{"IP_DUMMYNET3", Const, 0},
+		{"IP_DUMMYNET_CONFIGURE", Const, 0},
+		{"IP_DUMMYNET_DEL", Const, 0},
+		{"IP_DUMMYNET_FLUSH", Const, 0},
+		{"IP_DUMMYNET_GET", Const, 0},
+		{"IP_EF", Const, 1},
+		{"IP_ERRORMTU", Const, 1},
+		{"IP_ESP_NETWORK_LEVEL", Const, 1},
+		{"IP_ESP_TRANS_LEVEL", Const, 1},
+		{"IP_FAITH", Const, 0},
+		{"IP_FREEBIND", Const, 0},
+		{"IP_FW3", Const, 0},
+		{"IP_FW_ADD", Const, 0},
+		{"IP_FW_DEL", Const, 0},
+		{"IP_FW_FLUSH", Const, 0},
+		{"IP_FW_GET", Const, 0},
+		{"IP_FW_NAT_CFG", Const, 0},
+		{"IP_FW_NAT_DEL", Const, 0},
+		{"IP_FW_NAT_GET_CONFIG", Const, 0},
+		{"IP_FW_NAT_GET_LOG", Const, 0},
+		{"IP_FW_RESETLOG", Const, 0},
+		{"IP_FW_TABLE_ADD", Const, 0},
+		{"IP_FW_TABLE_DEL", Const, 0},
+		{"IP_FW_TABLE_FLUSH", Const, 0},
+		{"IP_FW_TABLE_GETSIZE", Const, 0},
+		{"IP_FW_TABLE_LIST", Const, 0},
+		{"IP_FW_ZERO", Const, 0},
+		{"IP_HDRINCL", Const, 0},
+		{"IP_IPCOMP_LEVEL", Const, 1},
+		{"IP_IPSECFLOWINFO", Const, 1},
+		{"IP_IPSEC_LOCAL_AUTH", Const, 1},
+		{"IP_IPSEC_LOCAL_CRED", Const, 1},
+		{"IP_IPSEC_LOCAL_ID", Const, 1},
+		{"IP_IPSEC_POLICY", Const, 0},
+		{"IP_IPSEC_REMOTE_AUTH", Const, 1},
+		{"IP_IPSEC_REMOTE_CRED", Const, 1},
+		{"IP_IPSEC_REMOTE_ID", Const, 1},
+		{"IP_MAXPACKET", Const, 0},
+		{"IP_MAX_GROUP_SRC_FILTER", Const, 0},
+		{"IP_MAX_MEMBERSHIPS", Const, 0},
+		{"IP_MAX_SOCK_MUTE_FILTER", Const, 0},
+		{"IP_MAX_SOCK_SRC_FILTER", Const, 0},
+		{"IP_MAX_SOURCE_FILTER", Const, 0},
+		{"IP_MF", Const, 0},
+		{"IP_MINFRAGSIZE", Const, 1},
+		{"IP_MINTTL", Const, 0},
+		{"IP_MIN_MEMBERSHIPS", Const, 0},
+		{"IP_MSFILTER", Const, 0},
+		{"IP_MSS", Const, 0},
+		{"IP_MTU", Const, 0},
+		{"IP_MTU_DISCOVER", Const, 0},
+		{"IP_MULTICAST_IF", Const, 0},
+		{"IP_MULTICAST_IFINDEX", Const, 0},
+		{"IP_MULTICAST_LOOP", Const, 0},
+		{"IP_MULTICAST_TTL", Const, 0},
+		{"IP_MULTICAST_VIF", Const, 0},
+		{"IP_NAT__XXX", Const, 0},
+		{"IP_OFFMASK", Const, 0},
+		{"IP_OLD_FW_ADD", Const, 0},
+		{"IP_OLD_FW_DEL", Const, 0},
+		{"IP_OLD_FW_FLUSH", Const, 0},
+		{"IP_OLD_FW_GET", Const, 0},
+		{"IP_OLD_FW_RESETLOG", Const, 0},
+		{"IP_OLD_FW_ZERO", Const, 0},
+		{"IP_ONESBCAST", Const, 0},
+		{"IP_OPTIONS", Const, 0},
+		{"IP_ORIGDSTADDR", Const, 0},
+		{"IP_PASSSEC", Const, 0},
+		{"IP_PIPEX", Const, 1},
+		{"IP_PKTINFO", Const, 0},
+		{"IP_PKTOPTIONS", Const, 0},
+		{"IP_PMTUDISC", Const, 0},
+		{"IP_PMTUDISC_DO", Const, 0},
+		{"IP_PMTUDISC_DONT", Const, 0},
+		{"IP_PMTUDISC_PROBE", Const, 0},
+		{"IP_PMTUDISC_WANT", Const, 0},
+		{"IP_PORTRANGE", Const, 0},
+		{"IP_PORTRANGE_DEFAULT", Const, 0},
+		{"IP_PORTRANGE_HIGH", Const, 0},
+		{"IP_PORTRANGE_LOW", Const, 0},
+		{"IP_RECVDSTADDR", Const, 0},
+		{"IP_RECVDSTPORT", Const, 1},
+		{"IP_RECVERR", Const, 0},
+		{"IP_RECVIF", Const, 0},
+		{"IP_RECVOPTS", Const, 0},
+		{"IP_RECVORIGDSTADDR", Const, 0},
+		{"IP_RECVPKTINFO", Const, 0},
+		{"IP_RECVRETOPTS", Const, 0},
+		{"IP_RECVRTABLE", Const, 1},
+		{"IP_RECVTOS", Const, 0},
+		{"IP_RECVTTL", Const, 0},
+		{"IP_RETOPTS", Const, 0},
+		{"IP_RF", Const, 0},
+		{"IP_ROUTER_ALERT", Const, 0},
+		{"IP_RSVP_OFF", Const, 0},
+		{"IP_RSVP_ON", Const, 0},
+		{"IP_RSVP_VIF_OFF", Const, 0},
+		{"IP_RSVP_VIF_ON", Const, 0},
+		{"IP_RTABLE", Const, 1},
+		{"IP_SENDSRCADDR", Const, 0},
+		{"IP_STRIPHDR", Const, 0},
+		{"IP_TOS", Const, 0},
+		{"IP_TRAFFIC_MGT_BACKGROUND", Const, 0},
+		{"IP_TRANSPARENT", Const, 0},
+		{"IP_TTL", Const, 0},
+		{"IP_UNBLOCK_SOURCE", Const, 0},
+		{"IP_XFRM_POLICY", Const, 0},
+		{"IPv6MTUInfo", Type, 2},
+		{"IPv6MTUInfo.Addr", Field, 2},
+		{"IPv6MTUInfo.Mtu", Field, 2},
+		{"IPv6Mreq", Type, 0},
+		{"IPv6Mreq.Interface", Field, 0},
+		{"IPv6Mreq.Multiaddr", Field, 0},
+		{"ISIG", Const, 0},
+		{"ISTRIP", Const, 0},
+		{"IUCLC", Const, 0},
+		{"IUTF8", Const, 0},
+		{"IXANY", Const, 0},
+		{"IXOFF", Const, 0},
+		{"IXON", Const, 0},
+		{"IfAddrmsg", Type, 0},
+		{"IfAddrmsg.Family", Field, 0},
+		{"IfAddrmsg.Flags", Field, 0},
+		{"IfAddrmsg.Index", Field, 0},
+		{"IfAddrmsg.Prefixlen", Field, 0},
+		{"IfAddrmsg.Scope", Field, 0},
+		{"IfAnnounceMsghdr", Type, 1},
+		{"IfAnnounceMsghdr.Hdrlen", Field, 2},
+		{"IfAnnounceMsghdr.Index", Field, 1},
+		{"IfAnnounceMsghdr.Msglen", Field, 1},
+		{"IfAnnounceMsghdr.Name", Field, 1},
+		{"IfAnnounceMsghdr.Type", Field, 1},
+		{"IfAnnounceMsghdr.Version", Field, 1},
+		{"IfAnnounceMsghdr.What", Field, 1},
+		{"IfData", Type, 0},
+		{"IfData.Addrlen", Field, 0},
+		{"IfData.Baudrate", Field, 0},
+		{"IfData.Capabilities", Field, 2},
+		{"IfData.Collisions", Field, 0},
+		{"IfData.Datalen", Field, 0},
+		{"IfData.Epoch", Field, 0},
+		{"IfData.Hdrlen", Field, 0},
+		{"IfData.Hwassist", Field, 0},
+		{"IfData.Ibytes", Field, 0},
+		{"IfData.Ierrors", Field, 0},
+		{"IfData.Imcasts", Field, 0},
+		{"IfData.Ipackets", Field, 0},
+		{"IfData.Iqdrops", Field, 0},
+		{"IfData.Lastchange", Field, 0},
+		{"IfData.Link_state", Field, 0},
+		{"IfData.Mclpool", Field, 2},
+		{"IfData.Metric", Field, 0},
+		{"IfData.Mtu", Field, 0},
+		{"IfData.Noproto", Field, 0},
+		{"IfData.Obytes", Field, 0},
+		{"IfData.Oerrors", Field, 0},
+		{"IfData.Omcasts", Field, 0},
+		{"IfData.Opackets", Field, 0},
+		{"IfData.Pad", Field, 2},
+		{"IfData.Pad_cgo_0", Field, 2},
+		{"IfData.Pad_cgo_1", Field, 2},
+		{"IfData.Physical", Field, 0},
+		{"IfData.Recvquota", Field, 0},
+		{"IfData.Recvtiming", Field, 0},
+		{"IfData.Reserved1", Field, 0},
+		{"IfData.Reserved2", Field, 0},
+		{"IfData.Spare_char1", Field, 0},
+		{"IfData.Spare_char2", Field, 0},
+		{"IfData.Type", Field, 0},
+		{"IfData.Typelen", Field, 0},
+		{"IfData.Unused1", Field, 0},
+		{"IfData.Unused2", Field, 0},
+		{"IfData.Xmitquota", Field, 0},
+		{"IfData.Xmittiming", Field, 0},
+		{"IfInfomsg", Type, 0},
+		{"IfInfomsg.Change", Field, 0},
+		{"IfInfomsg.Family", Field, 0},
+		{"IfInfomsg.Flags", Field, 0},
+		{"IfInfomsg.Index", Field, 0},
+		{"IfInfomsg.Type", Field, 0},
+		{"IfInfomsg.X__ifi_pad", Field, 0},
+		{"IfMsghdr", Type, 0},
+		{"IfMsghdr.Addrs", Field, 0},
+		{"IfMsghdr.Data", Field, 0},
+		{"IfMsghdr.Flags", Field, 0},
+		{"IfMsghdr.Hdrlen", Field, 2},
+		{"IfMsghdr.Index", Field, 0},
+		{"IfMsghdr.Msglen", Field, 0},
+		{"IfMsghdr.Pad1", Field, 2},
+		{"IfMsghdr.Pad2", Field, 2},
+		{"IfMsghdr.Pad_cgo_0", Field, 0},
+		{"IfMsghdr.Pad_cgo_1", Field, 2},
+		{"IfMsghdr.Tableid", Field, 2},
+		{"IfMsghdr.Type", Field, 0},
+		{"IfMsghdr.Version", Field, 0},
+		{"IfMsghdr.Xflags", Field, 2},
+		{"IfaMsghdr", Type, 0},
+		{"IfaMsghdr.Addrs", Field, 0},
+		{"IfaMsghdr.Flags", Field, 0},
+		{"IfaMsghdr.Hdrlen", Field, 2},
+		{"IfaMsghdr.Index", Field, 0},
+		{"IfaMsghdr.Metric", Field, 0},
+		{"IfaMsghdr.Msglen", Field, 0},
+		{"IfaMsghdr.Pad1", Field, 2},
+		{"IfaMsghdr.Pad2", Field, 2},
+		{"IfaMsghdr.Pad_cgo_0", Field, 0},
+		{"IfaMsghdr.Tableid", Field, 2},
+		{"IfaMsghdr.Type", Field, 0},
+		{"IfaMsghdr.Version", Field, 0},
+		{"IfmaMsghdr", Type, 0},
+		{"IfmaMsghdr.Addrs", Field, 0},
+		{"IfmaMsghdr.Flags", Field, 0},
+		{"IfmaMsghdr.Index", Field, 0},
+		{"IfmaMsghdr.Msglen", Field, 0},
+		{"IfmaMsghdr.Pad_cgo_0", Field, 0},
+		{"IfmaMsghdr.Type", Field, 0},
+		{"IfmaMsghdr.Version", Field, 0},
+		{"IfmaMsghdr2", Type, 0},
+		{"IfmaMsghdr2.Addrs", Field, 0},
+		{"IfmaMsghdr2.Flags", Field, 0},
+		{"IfmaMsghdr2.Index", Field, 0},
+		{"IfmaMsghdr2.Msglen", Field, 0},
+		{"IfmaMsghdr2.Pad_cgo_0", Field, 0},
+		{"IfmaMsghdr2.Refcount", Field, 0},
+		{"IfmaMsghdr2.Type", Field, 0},
+		{"IfmaMsghdr2.Version", Field, 0},
+		{"ImplementsGetwd", Const, 0},
+		{"Inet4Pktinfo", Type, 0},
+		{"Inet4Pktinfo.Addr", Field, 0},
+		{"Inet4Pktinfo.Ifindex", Field, 0},
+		{"Inet4Pktinfo.Spec_dst", Field, 0},
+		{"Inet6Pktinfo", Type, 0},
+		{"Inet6Pktinfo.Addr", Field, 0},
+		{"Inet6Pktinfo.Ifindex", Field, 0},
+		{"InotifyAddWatch", Func, 0},
+		{"InotifyEvent", Type, 0},
+		{"InotifyEvent.Cookie", Field, 0},
+		{"InotifyEvent.Len", Field, 0},
+		{"InotifyEvent.Mask", Field, 0},
+		{"InotifyEvent.Name", Field, 0},
+		{"InotifyEvent.Wd", Field, 0},
+		{"InotifyInit", Func, 0},
+		{"InotifyInit1", Func, 0},
+		{"InotifyRmWatch", Func, 0},
+		{"InterfaceAddrMessage", Type, 0},
+		{"InterfaceAddrMessage.Data", Field, 0},
+		{"InterfaceAddrMessage.Header", Field, 0},
+		{"InterfaceAnnounceMessage", Type, 1},
+		{"InterfaceAnnounceMessage.Header", Field, 1},
+		{"InterfaceInfo", Type, 0},
+		{"InterfaceInfo.Address", Field, 0},
+		{"InterfaceInfo.BroadcastAddress", Field, 0},
+		{"InterfaceInfo.Flags", Field, 0},
+		{"InterfaceInfo.Netmask", Field, 0},
+		{"InterfaceMessage", Type, 0},
+		{"InterfaceMessage.Data", Field, 0},
+		{"InterfaceMessage.Header", Field, 0},
+		{"InterfaceMulticastAddrMessage", Type, 0},
+		{"InterfaceMulticastAddrMessage.Data", Field, 0},
+		{"InterfaceMulticastAddrMessage.Header", Field, 0},
+		{"InvalidHandle", Const, 0},
+		{"Ioperm", Func, 0},
+		{"Iopl", Func, 0},
+		{"Iovec", Type, 0},
+		{"Iovec.Base", Field, 0},
+		{"Iovec.Len", Field, 0},
+		{"IpAdapterInfo", Type, 0},
+		{"IpAdapterInfo.AdapterName", Field, 0},
+		{"IpAdapterInfo.Address", Field, 0},
+		{"IpAdapterInfo.AddressLength", Field, 0},
+		{"IpAdapterInfo.ComboIndex", Field, 0},
+		{"IpAdapterInfo.CurrentIpAddress", Field, 0},
+		{"IpAdapterInfo.Description", Field, 0},
+		{"IpAdapterInfo.DhcpEnabled", Field, 0},
+		{"IpAdapterInfo.DhcpServer", Field, 0},
+		{"IpAdapterInfo.GatewayList", Field, 0},
+		{"IpAdapterInfo.HaveWins", Field, 0},
+		{"IpAdapterInfo.Index", Field, 0},
+		{"IpAdapterInfo.IpAddressList", Field, 0},
+		{"IpAdapterInfo.LeaseExpires", Field, 0},
+		{"IpAdapterInfo.LeaseObtained", Field, 0},
+		{"IpAdapterInfo.Next", Field, 0},
+		{"IpAdapterInfo.PrimaryWinsServer", Field, 0},
+		{"IpAdapterInfo.SecondaryWinsServer", Field, 0},
+		{"IpAdapterInfo.Type", Field, 0},
+		{"IpAddrString", Type, 0},
+		{"IpAddrString.Context", Field, 0},
+		{"IpAddrString.IpAddress", Field, 0},
+		{"IpAddrString.IpMask", Field, 0},
+		{"IpAddrString.Next", Field, 0},
+		{"IpAddressString", Type, 0},
+		{"IpAddressString.String", Field, 0},
+		{"IpMaskString", Type, 0},
+		{"IpMaskString.String", Field, 2},
+		{"Issetugid", Func, 0},
+		{"KEY_ALL_ACCESS", Const, 0},
+		{"KEY_CREATE_LINK", Const, 0},
+		{"KEY_CREATE_SUB_KEY", Const, 0},
+		{"KEY_ENUMERATE_SUB_KEYS", Const, 0},
+		{"KEY_EXECUTE", Const, 0},
+		{"KEY_NOTIFY", Const, 0},
+		{"KEY_QUERY_VALUE", Const, 0},
+		{"KEY_READ", Const, 0},
+		{"KEY_SET_VALUE", Const, 0},
+		{"KEY_WOW64_32KEY", Const, 0},
+		{"KEY_WOW64_64KEY", Const, 0},
+		{"KEY_WRITE", Const, 0},
+		{"Kevent", Func, 0},
+		{"Kevent_t", Type, 0},
+		{"Kevent_t.Data", Field, 0},
+		{"Kevent_t.Fflags", Field, 0},
+		{"Kevent_t.Filter", Field, 0},
+		{"Kevent_t.Flags", Field, 0},
+		{"Kevent_t.Ident", Field, 0},
+		{"Kevent_t.Pad_cgo_0", Field, 2},
+		{"Kevent_t.Udata", Field, 0},
+		{"Kill", Func, 0},
+		{"Klogctl", Func, 0},
+		{"Kqueue", Func, 0},
+		{"LANG_ENGLISH", Const, 0},
+		{"LAYERED_PROTOCOL", Const, 2},
+		{"LCNT_OVERLOAD_FLUSH", Const, 1},
+		{"LINUX_REBOOT_CMD_CAD_OFF", Const, 0},
+		{"LINUX_REBOOT_CMD_CAD_ON", Const, 0},
+		{"LINUX_REBOOT_CMD_HALT", Const, 0},
+		{"LINUX_REBOOT_CMD_KEXEC", Const, 0},
+		{"LINUX_REBOOT_CMD_POWER_OFF", Const, 0},
+		{"LINUX_REBOOT_CMD_RESTART", Const, 0},
+		{"LINUX_REBOOT_CMD_RESTART2", Const, 0},
+		{"LINUX_REBOOT_CMD_SW_SUSPEND", Const, 0},
+		{"LINUX_REBOOT_MAGIC1", Const, 0},
+		{"LINUX_REBOOT_MAGIC2", Const, 0},
+		{"LOCK_EX", Const, 0},
+		{"LOCK_NB", Const, 0},
+		{"LOCK_SH", Const, 0},
+		{"LOCK_UN", Const, 0},
+		{"LazyDLL", Type, 0},
+		{"LazyDLL.Name", Field, 0},
+		{"LazyProc", Type, 0},
+		{"LazyProc.Name", Field, 0},
+		{"Lchown", Func, 0},
+		{"Linger", Type, 0},
+		{"Linger.Linger", Field, 0},
+		{"Linger.Onoff", Field, 0},
+		{"Link", Func, 0},
+		{"Listen", Func, 0},
+		{"Listxattr", Func, 1},
+		{"LoadCancelIoEx", Func, 1},
+		{"LoadConnectEx", Func, 1},
+		{"LoadCreateSymbolicLink", Func, 4},
+		{"LoadDLL", Func, 0},
+		{"LoadGetAddrInfo", Func, 1},
+		{"LoadLibrary", Func, 0},
+		{"LoadSetFileCompletionNotificationModes", Func, 2},
+		{"LocalFree", Func, 0},
+		{"Log2phys_t", Type, 0},
+		{"Log2phys_t.Contigbytes", Field, 0},
+		{"Log2phys_t.Devoffset", Field, 0},
+		{"Log2phys_t.Flags", Field, 0},
+		{"LookupAccountName", Func, 0},
+		{"LookupAccountSid", Func, 0},
+		{"LookupSID", Func, 0},
+		{"LsfJump", Func, 0},
+		{"LsfSocket", Func, 0},
+		{"LsfStmt", Func, 0},
+		{"Lstat", Func, 0},
+		{"MADV_AUTOSYNC", Const, 1},
+		{"MADV_CAN_REUSE", Const, 0},
+		{"MADV_CORE", Const, 1},
+		{"MADV_DOFORK", Const, 0},
+		{"MADV_DONTFORK", Const, 0},
+		{"MADV_DONTNEED", Const, 0},
+		{"MADV_FREE", Const, 0},
+		{"MADV_FREE_REUSABLE", Const, 0},
+		{"MADV_FREE_REUSE", Const, 0},
+		{"MADV_HUGEPAGE", Const, 0},
+		{"MADV_HWPOISON", Const, 0},
+		{"MADV_MERGEABLE", Const, 0},
+		{"MADV_NOCORE", Const, 1},
+		{"MADV_NOHUGEPAGE", Const, 0},
+		{"MADV_NORMAL", Const, 0},
+		{"MADV_NOSYNC", Const, 1},
+		{"MADV_PROTECT", Const, 1},
+		{"MADV_RANDOM", Const, 0},
+		{"MADV_REMOVE", Const, 0},
+		{"MADV_SEQUENTIAL", Const, 0},
+		{"MADV_SPACEAVAIL", Const, 3},
+		{"MADV_UNMERGEABLE", Const, 0},
+		{"MADV_WILLNEED", Const, 0},
+		{"MADV_ZERO_WIRED_PAGES", Const, 0},
+		{"MAP_32BIT", Const, 0},
+		{"MAP_ALIGNED_SUPER", Const, 3},
+		{"MAP_ALIGNMENT_16MB", Const, 3},
+		{"MAP_ALIGNMENT_1TB", Const, 3},
+		{"MAP_ALIGNMENT_256TB", Const, 3},
+		{"MAP_ALIGNMENT_4GB", Const, 3},
+		{"MAP_ALIGNMENT_64KB", Const, 3},
+		{"MAP_ALIGNMENT_64PB", Const, 3},
+		{"MAP_ALIGNMENT_MASK", Const, 3},
+		{"MAP_ALIGNMENT_SHIFT", Const, 3},
+		{"MAP_ANON", Const, 0},
+		{"MAP_ANONYMOUS", Const, 0},
+		{"MAP_COPY", Const, 0},
+		{"MAP_DENYWRITE", Const, 0},
+		{"MAP_EXECUTABLE", Const, 0},
+		{"MAP_FILE", Const, 0},
+		{"MAP_FIXED", Const, 0},
+		{"MAP_FLAGMASK", Const, 3},
+		{"MAP_GROWSDOWN", Const, 0},
+		{"MAP_HASSEMAPHORE", Const, 0},
+		{"MAP_HUGETLB", Const, 0},
+		{"MAP_INHERIT", Const, 3},
+		{"MAP_INHERIT_COPY", Const, 3},
+		{"MAP_INHERIT_DEFAULT", Const, 3},
+		{"MAP_INHERIT_DONATE_COPY", Const, 3},
+		{"MAP_INHERIT_NONE", Const, 3},
+		{"MAP_INHERIT_SHARE", Const, 3},
+		{"MAP_JIT", Const, 0},
+		{"MAP_LOCKED", Const, 0},
+		{"MAP_NOCACHE", Const, 0},
+		{"MAP_NOCORE", Const, 1},
+		{"MAP_NOEXTEND", Const, 0},
+		{"MAP_NONBLOCK", Const, 0},
+		{"MAP_NORESERVE", Const, 0},
+		{"MAP_NOSYNC", Const, 1},
+		{"MAP_POPULATE", Const, 0},
+		{"MAP_PREFAULT_READ", Const, 1},
+		{"MAP_PRIVATE", Const, 0},
+		{"MAP_RENAME", Const, 0},
+		{"MAP_RESERVED0080", Const, 0},
+		{"MAP_RESERVED0100", Const, 1},
+		{"MAP_SHARED", Const, 0},
+		{"MAP_STACK", Const, 0},
+		{"MAP_TRYFIXED", Const, 3},
+		{"MAP_TYPE", Const, 0},
+		{"MAP_WIRED", Const, 3},
+		{"MAXIMUM_REPARSE_DATA_BUFFER_SIZE", Const, 4},
+		{"MAXLEN_IFDESCR", Const, 0},
+		{"MAXLEN_PHYSADDR", Const, 0},
+		{"MAX_ADAPTER_ADDRESS_LENGTH", Const, 0},
+		{"MAX_ADAPTER_DESCRIPTION_LENGTH", Const, 0},
+		{"MAX_ADAPTER_NAME_LENGTH", Const, 0},
+		{"MAX_COMPUTERNAME_LENGTH", Const, 0},
+		{"MAX_INTERFACE_NAME_LEN", Const, 0},
+		{"MAX_LONG_PATH", Const, 0},
+		{"MAX_PATH", Const, 0},
+		{"MAX_PROTOCOL_CHAIN", Const, 2},
+		{"MCL_CURRENT", Const, 0},
+		{"MCL_FUTURE", Const, 0},
+		{"MNT_DETACH", Const, 0},
+		{"MNT_EXPIRE", Const, 0},
+		{"MNT_FORCE", Const, 0},
+		{"MSG_BCAST", Const, 1},
+		{"MSG_CMSG_CLOEXEC", Const, 0},
+		{"MSG_COMPAT", Const, 0},
+		{"MSG_CONFIRM", Const, 0},
+		{"MSG_CONTROLMBUF", Const, 1},
+		{"MSG_CTRUNC", Const, 0},
+		{"MSG_DONTROUTE", Const, 0},
+		{"MSG_DONTWAIT", Const, 0},
+		{"MSG_EOF", Const, 0},
+		{"MSG_EOR", Const, 0},
+		{"MSG_ERRQUEUE", Const, 0},
+		{"MSG_FASTOPEN", Const, 1},
+		{"MSG_FIN", Const, 0},
+		{"MSG_FLUSH", Const, 0},
+		{"MSG_HAVEMORE", Const, 0},
+		{"MSG_HOLD", Const, 0},
+		{"MSG_IOVUSRSPACE", Const, 1},
+		{"MSG_LENUSRSPACE", Const, 1},
+		{"MSG_MCAST", Const, 1},
+		{"MSG_MORE", Const, 0},
+		{"MSG_NAMEMBUF", Const, 1},
+		{"MSG_NBIO", Const, 0},
+		{"MSG_NEEDSA", Const, 0},
+		{"MSG_NOSIGNAL", Const, 0},
+		{"MSG_NOTIFICATION", Const, 0},
+		{"MSG_OOB", Const, 0},
+		{"MSG_PEEK", Const, 0},
+		{"MSG_PROXY", Const, 0},
+		{"MSG_RCVMORE", Const, 0},
+		{"MSG_RST", Const, 0},
+		{"MSG_SEND", Const, 0},
+		{"MSG_SYN", Const, 0},
+		{"MSG_TRUNC", Const, 0},
+		{"MSG_TRYHARD", Const, 0},
+		{"MSG_USERFLAGS", Const, 1},
+		{"MSG_WAITALL", Const, 0},
+		{"MSG_WAITFORONE", Const, 0},
+		{"MSG_WAITSTREAM", Const, 0},
+		{"MS_ACTIVE", Const, 0},
+		{"MS_ASYNC", Const, 0},
+		{"MS_BIND", Const, 0},
+		{"MS_DEACTIVATE", Const, 0},
+		{"MS_DIRSYNC", Const, 0},
+		{"MS_INVALIDATE", Const, 0},
+		{"MS_I_VERSION", Const, 0},
+		{"MS_KERNMOUNT", Const, 0},
+		{"MS_KILLPAGES", Const, 0},
+		{"MS_MANDLOCK", Const, 0},
+		{"MS_MGC_MSK", Const, 0},
+		{"MS_MGC_VAL", Const, 0},
+		{"MS_MOVE", Const, 0},
+		{"MS_NOATIME", Const, 0},
+		{"MS_NODEV", Const, 0},
+		{"MS_NODIRATIME", Const, 0},
+		{"MS_NOEXEC", Const, 0},
+		{"MS_NOSUID", Const, 0},
+		{"MS_NOUSER", Const, 0},
+		{"MS_POSIXACL", Const, 0},
+		{"MS_PRIVATE", Const, 0},
+		{"MS_RDONLY", Const, 0},
+		{"MS_REC", Const, 0},
+		{"MS_RELATIME", Const, 0},
+		{"MS_REMOUNT", Const, 0},
+		{"MS_RMT_MASK", Const, 0},
+		{"MS_SHARED", Const, 0},
+		{"MS_SILENT", Const, 0},
+		{"MS_SLAVE", Const, 0},
+		{"MS_STRICTATIME", Const, 0},
+		{"MS_SYNC", Const, 0},
+		{"MS_SYNCHRONOUS", Const, 0},
+		{"MS_UNBINDABLE", Const, 0},
+		{"Madvise", Func, 0},
+		{"MapViewOfFile", Func, 0},
+		{"MaxTokenInfoClass", Const, 0},
+		{"Mclpool", Type, 2},
+		{"Mclpool.Alive", Field, 2},
+		{"Mclpool.Cwm", Field, 2},
+		{"Mclpool.Grown", Field, 2},
+		{"Mclpool.Hwm", Field, 2},
+		{"Mclpool.Lwm", Field, 2},
+		{"MibIfRow", Type, 0},
+		{"MibIfRow.AdminStatus", Field, 0},
+		{"MibIfRow.Descr", Field, 0},
+		{"MibIfRow.DescrLen", Field, 0},
+		{"MibIfRow.InDiscards", Field, 0},
+		{"MibIfRow.InErrors", Field, 0},
+		{"MibIfRow.InNUcastPkts", Field, 0},
+		{"MibIfRow.InOctets", Field, 0},
+		{"MibIfRow.InUcastPkts", Field, 0},
+		{"MibIfRow.InUnknownProtos", Field, 0},
+		{"MibIfRow.Index", Field, 0},
+		{"MibIfRow.LastChange", Field, 0},
+		{"MibIfRow.Mtu", Field, 0},
+		{"MibIfRow.Name", Field, 0},
+		{"MibIfRow.OperStatus", Field, 0},
+		{"MibIfRow.OutDiscards", Field, 0},
+		{"MibIfRow.OutErrors", Field, 0},
+		{"MibIfRow.OutNUcastPkts", Field, 0},
+		{"MibIfRow.OutOctets", Field, 0},
+		{"MibIfRow.OutQLen", Field, 0},
+		{"MibIfRow.OutUcastPkts", Field, 0},
+		{"MibIfRow.PhysAddr", Field, 0},
+		{"MibIfRow.PhysAddrLen", Field, 0},
+		{"MibIfRow.Speed", Field, 0},
+		{"MibIfRow.Type", Field, 0},
+		{"Mkdir", Func, 0},
+		{"Mkdirat", Func, 0},
+		{"Mkfifo", Func, 0},
+		{"Mknod", Func, 0},
+		{"Mknodat", Func, 0},
+		{"Mlock", Func, 0},
+		{"Mlockall", Func, 0},
+		{"Mmap", Func, 0},
+		{"Mount", Func, 0},
+		{"MoveFile", Func, 0},
+		{"Mprotect", Func, 0},
+		{"Msghdr", Type, 0},
+		{"Msghdr.Control", Field, 0},
+		{"Msghdr.Controllen", Field, 0},
+		{"Msghdr.Flags", Field, 0},
+		{"Msghdr.Iov", Field, 0},
+		{"Msghdr.Iovlen", Field, 0},
+		{"Msghdr.Name", Field, 0},
+		{"Msghdr.Namelen", Field, 0},
+		{"Msghdr.Pad_cgo_0", Field, 0},
+		{"Msghdr.Pad_cgo_1", Field, 0},
+		{"Munlock", Func, 0},
+		{"Munlockall", Func, 0},
+		{"Munmap", Func, 0},
+		{"MustLoadDLL", Func, 0},
+		{"NAME_MAX", Const, 0},
+		{"NETLINK_ADD_MEMBERSHIP", Const, 0},
+		{"NETLINK_AUDIT", Const, 0},
+		{"NETLINK_BROADCAST_ERROR", Const, 0},
+		{"NETLINK_CONNECTOR", Const, 0},
+		{"NETLINK_DNRTMSG", Const, 0},
+		{"NETLINK_DROP_MEMBERSHIP", Const, 0},
+		{"NETLINK_ECRYPTFS", Const, 0},
+		{"NETLINK_FIB_LOOKUP", Const, 0},
+		{"NETLINK_FIREWALL", Const, 0},
+		{"NETLINK_GENERIC", Const, 0},
+		{"NETLINK_INET_DIAG", Const, 0},
+		{"NETLINK_IP6_FW", Const, 0},
+		{"NETLINK_ISCSI", Const, 0},
+		{"NETLINK_KOBJECT_UEVENT", Const, 0},
+		{"NETLINK_NETFILTER", Const, 0},
+		{"NETLINK_NFLOG", Const, 0},
+		{"NETLINK_NO_ENOBUFS", Const, 0},
+		{"NETLINK_PKTINFO", Const, 0},
+		{"NETLINK_RDMA", Const, 0},
+		{"NETLINK_ROUTE", Const, 0},
+		{"NETLINK_SCSITRANSPORT", Const, 0},
+		{"NETLINK_SELINUX", Const, 0},
+		{"NETLINK_UNUSED", Const, 0},
+		{"NETLINK_USERSOCK", Const, 0},
+		{"NETLINK_XFRM", Const, 0},
+		{"NET_RT_DUMP", Const, 0},
+		{"NET_RT_DUMP2", Const, 0},
+		{"NET_RT_FLAGS", Const, 0},
+		{"NET_RT_IFLIST", Const, 0},
+		{"NET_RT_IFLIST2", Const, 0},
+		{"NET_RT_IFLISTL", Const, 1},
+		{"NET_RT_IFMALIST", Const, 0},
+		{"NET_RT_MAXID", Const, 0},
+		{"NET_RT_OIFLIST", Const, 1},
+		{"NET_RT_OOIFLIST", Const, 1},
+		{"NET_RT_STAT", Const, 0},
+		{"NET_RT_STATS", Const, 1},
+		{"NET_RT_TABLE", Const, 1},
+		{"NET_RT_TRASH", Const, 0},
+		{"NLA_ALIGNTO", Const, 0},
+		{"NLA_F_NESTED", Const, 0},
+		{"NLA_F_NET_BYTEORDER", Const, 0},
+		{"NLA_HDRLEN", Const, 0},
+		{"NLMSG_ALIGNTO", Const, 0},
+		{"NLMSG_DONE", Const, 0},
+		{"NLMSG_ERROR", Const, 0},
+		{"NLMSG_HDRLEN", Const, 0},
+		{"NLMSG_MIN_TYPE", Const, 0},
+		{"NLMSG_NOOP", Const, 0},
+		{"NLMSG_OVERRUN", Const, 0},
+		{"NLM_F_ACK", Const, 0},
+		{"NLM_F_APPEND", Const, 0},
+		{"NLM_F_ATOMIC", Const, 0},
+		{"NLM_F_CREATE", Const, 0},
+		{"NLM_F_DUMP", Const, 0},
+		{"NLM_F_ECHO", Const, 0},
+		{"NLM_F_EXCL", Const, 0},
+		{"NLM_F_MATCH", Const, 0},
+		{"NLM_F_MULTI", Const, 0},
+		{"NLM_F_REPLACE", Const, 0},
+		{"NLM_F_REQUEST", Const, 0},
+		{"NLM_F_ROOT", Const, 0},
+		{"NOFLSH", Const, 0},
+		{"NOTE_ABSOLUTE", Const, 0},
+		{"NOTE_ATTRIB", Const, 0},
+		{"NOTE_BACKGROUND", Const, 16},
+		{"NOTE_CHILD", Const, 0},
+		{"NOTE_CRITICAL", Const, 16},
+		{"NOTE_DELETE", Const, 0},
+		{"NOTE_EOF", Const, 1},
+		{"NOTE_EXEC", Const, 0},
+		{"NOTE_EXIT", Const, 0},
+		{"NOTE_EXITSTATUS", Const, 0},
+		{"NOTE_EXIT_CSERROR", Const, 16},
+		{"NOTE_EXIT_DECRYPTFAIL", Const, 16},
+		{"NOTE_EXIT_DETAIL", Const, 16},
+		{"NOTE_EXIT_DETAIL_MASK", Const, 16},
+		{"NOTE_EXIT_MEMORY", Const, 16},
+		{"NOTE_EXIT_REPARENTED", Const, 16},
+		{"NOTE_EXTEND", Const, 0},
+		{"NOTE_FFAND", Const, 0},
+		{"NOTE_FFCOPY", Const, 0},
+		{"NOTE_FFCTRLMASK", Const, 0},
+		{"NOTE_FFLAGSMASK", Const, 0},
+		{"NOTE_FFNOP", Const, 0},
+		{"NOTE_FFOR", Const, 0},
+		{"NOTE_FORK", Const, 0},
+		{"NOTE_LEEWAY", Const, 16},
+		{"NOTE_LINK", Const, 0},
+		{"NOTE_LOWAT", Const, 0},
+		{"NOTE_NONE", Const, 0},
+		{"NOTE_NSECONDS", Const, 0},
+		{"NOTE_PCTRLMASK", Const, 0},
+		{"NOTE_PDATAMASK", Const, 0},
+		{"NOTE_REAP", Const, 0},
+		{"NOTE_RENAME", Const, 0},
+		{"NOTE_RESOURCEEND", Const, 0},
+		{"NOTE_REVOKE", Const, 0},
+		{"NOTE_SECONDS", Const, 0},
+		{"NOTE_SIGNAL", Const, 0},
+		{"NOTE_TRACK", Const, 0},
+		{"NOTE_TRACKERR", Const, 0},
+		{"NOTE_TRIGGER", Const, 0},
+		{"NOTE_TRUNCATE", Const, 1},
+		{"NOTE_USECONDS", Const, 0},
+		{"NOTE_VM_ERROR", Const, 0},
+		{"NOTE_VM_PRESSURE", Const, 0},
+		{"NOTE_VM_PRESSURE_SUDDEN_TERMINATE", Const, 0},
+		{"NOTE_VM_PRESSURE_TERMINATE", Const, 0},
+		{"NOTE_WRITE", Const, 0},
+		{"NameCanonical", Const, 0},
+		{"NameCanonicalEx", Const, 0},
+		{"NameDisplay", Const, 0},
+		{"NameDnsDomain", Const, 0},
+		{"NameFullyQualifiedDN", Const, 0},
+		{"NameSamCompatible", Const, 0},
+		{"NameServicePrincipal", Const, 0},
+		{"NameUniqueId", Const, 0},
+		{"NameUnknown", Const, 0},
+		{"NameUserPrincipal", Const, 0},
+		{"Nanosleep", Func, 0},
+		{"NetApiBufferFree", Func, 0},
+		{"NetGetJoinInformation", Func, 2},
+		{"NetSetupDomainName", Const, 2},
+		{"NetSetupUnjoined", Const, 2},
+		{"NetSetupUnknownStatus", Const, 2},
+		{"NetSetupWorkgroupName", Const, 2},
+		{"NetUserGetInfo", Func, 0},
+		{"NetlinkMessage", Type, 0},
+		{"NetlinkMessage.Data", Field, 0},
+		{"NetlinkMessage.Header", Field, 0},
+		{"NetlinkRIB", Func, 0},
+		{"NetlinkRouteAttr", Type, 0},
+		{"NetlinkRouteAttr.Attr", Field, 0},
+		{"NetlinkRouteAttr.Value", Field, 0},
+		{"NetlinkRouteRequest", Type, 0},
+		{"NetlinkRouteRequest.Data", Field, 0},
+		{"NetlinkRouteRequest.Header", Field, 0},
+		{"NewCallback", Func, 0},
+		{"NewCallbackCDecl", Func, 3},
+		{"NewLazyDLL", Func, 0},
+		{"NlAttr", Type, 0},
+		{"NlAttr.Len", Field, 0},
+		{"NlAttr.Type", Field, 0},
+		{"NlMsgerr", Type, 0},
+		{"NlMsgerr.Error", Field, 0},
+		{"NlMsgerr.Msg", Field, 0},
+		{"NlMsghdr", Type, 0},
+		{"NlMsghdr.Flags", Field, 0},
+		{"NlMsghdr.Len", Field, 0},
+		{"NlMsghdr.Pid", Field, 0},
+		{"NlMsghdr.Seq", Field, 0},
+		{"NlMsghdr.Type", Field, 0},
+		{"NsecToFiletime", Func, 0},
+		{"NsecToTimespec", Func, 0},
+		{"NsecToTimeval", Func, 0},
+		{"Ntohs", Func, 0},
+		{"OCRNL", Const, 0},
+		{"OFDEL", Const, 0},
+		{"OFILL", Const, 0},
+		{"OFIOGETBMAP", Const, 1},
+		{"OID_PKIX_KP_SERVER_AUTH", Var, 0},
+		{"OID_SERVER_GATED_CRYPTO", Var, 0},
+		{"OID_SGC_NETSCAPE", Var, 0},
+		{"OLCUC", Const, 0},
+		{"ONLCR", Const, 0},
+		{"ONLRET", Const, 0},
+		{"ONOCR", Const, 0},
+		{"ONOEOT", Const, 1},
+		{"OPEN_ALWAYS", Const, 0},
+		{"OPEN_EXISTING", Const, 0},
+		{"OPOST", Const, 0},
+		{"O_ACCMODE", Const, 0},
+		{"O_ALERT", Const, 0},
+		{"O_ALT_IO", Const, 1},
+		{"O_APPEND", Const, 0},
+		{"O_ASYNC", Const, 0},
+		{"O_CLOEXEC", Const, 0},
+		{"O_CREAT", Const, 0},
+		{"O_DIRECT", Const, 0},
+		{"O_DIRECTORY", Const, 0},
+		{"O_DP_GETRAWENCRYPTED", Const, 16},
+		{"O_DSYNC", Const, 0},
+		{"O_EVTONLY", Const, 0},
+		{"O_EXCL", Const, 0},
+		{"O_EXEC", Const, 0},
+		{"O_EXLOCK", Const, 0},
+		{"O_FSYNC", Const, 0},
+		{"O_LARGEFILE", Const, 0},
+		{"O_NDELAY", Const, 0},
+		{"O_NOATIME", Const, 0},
+		{"O_NOCTTY", Const, 0},
+		{"O_NOFOLLOW", Const, 0},
+		{"O_NONBLOCK", Const, 0},
+		{"O_NOSIGPIPE", Const, 1},
+		{"O_POPUP", Const, 0},
+		{"O_RDONLY", Const, 0},
+		{"O_RDWR", Const, 0},
+		{"O_RSYNC", Const, 0},
+		{"O_SHLOCK", Const, 0},
+		{"O_SYMLINK", Const, 0},
+		{"O_SYNC", Const, 0},
+		{"O_TRUNC", Const, 0},
+		{"O_TTY_INIT", Const, 0},
+		{"O_WRONLY", Const, 0},
+		{"Open", Func, 0},
+		{"OpenCurrentProcessToken", Func, 0},
+		{"OpenProcess", Func, 0},
+		{"OpenProcessToken", Func, 0},
+		{"Openat", Func, 0},
+		{"Overlapped", Type, 0},
+		{"Overlapped.HEvent", Field, 0},
+		{"Overlapped.Internal", Field, 0},
+		{"Overlapped.InternalHigh", Field, 0},
+		{"Overlapped.Offset", Field, 0},
+		{"Overlapped.OffsetHigh", Field, 0},
+		{"PACKET_ADD_MEMBERSHIP", Const, 0},
+		{"PACKET_BROADCAST", Const, 0},
+		{"PACKET_DROP_MEMBERSHIP", Const, 0},
+		{"PACKET_FASTROUTE", Const, 0},
+		{"PACKET_HOST", Const, 0},
+		{"PACKET_LOOPBACK", Const, 0},
+		{"PACKET_MR_ALLMULTI", Const, 0},
+		{"PACKET_MR_MULTICAST", Const, 0},
+		{"PACKET_MR_PROMISC", Const, 0},
+		{"PACKET_MULTICAST", Const, 0},
+		{"PACKET_OTHERHOST", Const, 0},
+		{"PACKET_OUTGOING", Const, 0},
+		{"PACKET_RECV_OUTPUT", Const, 0},
+		{"PACKET_RX_RING", Const, 0},
+		{"PACKET_STATISTICS", Const, 0},
+		{"PAGE_EXECUTE_READ", Const, 0},
+		{"PAGE_EXECUTE_READWRITE", Const, 0},
+		{"PAGE_EXECUTE_WRITECOPY", Const, 0},
+		{"PAGE_READONLY", Const, 0},
+		{"PAGE_READWRITE", Const, 0},
+		{"PAGE_WRITECOPY", Const, 0},
+		{"PARENB", Const, 0},
+		{"PARMRK", Const, 0},
+		{"PARODD", Const, 0},
+		{"PENDIN", Const, 0},
+		{"PFL_HIDDEN", Const, 2},
+		{"PFL_MATCHES_PROTOCOL_ZERO", Const, 2},
+		{"PFL_MULTIPLE_PROTO_ENTRIES", Const, 2},
+		{"PFL_NETWORKDIRECT_PROVIDER", Const, 2},
+		{"PFL_RECOMMENDED_PROTO_ENTRY", Const, 2},
+		{"PF_FLUSH", Const, 1},
+		{"PKCS_7_ASN_ENCODING", Const, 0},
+		{"PMC5_PIPELINE_FLUSH", Const, 1},
+		{"PRIO_PGRP", Const, 2},
+		{"PRIO_PROCESS", Const, 2},
+		{"PRIO_USER", Const, 2},
+		{"PRI_IOFLUSH", Const, 1},
+		{"PROCESS_QUERY_INFORMATION", Const, 0},
+		{"PROCESS_TERMINATE", Const, 2},
+		{"PROT_EXEC", Const, 0},
+		{"PROT_GROWSDOWN", Const, 0},
+		{"PROT_GROWSUP", Const, 0},
+		{"PROT_NONE", Const, 0},
+		{"PROT_READ", Const, 0},
+		{"PROT_WRITE", Const, 0},
+		{"PROV_DH_SCHANNEL", Const, 0},
+		{"PROV_DSS", Const, 0},
+		{"PROV_DSS_DH", Const, 0},
+		{"PROV_EC_ECDSA_FULL", Const, 0},
+		{"PROV_EC_ECDSA_SIG", Const, 0},
+		{"PROV_EC_ECNRA_FULL", Const, 0},
+		{"PROV_EC_ECNRA_SIG", Const, 0},
+		{"PROV_FORTEZZA", Const, 0},
+		{"PROV_INTEL_SEC", Const, 0},
+		{"PROV_MS_EXCHANGE", Const, 0},
+		{"PROV_REPLACE_OWF", Const, 0},
+		{"PROV_RNG", Const, 0},
+		{"PROV_RSA_AES", Const, 0},
+		{"PROV_RSA_FULL", Const, 0},
+		{"PROV_RSA_SCHANNEL", Const, 0},
+		{"PROV_RSA_SIG", Const, 0},
+		{"PROV_SPYRUS_LYNKS", Const, 0},
+		{"PROV_SSL", Const, 0},
+		{"PR_CAPBSET_DROP", Const, 0},
+		{"PR_CAPBSET_READ", Const, 0},
+		{"PR_CLEAR_SECCOMP_FILTER", Const, 0},
+		{"PR_ENDIAN_BIG", Const, 0},
+		{"PR_ENDIAN_LITTLE", Const, 0},
+		{"PR_ENDIAN_PPC_LITTLE", Const, 0},
+		{"PR_FPEMU_NOPRINT", Const, 0},
+		{"PR_FPEMU_SIGFPE", Const, 0},
+		{"PR_FP_EXC_ASYNC", Const, 0},
+		{"PR_FP_EXC_DISABLED", Const, 0},
+		{"PR_FP_EXC_DIV", Const, 0},
+		{"PR_FP_EXC_INV", Const, 0},
+		{"PR_FP_EXC_NONRECOV", Const, 0},
+		{"PR_FP_EXC_OVF", Const, 0},
+		{"PR_FP_EXC_PRECISE", Const, 0},
+		{"PR_FP_EXC_RES", Const, 0},
+		{"PR_FP_EXC_SW_ENABLE", Const, 0},
+		{"PR_FP_EXC_UND", Const, 0},
+		{"PR_GET_DUMPABLE", Const, 0},
+		{"PR_GET_ENDIAN", Const, 0},
+		{"PR_GET_FPEMU", Const, 0},
+		{"PR_GET_FPEXC", Const, 0},
+		{"PR_GET_KEEPCAPS", Const, 0},
+		{"PR_GET_NAME", Const, 0},
+		{"PR_GET_PDEATHSIG", Const, 0},
+		{"PR_GET_SECCOMP", Const, 0},
+		{"PR_GET_SECCOMP_FILTER", Const, 0},
+		{"PR_GET_SECUREBITS", Const, 0},
+		{"PR_GET_TIMERSLACK", Const, 0},
+		{"PR_GET_TIMING", Const, 0},
+		{"PR_GET_TSC", Const, 0},
+		{"PR_GET_UNALIGN", Const, 0},
+		{"PR_MCE_KILL", Const, 0},
+		{"PR_MCE_KILL_CLEAR", Const, 0},
+		{"PR_MCE_KILL_DEFAULT", Const, 0},
+		{"PR_MCE_KILL_EARLY", Const, 0},
+		{"PR_MCE_KILL_GET", Const, 0},
+		{"PR_MCE_KILL_LATE", Const, 0},
+		{"PR_MCE_KILL_SET", Const, 0},
+		{"PR_SECCOMP_FILTER_EVENT", Const, 0},
+		{"PR_SECCOMP_FILTER_SYSCALL", Const, 0},
+		{"PR_SET_DUMPABLE", Const, 0},
+		{"PR_SET_ENDIAN", Const, 0},
+		{"PR_SET_FPEMU", Const, 0},
+		{"PR_SET_FPEXC", Const, 0},
+		{"PR_SET_KEEPCAPS", Const, 0},
+		{"PR_SET_NAME", Const, 0},
+		{"PR_SET_PDEATHSIG", Const, 0},
+		{"PR_SET_PTRACER", Const, 0},
+		{"PR_SET_SECCOMP", Const, 0},
+		{"PR_SET_SECCOMP_FILTER", Const, 0},
+		{"PR_SET_SECUREBITS", Const, 0},
+		{"PR_SET_TIMERSLACK", Const, 0},
+		{"PR_SET_TIMING", Const, 0},
+		{"PR_SET_TSC", Const, 0},
+		{"PR_SET_UNALIGN", Const, 0},
+		{"PR_TASK_PERF_EVENTS_DISABLE", Const, 0},
+		{"PR_TASK_PERF_EVENTS_ENABLE", Const, 0},
+		{"PR_TIMING_STATISTICAL", Const, 0},
+		{"PR_TIMING_TIMESTAMP", Const, 0},
+		{"PR_TSC_ENABLE", Const, 0},
+		{"PR_TSC_SIGSEGV", Const, 0},
+		{"PR_UNALIGN_NOPRINT", Const, 0},
+		{"PR_UNALIGN_SIGBUS", Const, 0},
+		{"PTRACE_ARCH_PRCTL", Const, 0},
+		{"PTRACE_ATTACH", Const, 0},
+		{"PTRACE_CONT", Const, 0},
+		{"PTRACE_DETACH", Const, 0},
+		{"PTRACE_EVENT_CLONE", Const, 0},
+		{"PTRACE_EVENT_EXEC", Const, 0},
+		{"PTRACE_EVENT_EXIT", Const, 0},
+		{"PTRACE_EVENT_FORK", Const, 0},
+		{"PTRACE_EVENT_VFORK", Const, 0},
+		{"PTRACE_EVENT_VFORK_DONE", Const, 0},
+		{"PTRACE_GETCRUNCHREGS", Const, 0},
+		{"PTRACE_GETEVENTMSG", Const, 0},
+		{"PTRACE_GETFPREGS", Const, 0},
+		{"PTRACE_GETFPXREGS", Const, 0},
+		{"PTRACE_GETHBPREGS", Const, 0},
+		{"PTRACE_GETREGS", Const, 0},
+		{"PTRACE_GETREGSET", Const, 0},
+		{"PTRACE_GETSIGINFO", Const, 0},
+		{"PTRACE_GETVFPREGS", Const, 0},
+		{"PTRACE_GETWMMXREGS", Const, 0},
+		{"PTRACE_GET_THREAD_AREA", Const, 0},
+		{"PTRACE_KILL", Const, 0},
+		{"PTRACE_OLDSETOPTIONS", Const, 0},
+		{"PTRACE_O_MASK", Const, 0},
+		{"PTRACE_O_TRACECLONE", Const, 0},
+		{"PTRACE_O_TRACEEXEC", Const, 0},
+		{"PTRACE_O_TRACEEXIT", Const, 0},
+		{"PTRACE_O_TRACEFORK", Const, 0},
+		{"PTRACE_O_TRACESYSGOOD", Const, 0},
+		{"PTRACE_O_TRACEVFORK", Const, 0},
+		{"PTRACE_O_TRACEVFORKDONE", Const, 0},
+		{"PTRACE_PEEKDATA", Const, 0},
+		{"PTRACE_PEEKTEXT", Const, 0},
+		{"PTRACE_PEEKUSR", Const, 0},
+		{"PTRACE_POKEDATA", Const, 0},
+		{"PTRACE_POKETEXT", Const, 0},
+		{"PTRACE_POKEUSR", Const, 0},
+		{"PTRACE_SETCRUNCHREGS", Const, 0},
+		{"PTRACE_SETFPREGS", Const, 0},
+		{"PTRACE_SETFPXREGS", Const, 0},
+		{"PTRACE_SETHBPREGS", Const, 0},
+		{"PTRACE_SETOPTIONS", Const, 0},
+		{"PTRACE_SETREGS", Const, 0},
+		{"PTRACE_SETREGSET", Const, 0},
+		{"PTRACE_SETSIGINFO", Const, 0},
+		{"PTRACE_SETVFPREGS", Const, 0},
+		{"PTRACE_SETWMMXREGS", Const, 0},
+		{"PTRACE_SET_SYSCALL", Const, 0},
+		{"PTRACE_SET_THREAD_AREA", Const, 0},
+		{"PTRACE_SINGLEBLOCK", Const, 0},
+		{"PTRACE_SINGLESTEP", Const, 0},
+		{"PTRACE_SYSCALL", Const, 0},
+		{"PTRACE_SYSEMU", Const, 0},
+		{"PTRACE_SYSEMU_SINGLESTEP", Const, 0},
+		{"PTRACE_TRACEME", Const, 0},
+		{"PT_ATTACH", Const, 0},
+		{"PT_ATTACHEXC", Const, 0},
+		{"PT_CONTINUE", Const, 0},
+		{"PT_DATA_ADDR", Const, 0},
+		{"PT_DENY_ATTACH", Const, 0},
+		{"PT_DETACH", Const, 0},
+		{"PT_FIRSTMACH", Const, 0},
+		{"PT_FORCEQUOTA", Const, 0},
+		{"PT_KILL", Const, 0},
+		{"PT_MASK", Const, 1},
+		{"PT_READ_D", Const, 0},
+		{"PT_READ_I", Const, 0},
+		{"PT_READ_U", Const, 0},
+		{"PT_SIGEXC", Const, 0},
+		{"PT_STEP", Const, 0},
+		{"PT_TEXT_ADDR", Const, 0},
+		{"PT_TEXT_END_ADDR", Const, 0},
+		{"PT_THUPDATE", Const, 0},
+		{"PT_TRACE_ME", Const, 0},
+		{"PT_WRITE_D", Const, 0},
+		{"PT_WRITE_I", Const, 0},
+		{"PT_WRITE_U", Const, 0},
+		{"ParseDirent", Func, 0},
+		{"ParseNetlinkMessage", Func, 0},
+		{"ParseNetlinkRouteAttr", Func, 0},
+		{"ParseRoutingMessage", Func, 0},
+		{"ParseRoutingSockaddr", Func, 0},
+		{"ParseSocketControlMessage", Func, 0},
+		{"ParseUnixCredentials", Func, 0},
+		{"ParseUnixRights", Func, 0},
+		{"PathMax", Const, 0},
+		{"Pathconf", Func, 0},
+		{"Pause", Func, 0},
+		{"Pipe", Func, 0},
+		{"Pipe2", Func, 1},
+		{"PivotRoot", Func, 0},
+		{"Pointer", Type, 11},
+		{"PostQueuedCompletionStatus", Func, 0},
+		{"Pread", Func, 0},
+		{"Proc", Type, 0},
+		{"Proc.Dll", Field, 0},
+		{"Proc.Name", Field, 0},
+		{"ProcAttr", Type, 0},
+		{"ProcAttr.Dir", Field, 0},
+		{"ProcAttr.Env", Field, 0},
+		{"ProcAttr.Files", Field, 0},
+		{"ProcAttr.Sys", Field, 0},
+		{"Process32First", Func, 4},
+		{"Process32Next", Func, 4},
+		{"ProcessEntry32", Type, 4},
+		{"ProcessEntry32.DefaultHeapID", Field, 4},
+		{"ProcessEntry32.ExeFile", Field, 4},
+		{"ProcessEntry32.Flags", Field, 4},
+		{"ProcessEntry32.ModuleID", Field, 4},
+		{"ProcessEntry32.ParentProcessID", Field, 4},
+		{"ProcessEntry32.PriClassBase", Field, 4},
+		{"ProcessEntry32.ProcessID", Field, 4},
+		{"ProcessEntry32.Size", Field, 4},
+		{"ProcessEntry32.Threads", Field, 4},
+		{"ProcessEntry32.Usage", Field, 4},
+		{"ProcessInformation", Type, 0},
+		{"ProcessInformation.Process", Field, 0},
+		{"ProcessInformation.ProcessId", Field, 0},
+		{"ProcessInformation.Thread", Field, 0},
+		{"ProcessInformation.ThreadId", Field, 0},
+		{"Protoent", Type, 0},
+		{"Protoent.Aliases", Field, 0},
+		{"Protoent.Name", Field, 0},
+		{"Protoent.Proto", Field, 0},
+		{"PtraceAttach", Func, 0},
+		{"PtraceCont", Func, 0},
+		{"PtraceDetach", Func, 0},
+		{"PtraceGetEventMsg", Func, 0},
+		{"PtraceGetRegs", Func, 0},
+		{"PtracePeekData", Func, 0},
+		{"PtracePeekText", Func, 0},
+		{"PtracePokeData", Func, 0},
+		{"PtracePokeText", Func, 0},
+		{"PtraceRegs", Type, 0},
+		{"PtraceRegs.Cs", Field, 0},
+		{"PtraceRegs.Ds", Field, 0},
+		{"PtraceRegs.Eax", Field, 0},
+		{"PtraceRegs.Ebp", Field, 0},
+		{"PtraceRegs.Ebx", Field, 0},
+		{"PtraceRegs.Ecx", Field, 0},
+		{"PtraceRegs.Edi", Field, 0},
+		{"PtraceRegs.Edx", Field, 0},
+		{"PtraceRegs.Eflags", Field, 0},
+		{"PtraceRegs.Eip", Field, 0},
+		{"PtraceRegs.Es", Field, 0},
+		{"PtraceRegs.Esi", Field, 0},
+		{"PtraceRegs.Esp", Field, 0},
+		{"PtraceRegs.Fs", Field, 0},
+		{"PtraceRegs.Fs_base", Field, 0},
+		{"PtraceRegs.Gs", Field, 0},
+		{"PtraceRegs.Gs_base", Field, 0},
+		{"PtraceRegs.Orig_eax", Field, 0},
+		{"PtraceRegs.Orig_rax", Field, 0},
+		{"PtraceRegs.R10", Field, 0},
+		{"PtraceRegs.R11", Field, 0},
+		{"PtraceRegs.R12", Field, 0},
+		{"PtraceRegs.R13", Field, 0},
+		{"PtraceRegs.R14", Field, 0},
+		{"PtraceRegs.R15", Field, 0},
+		{"PtraceRegs.R8", Field, 0},
+		{"PtraceRegs.R9", Field, 0},
+		{"PtraceRegs.Rax", Field, 0},
+		{"PtraceRegs.Rbp", Field, 0},
+		{"PtraceRegs.Rbx", Field, 0},
+		{"PtraceRegs.Rcx", Field, 0},
+		{"PtraceRegs.Rdi", Field, 0},
+		{"PtraceRegs.Rdx", Field, 0},
+		{"PtraceRegs.Rip", Field, 0},
+		{"PtraceRegs.Rsi", Field, 0},
+		{"PtraceRegs.Rsp", Field, 0},
+		{"PtraceRegs.Ss", Field, 0},
+		{"PtraceRegs.Uregs", Field, 0},
+		{"PtraceRegs.Xcs", Field, 0},
+		{"PtraceRegs.Xds", Field, 0},
+		{"PtraceRegs.Xes", Field, 0},
+		{"PtraceRegs.Xfs", Field, 0},
+		{"PtraceRegs.Xgs", Field, 0},
+		{"PtraceRegs.Xss", Field, 0},
+		{"PtraceSetOptions", Func, 0},
+		{"PtraceSetRegs", Func, 0},
+		{"PtraceSingleStep", Func, 0},
+		{"PtraceSyscall", Func, 1},
+		{"Pwrite", Func, 0},
+		{"REG_BINARY", Const, 0},
+		{"REG_DWORD", Const, 0},
+		{"REG_DWORD_BIG_ENDIAN", Const, 0},
+		{"REG_DWORD_LITTLE_ENDIAN", Const, 0},
+		{"REG_EXPAND_SZ", Const, 0},
+		{"REG_FULL_RESOURCE_DESCRIPTOR", Const, 0},
+		{"REG_LINK", Const, 0},
+		{"REG_MULTI_SZ", Const, 0},
+		{"REG_NONE", Const, 0},
+		{"REG_QWORD", Const, 0},
+		{"REG_QWORD_LITTLE_ENDIAN", Const, 0},
+		{"REG_RESOURCE_LIST", Const, 0},
+		{"REG_RESOURCE_REQUIREMENTS_LIST", Const, 0},
+		{"REG_SZ", Const, 0},
+		{"RLIMIT_AS", Const, 0},
+		{"RLIMIT_CORE", Const, 0},
+		{"RLIMIT_CPU", Const, 0},
+		{"RLIMIT_CPU_USAGE_MONITOR", Const, 16},
+		{"RLIMIT_DATA", Const, 0},
+		{"RLIMIT_FSIZE", Const, 0},
+		{"RLIMIT_NOFILE", Const, 0},
+		{"RLIMIT_STACK", Const, 0},
+		{"RLIM_INFINITY", Const, 0},
+		{"RTAX_ADVMSS", Const, 0},
+		{"RTAX_AUTHOR", Const, 0},
+		{"RTAX_BRD", Const, 0},
+		{"RTAX_CWND", Const, 0},
+		{"RTAX_DST", Const, 0},
+		{"RTAX_FEATURES", Const, 0},
+		{"RTAX_FEATURE_ALLFRAG", Const, 0},
+		{"RTAX_FEATURE_ECN", Const, 0},
+		{"RTAX_FEATURE_SACK", Const, 0},
+		{"RTAX_FEATURE_TIMESTAMP", Const, 0},
+		{"RTAX_GATEWAY", Const, 0},
+		{"RTAX_GENMASK", Const, 0},
+		{"RTAX_HOPLIMIT", Const, 0},
+		{"RTAX_IFA", Const, 0},
+		{"RTAX_IFP", Const, 0},
+		{"RTAX_INITCWND", Const, 0},
+		{"RTAX_INITRWND", Const, 0},
+		{"RTAX_LABEL", Const, 1},
+		{"RTAX_LOCK", Const, 0},
+		{"RTAX_MAX", Const, 0},
+		{"RTAX_MTU", Const, 0},
+		{"RTAX_NETMASK", Const, 0},
+		{"RTAX_REORDERING", Const, 0},
+		{"RTAX_RTO_MIN", Const, 0},
+		{"RTAX_RTT", Const, 0},
+		{"RTAX_RTTVAR", Const, 0},
+		{"RTAX_SRC", Const, 1},
+		{"RTAX_SRCMASK", Const, 1},
+		{"RTAX_SSTHRESH", Const, 0},
+		{"RTAX_TAG", Const, 1},
+		{"RTAX_UNSPEC", Const, 0},
+		{"RTAX_WINDOW", Const, 0},
+		{"RTA_ALIGNTO", Const, 0},
+		{"RTA_AUTHOR", Const, 0},
+		{"RTA_BRD", Const, 0},
+		{"RTA_CACHEINFO", Const, 0},
+		{"RTA_DST", Const, 0},
+		{"RTA_FLOW", Const, 0},
+		{"RTA_GATEWAY", Const, 0},
+		{"RTA_GENMASK", Const, 0},
+		{"RTA_IFA", Const, 0},
+		{"RTA_IFP", Const, 0},
+		{"RTA_IIF", Const, 0},
+		{"RTA_LABEL", Const, 1},
+		{"RTA_MAX", Const, 0},
+		{"RTA_METRICS", Const, 0},
+		{"RTA_MULTIPATH", Const, 0},
+		{"RTA_NETMASK", Const, 0},
+		{"RTA_OIF", Const, 0},
+		{"RTA_PREFSRC", Const, 0},
+		{"RTA_PRIORITY", Const, 0},
+		{"RTA_SRC", Const, 0},
+		{"RTA_SRCMASK", Const, 1},
+		{"RTA_TABLE", Const, 0},
+		{"RTA_TAG", Const, 1},
+		{"RTA_UNSPEC", Const, 0},
+		{"RTCF_DIRECTSRC", Const, 0},
+		{"RTCF_DOREDIRECT", Const, 0},
+		{"RTCF_LOG", Const, 0},
+		{"RTCF_MASQ", Const, 0},
+		{"RTCF_NAT", Const, 0},
+		{"RTCF_VALVE", Const, 0},
+		{"RTF_ADDRCLASSMASK", Const, 0},
+		{"RTF_ADDRCONF", Const, 0},
+		{"RTF_ALLONLINK", Const, 0},
+		{"RTF_ANNOUNCE", Const, 1},
+		{"RTF_BLACKHOLE", Const, 0},
+		{"RTF_BROADCAST", Const, 0},
+		{"RTF_CACHE", Const, 0},
+		{"RTF_CLONED", Const, 1},
+		{"RTF_CLONING", Const, 0},
+		{"RTF_CONDEMNED", Const, 0},
+		{"RTF_DEFAULT", Const, 0},
+		{"RTF_DELCLONE", Const, 0},
+		{"RTF_DONE", Const, 0},
+		{"RTF_DYNAMIC", Const, 0},
+		{"RTF_FLOW", Const, 0},
+		{"RTF_FMASK", Const, 0},
+		{"RTF_GATEWAY", Const, 0},
+		{"RTF_GWFLAG_COMPAT", Const, 3},
+		{"RTF_HOST", Const, 0},
+		{"RTF_IFREF", Const, 0},
+		{"RTF_IFSCOPE", Const, 0},
+		{"RTF_INTERFACE", Const, 0},
+		{"RTF_IRTT", Const, 0},
+		{"RTF_LINKRT", Const, 0},
+		{"RTF_LLDATA", Const, 0},
+		{"RTF_LLINFO", Const, 0},
+		{"RTF_LOCAL", Const, 0},
+		{"RTF_MASK", Const, 1},
+		{"RTF_MODIFIED", Const, 0},
+		{"RTF_MPATH", Const, 1},
+		{"RTF_MPLS", Const, 1},
+		{"RTF_MSS", Const, 0},
+		{"RTF_MTU", Const, 0},
+		{"RTF_MULTICAST", Const, 0},
+		{"RTF_NAT", Const, 0},
+		{"RTF_NOFORWARD", Const, 0},
+		{"RTF_NONEXTHOP", Const, 0},
+		{"RTF_NOPMTUDISC", Const, 0},
+		{"RTF_PERMANENT_ARP", Const, 1},
+		{"RTF_PINNED", Const, 0},
+		{"RTF_POLICY", Const, 0},
+		{"RTF_PRCLONING", Const, 0},
+		{"RTF_PROTO1", Const, 0},
+		{"RTF_PROTO2", Const, 0},
+		{"RTF_PROTO3", Const, 0},
+		{"RTF_PROXY", Const, 16},
+		{"RTF_REINSTATE", Const, 0},
+		{"RTF_REJECT", Const, 0},
+		{"RTF_RNH_LOCKED", Const, 0},
+		{"RTF_ROUTER", Const, 16},
+		{"RTF_SOURCE", Const, 1},
+		{"RTF_SRC", Const, 1},
+		{"RTF_STATIC", Const, 0},
+		{"RTF_STICKY", Const, 0},
+		{"RTF_THROW", Const, 0},
+		{"RTF_TUNNEL", Const, 1},
+		{"RTF_UP", Const, 0},
+		{"RTF_USETRAILERS", Const, 1},
+		{"RTF_WASCLONED", Const, 0},
+		{"RTF_WINDOW", Const, 0},
+		{"RTF_XRESOLVE", Const, 0},
+		{"RTM_ADD", Const, 0},
+		{"RTM_BASE", Const, 0},
+		{"RTM_CHANGE", Const, 0},
+		{"RTM_CHGADDR", Const, 1},
+		{"RTM_DELACTION", Const, 0},
+		{"RTM_DELADDR", Const, 0},
+		{"RTM_DELADDRLABEL", Const, 0},
+		{"RTM_DELETE", Const, 0},
+		{"RTM_DELLINK", Const, 0},
+		{"RTM_DELMADDR", Const, 0},
+		{"RTM_DELNEIGH", Const, 0},
+		{"RTM_DELQDISC", Const, 0},
+		{"RTM_DELROUTE", Const, 0},
+		{"RTM_DELRULE", Const, 0},
+		{"RTM_DELTCLASS", Const, 0},
+		{"RTM_DELTFILTER", Const, 0},
+		{"RTM_DESYNC", Const, 1},
+		{"RTM_F_CLONED", Const, 0},
+		{"RTM_F_EQUALIZE", Const, 0},
+		{"RTM_F_NOTIFY", Const, 0},
+		{"RTM_F_PREFIX", Const, 0},
+		{"RTM_GET", Const, 0},
+		{"RTM_GET2", Const, 0},
+		{"RTM_GETACTION", Const, 0},
+		{"RTM_GETADDR", Const, 0},
+		{"RTM_GETADDRLABEL", Const, 0},
+		{"RTM_GETANYCAST", Const, 0},
+		{"RTM_GETDCB", Const, 0},
+		{"RTM_GETLINK", Const, 0},
+		{"RTM_GETMULTICAST", Const, 0},
+		{"RTM_GETNEIGH", Const, 0},
+		{"RTM_GETNEIGHTBL", Const, 0},
+		{"RTM_GETQDISC", Const, 0},
+		{"RTM_GETROUTE", Const, 0},
+		{"RTM_GETRULE", Const, 0},
+		{"RTM_GETTCLASS", Const, 0},
+		{"RTM_GETTFILTER", Const, 0},
+		{"RTM_IEEE80211", Const, 0},
+		{"RTM_IFANNOUNCE", Const, 0},
+		{"RTM_IFINFO", Const, 0},
+		{"RTM_IFINFO2", Const, 0},
+		{"RTM_LLINFO_UPD", Const, 1},
+		{"RTM_LOCK", Const, 0},
+		{"RTM_LOSING", Const, 0},
+		{"RTM_MAX", Const, 0},
+		{"RTM_MAXSIZE", Const, 1},
+		{"RTM_MISS", Const, 0},
+		{"RTM_NEWACTION", Const, 0},
+		{"RTM_NEWADDR", Const, 0},
+		{"RTM_NEWADDRLABEL", Const, 0},
+		{"RTM_NEWLINK", Const, 0},
+		{"RTM_NEWMADDR", Const, 0},
+		{"RTM_NEWMADDR2", Const, 0},
+		{"RTM_NEWNDUSEROPT", Const, 0},
+		{"RTM_NEWNEIGH", Const, 0},
+		{"RTM_NEWNEIGHTBL", Const, 0},
+		{"RTM_NEWPREFIX", Const, 0},
+		{"RTM_NEWQDISC", Const, 0},
+		{"RTM_NEWROUTE", Const, 0},
+		{"RTM_NEWRULE", Const, 0},
+		{"RTM_NEWTCLASS", Const, 0},
+		{"RTM_NEWTFILTER", Const, 0},
+		{"RTM_NR_FAMILIES", Const, 0},
+		{"RTM_NR_MSGTYPES", Const, 0},
+		{"RTM_OIFINFO", Const, 1},
+		{"RTM_OLDADD", Const, 0},
+		{"RTM_OLDDEL", Const, 0},
+		{"RTM_OOIFINFO", Const, 1},
+		{"RTM_REDIRECT", Const, 0},
+		{"RTM_RESOLVE", Const, 0},
+		{"RTM_RTTUNIT", Const, 0},
+		{"RTM_SETDCB", Const, 0},
+		{"RTM_SETGATE", Const, 1},
+		{"RTM_SETLINK", Const, 0},
+		{"RTM_SETNEIGHTBL", Const, 0},
+		{"RTM_VERSION", Const, 0},
+		{"RTNH_ALIGNTO", Const, 0},
+		{"RTNH_F_DEAD", Const, 0},
+		{"RTNH_F_ONLINK", Const, 0},
+		{"RTNH_F_PERVASIVE", Const, 0},
+		{"RTNLGRP_IPV4_IFADDR", Const, 1},
+		{"RTNLGRP_IPV4_MROUTE", Const, 1},
+		{"RTNLGRP_IPV4_ROUTE", Const, 1},
+		{"RTNLGRP_IPV4_RULE", Const, 1},
+		{"RTNLGRP_IPV6_IFADDR", Const, 1},
+		{"RTNLGRP_IPV6_IFINFO", Const, 1},
+		{"RTNLGRP_IPV6_MROUTE", Const, 1},
+		{"RTNLGRP_IPV6_PREFIX", Const, 1},
+		{"RTNLGRP_IPV6_ROUTE", Const, 1},
+		{"RTNLGRP_IPV6_RULE", Const, 1},
+		{"RTNLGRP_LINK", Const, 1},
+		{"RTNLGRP_ND_USEROPT", Const, 1},
+		{"RTNLGRP_NEIGH", Const, 1},
+		{"RTNLGRP_NONE", Const, 1},
+		{"RTNLGRP_NOTIFY", Const, 1},
+		{"RTNLGRP_TC", Const, 1},
+		{"RTN_ANYCAST", Const, 0},
+		{"RTN_BLACKHOLE", Const, 0},
+		{"RTN_BROADCAST", Const, 0},
+		{"RTN_LOCAL", Const, 0},
+		{"RTN_MAX", Const, 0},
+		{"RTN_MULTICAST", Const, 0},
+		{"RTN_NAT", Const, 0},
+		{"RTN_PROHIBIT", Const, 0},
+		{"RTN_THROW", Const, 0},
+		{"RTN_UNICAST", Const, 0},
+		{"RTN_UNREACHABLE", Const, 0},
+		{"RTN_UNSPEC", Const, 0},
+		{"RTN_XRESOLVE", Const, 0},
+		{"RTPROT_BIRD", Const, 0},
+		{"RTPROT_BOOT", Const, 0},
+		{"RTPROT_DHCP", Const, 0},
+		{"RTPROT_DNROUTED", Const, 0},
+		{"RTPROT_GATED", Const, 0},
+		{"RTPROT_KERNEL", Const, 0},
+		{"RTPROT_MRT", Const, 0},
+		{"RTPROT_NTK", Const, 0},
+		{"RTPROT_RA", Const, 0},
+		{"RTPROT_REDIRECT", Const, 0},
+		{"RTPROT_STATIC", Const, 0},
+		{"RTPROT_UNSPEC", Const, 0},
+		{"RTPROT_XORP", Const, 0},
+		{"RTPROT_ZEBRA", Const, 0},
+		{"RTV_EXPIRE", Const, 0},
+		{"RTV_HOPCOUNT", Const, 0},
+		{"RTV_MTU", Const, 0},
+		{"RTV_RPIPE", Const, 0},
+		{"RTV_RTT", Const, 0},
+		{"RTV_RTTVAR", Const, 0},
+		{"RTV_SPIPE", Const, 0},
+		{"RTV_SSTHRESH", Const, 0},
+		{"RTV_WEIGHT", Const, 0},
+		{"RT_CACHING_CONTEXT", Const, 1},
+		{"RT_CLASS_DEFAULT", Const, 0},
+		{"RT_CLASS_LOCAL", Const, 0},
+		{"RT_CLASS_MAIN", Const, 0},
+		{"RT_CLASS_MAX", Const, 0},
+		{"RT_CLASS_UNSPEC", Const, 0},
+		{"RT_DEFAULT_FIB", Const, 1},
+		{"RT_NORTREF", Const, 1},
+		{"RT_SCOPE_HOST", Const, 0},
+		{"RT_SCOPE_LINK", Const, 0},
+		{"RT_SCOPE_NOWHERE", Const, 0},
+		{"RT_SCOPE_SITE", Const, 0},
+		{"RT_SCOPE_UNIVERSE", Const, 0},
+		{"RT_TABLEID_MAX", Const, 1},
+		{"RT_TABLE_COMPAT", Const, 0},
+		{"RT_TABLE_DEFAULT", Const, 0},
+		{"RT_TABLE_LOCAL", Const, 0},
+		{"RT_TABLE_MAIN", Const, 0},
+		{"RT_TABLE_MAX", Const, 0},
+		{"RT_TABLE_UNSPEC", Const, 0},
+		{"RUSAGE_CHILDREN", Const, 0},
+		{"RUSAGE_SELF", Const, 0},
+		{"RUSAGE_THREAD", Const, 0},
+		{"Radvisory_t", Type, 0},
+		{"Radvisory_t.Count", Field, 0},
+		{"Radvisory_t.Offset", Field, 0},
+		{"Radvisory_t.Pad_cgo_0", Field, 0},
+		{"RawConn", Type, 9},
+		{"RawSockaddr", Type, 0},
+		{"RawSockaddr.Data", Field, 0},
+		{"RawSockaddr.Family", Field, 0},
+		{"RawSockaddr.Len", Field, 0},
+		{"RawSockaddrAny", Type, 0},
+		{"RawSockaddrAny.Addr", Field, 0},
+		{"RawSockaddrAny.Pad", Field, 0},
+		{"RawSockaddrDatalink", Type, 0},
+		{"RawSockaddrDatalink.Alen", Field, 0},
+		{"RawSockaddrDatalink.Data", Field, 0},
+		{"RawSockaddrDatalink.Family", Field, 0},
+		{"RawSockaddrDatalink.Index", Field, 0},
+		{"RawSockaddrDatalink.Len", Field, 0},
+		{"RawSockaddrDatalink.Nlen", Field, 0},
+		{"RawSockaddrDatalink.Pad_cgo_0", Field, 2},
+		{"RawSockaddrDatalink.Slen", Field, 0},
+		{"RawSockaddrDatalink.Type", Field, 0},
+		{"RawSockaddrInet4", Type, 0},
+		{"RawSockaddrInet4.Addr", Field, 0},
+		{"RawSockaddrInet4.Family", Field, 0},
+		{"RawSockaddrInet4.Len", Field, 0},
+		{"RawSockaddrInet4.Port", Field, 0},
+		{"RawSockaddrInet4.Zero", Field, 0},
+		{"RawSockaddrInet6", Type, 0},
+		{"RawSockaddrInet6.Addr", Field, 0},
+		{"RawSockaddrInet6.Family", Field, 0},
+		{"RawSockaddrInet6.Flowinfo", Field, 0},
+		{"RawSockaddrInet6.Len", Field, 0},
+		{"RawSockaddrInet6.Port", Field, 0},
+		{"RawSockaddrInet6.Scope_id", Field, 0},
+		{"RawSockaddrLinklayer", Type, 0},
+		{"RawSockaddrLinklayer.Addr", Field, 0},
+		{"RawSockaddrLinklayer.Family", Field, 0},
+		{"RawSockaddrLinklayer.Halen", Field, 0},
+		{"RawSockaddrLinklayer.Hatype", Field, 0},
+		{"RawSockaddrLinklayer.Ifindex", Field, 0},
+		{"RawSockaddrLinklayer.Pkttype", Field, 0},
+		{"RawSockaddrLinklayer.Protocol", Field, 0},
+		{"RawSockaddrNetlink", Type, 0},
+		{"RawSockaddrNetlink.Family", Field, 0},
+		{"RawSockaddrNetlink.Groups", Field, 0},
+		{"RawSockaddrNetlink.Pad", Field, 0},
+		{"RawSockaddrNetlink.Pid", Field, 0},
+		{"RawSockaddrUnix", Type, 0},
+		{"RawSockaddrUnix.Family", Field, 0},
+		{"RawSockaddrUnix.Len", Field, 0},
+		{"RawSockaddrUnix.Pad_cgo_0", Field, 2},
+		{"RawSockaddrUnix.Path", Field, 0},
+		{"RawSyscall", Func, 0},
+		{"RawSyscall6", Func, 0},
+		{"Read", Func, 0},
+		{"ReadConsole", Func, 1},
+		{"ReadDirectoryChanges", Func, 0},
+		{"ReadDirent", Func, 0},
+		{"ReadFile", Func, 0},
+		{"Readlink", Func, 0},
+		{"Reboot", Func, 0},
+		{"Recvfrom", Func, 0},
+		{"Recvmsg", Func, 0},
+		{"RegCloseKey", Func, 0},
+		{"RegEnumKeyEx", Func, 0},
+		{"RegOpenKeyEx", Func, 0},
+		{"RegQueryInfoKey", Func, 0},
+		{"RegQueryValueEx", Func, 0},
+		{"RemoveDirectory", Func, 0},
+		{"Removexattr", Func, 1},
+		{"Rename", Func, 0},
+		{"Renameat", Func, 0},
+		{"Revoke", Func, 0},
+		{"Rlimit", Type, 0},
+		{"Rlimit.Cur", Field, 0},
+		{"Rlimit.Max", Field, 0},
+		{"Rmdir", Func, 0},
+		{"RouteMessage", Type, 0},
+		{"RouteMessage.Data", Field, 0},
+		{"RouteMessage.Header", Field, 0},
+		{"RouteRIB", Func, 0},
+		{"RoutingMessage", Type, 0},
+		{"RtAttr", Type, 0},
+		{"RtAttr.Len", Field, 0},
+		{"RtAttr.Type", Field, 0},
+		{"RtGenmsg", Type, 0},
+		{"RtGenmsg.Family", Field, 0},
+		{"RtMetrics", Type, 0},
+		{"RtMetrics.Expire", Field, 0},
+		{"RtMetrics.Filler", Field, 0},
+		{"RtMetrics.Hopcount", Field, 0},
+		{"RtMetrics.Locks", Field, 0},
+		{"RtMetrics.Mtu", Field, 0},
+		{"RtMetrics.Pad", Field, 3},
+		{"RtMetrics.Pksent", Field, 0},
+		{"RtMetrics.Recvpipe", Field, 0},
+		{"RtMetrics.Refcnt", Field, 2},
+		{"RtMetrics.Rtt", Field, 0},
+		{"RtMetrics.Rttvar", Field, 0},
+		{"RtMetrics.Sendpipe", Field, 0},
+		{"RtMetrics.Ssthresh", Field, 0},
+		{"RtMetrics.Weight", Field, 0},
+		{"RtMsg", Type, 0},
+		{"RtMsg.Dst_len", Field, 0},
+		{"RtMsg.Family", Field, 0},
+		{"RtMsg.Flags", Field, 0},
+		{"RtMsg.Protocol", Field, 0},
+		{"RtMsg.Scope", Field, 0},
+		{"RtMsg.Src_len", Field, 0},
+		{"RtMsg.Table", Field, 0},
+		{"RtMsg.Tos", Field, 0},
+		{"RtMsg.Type", Field, 0},
+		{"RtMsghdr", Type, 0},
+		{"RtMsghdr.Addrs", Field, 0},
+		{"RtMsghdr.Errno", Field, 0},
+		{"RtMsghdr.Flags", Field, 0},
+		{"RtMsghdr.Fmask", Field, 0},
+		{"RtMsghdr.Hdrlen", Field, 2},
+		{"RtMsghdr.Index", Field, 0},
+		{"RtMsghdr.Inits", Field, 0},
+		{"RtMsghdr.Mpls", Field, 2},
+		{"RtMsghdr.Msglen", Field, 0},
+		{"RtMsghdr.Pad_cgo_0", Field, 0},
+		{"RtMsghdr.Pad_cgo_1", Field, 2},
+		{"RtMsghdr.Pid", Field, 0},
+		{"RtMsghdr.Priority", Field, 2},
+		{"RtMsghdr.Rmx", Field, 0},
+		{"RtMsghdr.Seq", Field, 0},
+		{"RtMsghdr.Tableid", Field, 2},
+		{"RtMsghdr.Type", Field, 0},
+		{"RtMsghdr.Use", Field, 0},
+		{"RtMsghdr.Version", Field, 0},
+		{"RtNexthop", Type, 0},
+		{"RtNexthop.Flags", Field, 0},
+		{"RtNexthop.Hops", Field, 0},
+		{"RtNexthop.Ifindex", Field, 0},
+		{"RtNexthop.Len", Field, 0},
+		{"Rusage", Type, 0},
+		{"Rusage.CreationTime", Field, 0},
+		{"Rusage.ExitTime", Field, 0},
+		{"Rusage.Idrss", Field, 0},
+		{"Rusage.Inblock", Field, 0},
+		{"Rusage.Isrss", Field, 0},
+		{"Rusage.Ixrss", Field, 0},
+		{"Rusage.KernelTime", Field, 0},
+		{"Rusage.Majflt", Field, 0},
+		{"Rusage.Maxrss", Field, 0},
+		{"Rusage.Minflt", Field, 0},
+		{"Rusage.Msgrcv", Field, 0},
+		{"Rusage.Msgsnd", Field, 0},
+		{"Rusage.Nivcsw", Field, 0},
+		{"Rusage.Nsignals", Field, 0},
+		{"Rusage.Nswap", Field, 0},
+		{"Rusage.Nvcsw", Field, 0},
+		{"Rusage.Oublock", Field, 0},
+		{"Rusage.Stime", Field, 0},
+		{"Rusage.UserTime", Field, 0},
+		{"Rusage.Utime", Field, 0},
+		{"SCM_BINTIME", Const, 0},
+		{"SCM_CREDENTIALS", Const, 0},
+		{"SCM_CREDS", Const, 0},
+		{"SCM_RIGHTS", Const, 0},
+		{"SCM_TIMESTAMP", Const, 0},
+		{"SCM_TIMESTAMPING", Const, 0},
+		{"SCM_TIMESTAMPNS", Const, 0},
+		{"SCM_TIMESTAMP_MONOTONIC", Const, 0},
+		{"SHUT_RD", Const, 0},
+		{"SHUT_RDWR", Const, 0},
+		{"SHUT_WR", Const, 0},
+		{"SID", Type, 0},
+		{"SIDAndAttributes", Type, 0},
+		{"SIDAndAttributes.Attributes", Field, 0},
+		{"SIDAndAttributes.Sid", Field, 0},
+		{"SIGABRT", Const, 0},
+		{"SIGALRM", Const, 0},
+		{"SIGBUS", Const, 0},
+		{"SIGCHLD", Const, 0},
+		{"SIGCLD", Const, 0},
+		{"SIGCONT", Const, 0},
+		{"SIGEMT", Const, 0},
+		{"SIGFPE", Const, 0},
+		{"SIGHUP", Const, 0},
+		{"SIGILL", Const, 0},
+		{"SIGINFO", Const, 0},
+		{"SIGINT", Const, 0},
+		{"SIGIO", Const, 0},
+		{"SIGIOT", Const, 0},
+		{"SIGKILL", Const, 0},
+		{"SIGLIBRT", Const, 1},
+		{"SIGLWP", Const, 0},
+		{"SIGPIPE", Const, 0},
+		{"SIGPOLL", Const, 0},
+		{"SIGPROF", Const, 0},
+		{"SIGPWR", Const, 0},
+		{"SIGQUIT", Const, 0},
+		{"SIGSEGV", Const, 0},
+		{"SIGSTKFLT", Const, 0},
+		{"SIGSTOP", Const, 0},
+		{"SIGSYS", Const, 0},
+		{"SIGTERM", Const, 0},
+		{"SIGTHR", Const, 0},
+		{"SIGTRAP", Const, 0},
+		{"SIGTSTP", Const, 0},
+		{"SIGTTIN", Const, 0},
+		{"SIGTTOU", Const, 0},
+		{"SIGUNUSED", Const, 0},
+		{"SIGURG", Const, 0},
+		{"SIGUSR1", Const, 0},
+		{"SIGUSR2", Const, 0},
+		{"SIGVTALRM", Const, 0},
+		{"SIGWINCH", Const, 0},
+		{"SIGXCPU", Const, 0},
+		{"SIGXFSZ", Const, 0},
+		{"SIOCADDDLCI", Const, 0},
+		{"SIOCADDMULTI", Const, 0},
+		{"SIOCADDRT", Const, 0},
+		{"SIOCAIFADDR", Const, 0},
+		{"SIOCAIFGROUP", Const, 0},
+		{"SIOCALIFADDR", Const, 0},
+		{"SIOCARPIPLL", Const, 0},
+		{"SIOCATMARK", Const, 0},
+		{"SIOCAUTOADDR", Const, 0},
+		{"SIOCAUTONETMASK", Const, 0},
+		{"SIOCBRDGADD", Const, 1},
+		{"SIOCBRDGADDS", Const, 1},
+		{"SIOCBRDGARL", Const, 1},
+		{"SIOCBRDGDADDR", Const, 1},
+		{"SIOCBRDGDEL", Const, 1},
+		{"SIOCBRDGDELS", Const, 1},
+		{"SIOCBRDGFLUSH", Const, 1},
+		{"SIOCBRDGFRL", Const, 1},
+		{"SIOCBRDGGCACHE", Const, 1},
+		{"SIOCBRDGGFD", Const, 1},
+		{"SIOCBRDGGHT", Const, 1},
+		{"SIOCBRDGGIFFLGS", Const, 1},
+		{"SIOCBRDGGMA", Const, 1},
+		{"SIOCBRDGGPARAM", Const, 1},
+		{"SIOCBRDGGPRI", Const, 1},
+		{"SIOCBRDGGRL", Const, 1},
+		{"SIOCBRDGGSIFS", Const, 1},
+		{"SIOCBRDGGTO", Const, 1},
+		{"SIOCBRDGIFS", Const, 1},
+		{"SIOCBRDGRTS", Const, 1},
+		{"SIOCBRDGSADDR", Const, 1},
+		{"SIOCBRDGSCACHE", Const, 1},
+		{"SIOCBRDGSFD", Const, 1},
+		{"SIOCBRDGSHT", Const, 1},
+		{"SIOCBRDGSIFCOST", Const, 1},
+		{"SIOCBRDGSIFFLGS", Const, 1},
+		{"SIOCBRDGSIFPRIO", Const, 1},
+		{"SIOCBRDGSMA", Const, 1},
+		{"SIOCBRDGSPRI", Const, 1},
+		{"SIOCBRDGSPROTO", Const, 1},
+		{"SIOCBRDGSTO", Const, 1},
+		{"SIOCBRDGSTXHC", Const, 1},
+		{"SIOCDARP", Const, 0},
+		{"SIOCDELDLCI", Const, 0},
+		{"SIOCDELMULTI", Const, 0},
+		{"SIOCDELRT", Const, 0},
+		{"SIOCDEVPRIVATE", Const, 0},
+		{"SIOCDIFADDR", Const, 0},
+		{"SIOCDIFGROUP", Const, 0},
+		{"SIOCDIFPHYADDR", Const, 0},
+		{"SIOCDLIFADDR", Const, 0},
+		{"SIOCDRARP", Const, 0},
+		{"SIOCGARP", Const, 0},
+		{"SIOCGDRVSPEC", Const, 0},
+		{"SIOCGETKALIVE", Const, 1},
+		{"SIOCGETLABEL", Const, 1},
+		{"SIOCGETPFLOW", Const, 1},
+		{"SIOCGETPFSYNC", Const, 1},
+		{"SIOCGETSGCNT", Const, 0},
+		{"SIOCGETVIFCNT", Const, 0},
+		{"SIOCGETVLAN", Const, 0},
+		{"SIOCGHIWAT", Const, 0},
+		{"SIOCGIFADDR", Const, 0},
+		{"SIOCGIFADDRPREF", Const, 1},
+		{"SIOCGIFALIAS", Const, 1},
+		{"SIOCGIFALTMTU", Const, 0},
+		{"SIOCGIFASYNCMAP", Const, 0},
+		{"SIOCGIFBOND", Const, 0},
+		{"SIOCGIFBR", Const, 0},
+		{"SIOCGIFBRDADDR", Const, 0},
+		{"SIOCGIFCAP", Const, 0},
+		{"SIOCGIFCONF", Const, 0},
+		{"SIOCGIFCOUNT", Const, 0},
+		{"SIOCGIFDATA", Const, 1},
+		{"SIOCGIFDESCR", Const, 0},
+		{"SIOCGIFDEVMTU", Const, 0},
+		{"SIOCGIFDLT", Const, 1},
+		{"SIOCGIFDSTADDR", Const, 0},
+		{"SIOCGIFENCAP", Const, 0},
+		{"SIOCGIFFIB", Const, 1},
+		{"SIOCGIFFLAGS", Const, 0},
+		{"SIOCGIFGATTR", Const, 1},
+		{"SIOCGIFGENERIC", Const, 0},
+		{"SIOCGIFGMEMB", Const, 0},
+		{"SIOCGIFGROUP", Const, 0},
+		{"SIOCGIFHARDMTU", Const, 3},
+		{"SIOCGIFHWADDR", Const, 0},
+		{"SIOCGIFINDEX", Const, 0},
+		{"SIOCGIFKPI", Const, 0},
+		{"SIOCGIFMAC", Const, 0},
+		{"SIOCGIFMAP", Const, 0},
+		{"SIOCGIFMEDIA", Const, 0},
+		{"SIOCGIFMEM", Const, 0},
+		{"SIOCGIFMETRIC", Const, 0},
+		{"SIOCGIFMTU", Const, 0},
+		{"SIOCGIFNAME", Const, 0},
+		{"SIOCGIFNETMASK", Const, 0},
+		{"SIOCGIFPDSTADDR", Const, 0},
+		{"SIOCGIFPFLAGS", Const, 0},
+		{"SIOCGIFPHYS", Const, 0},
+		{"SIOCGIFPRIORITY", Const, 1},
+		{"SIOCGIFPSRCADDR", Const, 0},
+		{"SIOCGIFRDOMAIN", Const, 1},
+		{"SIOCGIFRTLABEL", Const, 1},
+		{"SIOCGIFSLAVE", Const, 0},
+		{"SIOCGIFSTATUS", Const, 0},
+		{"SIOCGIFTIMESLOT", Const, 1},
+		{"SIOCGIFTXQLEN", Const, 0},
+		{"SIOCGIFVLAN", Const, 0},
+		{"SIOCGIFWAKEFLAGS", Const, 0},
+		{"SIOCGIFXFLAGS", Const, 1},
+		{"SIOCGLIFADDR", Const, 0},
+		{"SIOCGLIFPHYADDR", Const, 0},
+		{"SIOCGLIFPHYRTABLE", Const, 1},
+		{"SIOCGLIFPHYTTL", Const, 3},
+		{"SIOCGLINKSTR", Const, 1},
+		{"SIOCGLOWAT", Const, 0},
+		{"SIOCGPGRP", Const, 0},
+		{"SIOCGPRIVATE_0", Const, 0},
+		{"SIOCGPRIVATE_1", Const, 0},
+		{"SIOCGRARP", Const, 0},
+		{"SIOCGSPPPPARAMS", Const, 3},
+		{"SIOCGSTAMP", Const, 0},
+		{"SIOCGSTAMPNS", Const, 0},
+		{"SIOCGVH", Const, 1},
+		{"SIOCGVNETID", Const, 3},
+		{"SIOCIFCREATE", Const, 0},
+		{"SIOCIFCREATE2", Const, 0},
+		{"SIOCIFDESTROY", Const, 0},
+		{"SIOCIFGCLONERS", Const, 0},
+		{"SIOCINITIFADDR", Const, 1},
+		{"SIOCPROTOPRIVATE", Const, 0},
+		{"SIOCRSLVMULTI", Const, 0},
+		{"SIOCRTMSG", Const, 0},
+		{"SIOCSARP", Const, 0},
+		{"SIOCSDRVSPEC", Const, 0},
+		{"SIOCSETKALIVE", Const, 1},
+		{"SIOCSETLABEL", Const, 1},
+		{"SIOCSETPFLOW", Const, 1},
+		{"SIOCSETPFSYNC", Const, 1},
+		{"SIOCSETVLAN", Const, 0},
+		{"SIOCSHIWAT", Const, 0},
+		{"SIOCSIFADDR", Const, 0},
+		{"SIOCSIFADDRPREF", Const, 1},
+		{"SIOCSIFALTMTU", Const, 0},
+		{"SIOCSIFASYNCMAP", Const, 0},
+		{"SIOCSIFBOND", Const, 0},
+		{"SIOCSIFBR", Const, 0},
+		{"SIOCSIFBRDADDR", Const, 0},
+		{"SIOCSIFCAP", Const, 0},
+		{"SIOCSIFDESCR", Const, 0},
+		{"SIOCSIFDSTADDR", Const, 0},
+		{"SIOCSIFENCAP", Const, 0},
+		{"SIOCSIFFIB", Const, 1},
+		{"SIOCSIFFLAGS", Const, 0},
+		{"SIOCSIFGATTR", Const, 1},
+		{"SIOCSIFGENERIC", Const, 0},
+		{"SIOCSIFHWADDR", Const, 0},
+		{"SIOCSIFHWBROADCAST", Const, 0},
+		{"SIOCSIFKPI", Const, 0},
+		{"SIOCSIFLINK", Const, 0},
+		{"SIOCSIFLLADDR", Const, 0},
+		{"SIOCSIFMAC", Const, 0},
+		{"SIOCSIFMAP", Const, 0},
+		{"SIOCSIFMEDIA", Const, 0},
+		{"SIOCSIFMEM", Const, 0},
+		{"SIOCSIFMETRIC", Const, 0},
+		{"SIOCSIFMTU", Const, 0},
+		{"SIOCSIFNAME", Const, 0},
+		{"SIOCSIFNETMASK", Const, 0},
+		{"SIOCSIFPFLAGS", Const, 0},
+		{"SIOCSIFPHYADDR", Const, 0},
+		{"SIOCSIFPHYS", Const, 0},
+		{"SIOCSIFPRIORITY", Const, 1},
+		{"SIOCSIFRDOMAIN", Const, 1},
+		{"SIOCSIFRTLABEL", Const, 1},
+		{"SIOCSIFRVNET", Const, 0},
+		{"SIOCSIFSLAVE", Const, 0},
+		{"SIOCSIFTIMESLOT", Const, 1},
+		{"SIOCSIFTXQLEN", Const, 0},
+		{"SIOCSIFVLAN", Const, 0},
+		{"SIOCSIFVNET", Const, 0},
+		{"SIOCSIFXFLAGS", Const, 1},
+		{"SIOCSLIFPHYADDR", Const, 0},
+		{"SIOCSLIFPHYRTABLE", Const, 1},
+		{"SIOCSLIFPHYTTL", Const, 3},
+		{"SIOCSLINKSTR", Const, 1},
+		{"SIOCSLOWAT", Const, 0},
+		{"SIOCSPGRP", Const, 0},
+		{"SIOCSRARP", Const, 0},
+		{"SIOCSSPPPPARAMS", Const, 3},
+		{"SIOCSVH", Const, 1},
+		{"SIOCSVNETID", Const, 3},
+		{"SIOCZIFDATA", Const, 1},
+		{"SIO_GET_EXTENSION_FUNCTION_POINTER", Const, 1},
+		{"SIO_GET_INTERFACE_LIST", Const, 0},
+		{"SIO_KEEPALIVE_VALS", Const, 3},
+		{"SIO_UDP_CONNRESET", Const, 4},
+		{"SOCK_CLOEXEC", Const, 0},
+		{"SOCK_DCCP", Const, 0},
+		{"SOCK_DGRAM", Const, 0},
+		{"SOCK_FLAGS_MASK", Const, 1},
+		{"SOCK_MAXADDRLEN", Const, 0},
+		{"SOCK_NONBLOCK", Const, 0},
+		{"SOCK_NOSIGPIPE", Const, 1},
+		{"SOCK_PACKET", Const, 0},
+		{"SOCK_RAW", Const, 0},
+		{"SOCK_RDM", Const, 0},
+		{"SOCK_SEQPACKET", Const, 0},
+		{"SOCK_STREAM", Const, 0},
+		{"SOL_AAL", Const, 0},
+		{"SOL_ATM", Const, 0},
+		{"SOL_DECNET", Const, 0},
+		{"SOL_ICMPV6", Const, 0},
+		{"SOL_IP", Const, 0},
+		{"SOL_IPV6", Const, 0},
+		{"SOL_IRDA", Const, 0},
+		{"SOL_PACKET", Const, 0},
+		{"SOL_RAW", Const, 0},
+		{"SOL_SOCKET", Const, 0},
+		{"SOL_TCP", Const, 0},
+		{"SOL_X25", Const, 0},
+		{"SOMAXCONN", Const, 0},
+		{"SO_ACCEPTCONN", Const, 0},
+		{"SO_ACCEPTFILTER", Const, 0},
+		{"SO_ATTACH_FILTER", Const, 0},
+		{"SO_BINDANY", Const, 1},
+		{"SO_BINDTODEVICE", Const, 0},
+		{"SO_BINTIME", Const, 0},
+		{"SO_BROADCAST", Const, 0},
+		{"SO_BSDCOMPAT", Const, 0},
+		{"SO_DEBUG", Const, 0},
+		{"SO_DETACH_FILTER", Const, 0},
+		{"SO_DOMAIN", Const, 0},
+		{"SO_DONTROUTE", Const, 0},
+		{"SO_DONTTRUNC", Const, 0},
+		{"SO_ERROR", Const, 0},
+		{"SO_KEEPALIVE", Const, 0},
+		{"SO_LABEL", Const, 0},
+		{"SO_LINGER", Const, 0},
+		{"SO_LINGER_SEC", Const, 0},
+		{"SO_LISTENINCQLEN", Const, 0},
+		{"SO_LISTENQLEN", Const, 0},
+		{"SO_LISTENQLIMIT", Const, 0},
+		{"SO_MARK", Const, 0},
+		{"SO_NETPROC", Const, 1},
+		{"SO_NKE", Const, 0},
+		{"SO_NOADDRERR", Const, 0},
+		{"SO_NOHEADER", Const, 1},
+		{"SO_NOSIGPIPE", Const, 0},
+		{"SO_NOTIFYCONFLICT", Const, 0},
+		{"SO_NO_CHECK", Const, 0},
+		{"SO_NO_DDP", Const, 0},
+		{"SO_NO_OFFLOAD", Const, 0},
+		{"SO_NP_EXTENSIONS", Const, 0},
+		{"SO_NREAD", Const, 0},
+		{"SO_NUMRCVPKT", Const, 16},
+		{"SO_NWRITE", Const, 0},
+		{"SO_OOBINLINE", Const, 0},
+		{"SO_OVERFLOWED", Const, 1},
+		{"SO_PASSCRED", Const, 0},
+		{"SO_PASSSEC", Const, 0},
+		{"SO_PEERCRED", Const, 0},
+		{"SO_PEERLABEL", Const, 0},
+		{"SO_PEERNAME", Const, 0},
+		{"SO_PEERSEC", Const, 0},
+		{"SO_PRIORITY", Const, 0},
+		{"SO_PROTOCOL", Const, 0},
+		{"SO_PROTOTYPE", Const, 1},
+		{"SO_RANDOMPORT", Const, 0},
+		{"SO_RCVBUF", Const, 0},
+		{"SO_RCVBUFFORCE", Const, 0},
+		{"SO_RCVLOWAT", Const, 0},
+		{"SO_RCVTIMEO", Const, 0},
+		{"SO_RESTRICTIONS", Const, 0},
+		{"SO_RESTRICT_DENYIN", Const, 0},
+		{"SO_RESTRICT_DENYOUT", Const, 0},
+		{"SO_RESTRICT_DENYSET", Const, 0},
+		{"SO_REUSEADDR", Const, 0},
+		{"SO_REUSEPORT", Const, 0},
+		{"SO_REUSESHAREUID", Const, 0},
+		{"SO_RTABLE", Const, 1},
+		{"SO_RXQ_OVFL", Const, 0},
+		{"SO_SECURITY_AUTHENTICATION", Const, 0},
+		{"SO_SECURITY_ENCRYPTION_NETWORK", Const, 0},
+		{"SO_SECURITY_ENCRYPTION_TRANSPORT", Const, 0},
+		{"SO_SETFIB", Const, 0},
+		{"SO_SNDBUF", Const, 0},
+		{"SO_SNDBUFFORCE", Const, 0},
+		{"SO_SNDLOWAT", Const, 0},
+		{"SO_SNDTIMEO", Const, 0},
+		{"SO_SPLICE", Const, 1},
+		{"SO_TIMESTAMP", Const, 0},
+		{"SO_TIMESTAMPING", Const, 0},
+		{"SO_TIMESTAMPNS", Const, 0},
+		{"SO_TIMESTAMP_MONOTONIC", Const, 0},
+		{"SO_TYPE", Const, 0},
+		{"SO_UPCALLCLOSEWAIT", Const, 0},
+		{"SO_UPDATE_ACCEPT_CONTEXT", Const, 0},
+		{"SO_UPDATE_CONNECT_CONTEXT", Const, 1},
+		{"SO_USELOOPBACK", Const, 0},
+		{"SO_USER_COOKIE", Const, 1},
+		{"SO_VENDOR", Const, 3},
+		{"SO_WANTMORE", Const, 0},
+		{"SO_WANTOOBFLAG", Const, 0},
+		{"SSLExtraCertChainPolicyPara", Type, 0},
+		{"SSLExtraCertChainPolicyPara.AuthType", Field, 0},
+		{"SSLExtraCertChainPolicyPara.Checks", Field, 0},
+		{"SSLExtraCertChainPolicyPara.ServerName", Field, 0},
+		{"SSLExtraCertChainPolicyPara.Size", Field, 0},
+		{"STANDARD_RIGHTS_ALL", Const, 0},
+		{"STANDARD_RIGHTS_EXECUTE", Const, 0},
+		{"STANDARD_RIGHTS_READ", Const, 0},
+		{"STANDARD_RIGHTS_REQUIRED", Const, 0},
+		{"STANDARD_RIGHTS_WRITE", Const, 0},
+		{"STARTF_USESHOWWINDOW", Const, 0},
+		{"STARTF_USESTDHANDLES", Const, 0},
+		{"STD_ERROR_HANDLE", Const, 0},
+		{"STD_INPUT_HANDLE", Const, 0},
+		{"STD_OUTPUT_HANDLE", Const, 0},
+		{"SUBLANG_ENGLISH_US", Const, 0},
+		{"SW_FORCEMINIMIZE", Const, 0},
+		{"SW_HIDE", Const, 0},
+		{"SW_MAXIMIZE", Const, 0},
+		{"SW_MINIMIZE", Const, 0},
+		{"SW_NORMAL", Const, 0},
+		{"SW_RESTORE", Const, 0},
+		{"SW_SHOW", Const, 0},
+		{"SW_SHOWDEFAULT", Const, 0},
+		{"SW_SHOWMAXIMIZED", Const, 0},
+		{"SW_SHOWMINIMIZED", Const, 0},
+		{"SW_SHOWMINNOACTIVE", Const, 0},
+		{"SW_SHOWNA", Const, 0},
+		{"SW_SHOWNOACTIVATE", Const, 0},
+		{"SW_SHOWNORMAL", Const, 0},
+		{"SYMBOLIC_LINK_FLAG_DIRECTORY", Const, 4},
+		{"SYNCHRONIZE", Const, 0},
+		{"SYSCTL_VERSION", Const, 1},
+		{"SYSCTL_VERS_0", Const, 1},
+		{"SYSCTL_VERS_1", Const, 1},
+		{"SYSCTL_VERS_MASK", Const, 1},
+		{"SYS_ABORT2", Const, 0},
+		{"SYS_ACCEPT", Const, 0},
+		{"SYS_ACCEPT4", Const, 0},
+		{"SYS_ACCEPT_NOCANCEL", Const, 0},
+		{"SYS_ACCESS", Const, 0},
+		{"SYS_ACCESS_EXTENDED", Const, 0},
+		{"SYS_ACCT", Const, 0},
+		{"SYS_ADD_KEY", Const, 0},
+		{"SYS_ADD_PROFIL", Const, 0},
+		{"SYS_ADJFREQ", Const, 1},
+		{"SYS_ADJTIME", Const, 0},
+		{"SYS_ADJTIMEX", Const, 0},
+		{"SYS_AFS_SYSCALL", Const, 0},
+		{"SYS_AIO_CANCEL", Const, 0},
+		{"SYS_AIO_ERROR", Const, 0},
+		{"SYS_AIO_FSYNC", Const, 0},
+		{"SYS_AIO_MLOCK", Const, 14},
+		{"SYS_AIO_READ", Const, 0},
+		{"SYS_AIO_RETURN", Const, 0},
+		{"SYS_AIO_SUSPEND", Const, 0},
+		{"SYS_AIO_SUSPEND_NOCANCEL", Const, 0},
+		{"SYS_AIO_WAITCOMPLETE", Const, 14},
+		{"SYS_AIO_WRITE", Const, 0},
+		{"SYS_ALARM", Const, 0},
+		{"SYS_ARCH_PRCTL", Const, 0},
+		{"SYS_ARM_FADVISE64_64", Const, 0},
+		{"SYS_ARM_SYNC_FILE_RANGE", Const, 0},
+		{"SYS_ATGETMSG", Const, 0},
+		{"SYS_ATPGETREQ", Const, 0},
+		{"SYS_ATPGETRSP", Const, 0},
+		{"SYS_ATPSNDREQ", Const, 0},
+		{"SYS_ATPSNDRSP", Const, 0},
+		{"SYS_ATPUTMSG", Const, 0},
+		{"SYS_ATSOCKET", Const, 0},
+		{"SYS_AUDIT", Const, 0},
+		{"SYS_AUDITCTL", Const, 0},
+		{"SYS_AUDITON", Const, 0},
+		{"SYS_AUDIT_SESSION_JOIN", Const, 0},
+		{"SYS_AUDIT_SESSION_PORT", Const, 0},
+		{"SYS_AUDIT_SESSION_SELF", Const, 0},
+		{"SYS_BDFLUSH", Const, 0},
+		{"SYS_BIND", Const, 0},
+		{"SYS_BINDAT", Const, 3},
+		{"SYS_BREAK", Const, 0},
+		{"SYS_BRK", Const, 0},
+		{"SYS_BSDTHREAD_CREATE", Const, 0},
+		{"SYS_BSDTHREAD_REGISTER", Const, 0},
+		{"SYS_BSDTHREAD_TERMINATE", Const, 0},
+		{"SYS_CAPGET", Const, 0},
+		{"SYS_CAPSET", Const, 0},
+		{"SYS_CAP_ENTER", Const, 0},
+		{"SYS_CAP_FCNTLS_GET", Const, 1},
+		{"SYS_CAP_FCNTLS_LIMIT", Const, 1},
+		{"SYS_CAP_GETMODE", Const, 0},
+		{"SYS_CAP_GETRIGHTS", Const, 0},
+		{"SYS_CAP_IOCTLS_GET", Const, 1},
+		{"SYS_CAP_IOCTLS_LIMIT", Const, 1},
+		{"SYS_CAP_NEW", Const, 0},
+		{"SYS_CAP_RIGHTS_GET", Const, 1},
+		{"SYS_CAP_RIGHTS_LIMIT", Const, 1},
+		{"SYS_CHDIR", Const, 0},
+		{"SYS_CHFLAGS", Const, 0},
+		{"SYS_CHFLAGSAT", Const, 3},
+		{"SYS_CHMOD", Const, 0},
+		{"SYS_CHMOD_EXTENDED", Const, 0},
+		{"SYS_CHOWN", Const, 0},
+		{"SYS_CHOWN32", Const, 0},
+		{"SYS_CHROOT", Const, 0},
+		{"SYS_CHUD", Const, 0},
+		{"SYS_CLOCK_ADJTIME", Const, 0},
+		{"SYS_CLOCK_GETCPUCLOCKID2", Const, 1},
+		{"SYS_CLOCK_GETRES", Const, 0},
+		{"SYS_CLOCK_GETTIME", Const, 0},
+		{"SYS_CLOCK_NANOSLEEP", Const, 0},
+		{"SYS_CLOCK_SETTIME", Const, 0},
+		{"SYS_CLONE", Const, 0},
+		{"SYS_CLOSE", Const, 0},
+		{"SYS_CLOSEFROM", Const, 0},
+		{"SYS_CLOSE_NOCANCEL", Const, 0},
+		{"SYS_CONNECT", Const, 0},
+		{"SYS_CONNECTAT", Const, 3},
+		{"SYS_CONNECT_NOCANCEL", Const, 0},
+		{"SYS_COPYFILE", Const, 0},
+		{"SYS_CPUSET", Const, 0},
+		{"SYS_CPUSET_GETAFFINITY", Const, 0},
+		{"SYS_CPUSET_GETID", Const, 0},
+		{"SYS_CPUSET_SETAFFINITY", Const, 0},
+		{"SYS_CPUSET_SETID", Const, 0},
+		{"SYS_CREAT", Const, 0},
+		{"SYS_CREATE_MODULE", Const, 0},
+		{"SYS_CSOPS", Const, 0},
+		{"SYS_CSOPS_AUDITTOKEN", Const, 16},
+		{"SYS_DELETE", Const, 0},
+		{"SYS_DELETE_MODULE", Const, 0},
+		{"SYS_DUP", Const, 0},
+		{"SYS_DUP2", Const, 0},
+		{"SYS_DUP3", Const, 0},
+		{"SYS_EACCESS", Const, 0},
+		{"SYS_EPOLL_CREATE", Const, 0},
+		{"SYS_EPOLL_CREATE1", Const, 0},
+		{"SYS_EPOLL_CTL", Const, 0},
+		{"SYS_EPOLL_CTL_OLD", Const, 0},
+		{"SYS_EPOLL_PWAIT", Const, 0},
+		{"SYS_EPOLL_WAIT", Const, 0},
+		{"SYS_EPOLL_WAIT_OLD", Const, 0},
+		{"SYS_EVENTFD", Const, 0},
+		{"SYS_EVENTFD2", Const, 0},
+		{"SYS_EXCHANGEDATA", Const, 0},
+		{"SYS_EXECVE", Const, 0},
+		{"SYS_EXIT", Const, 0},
+		{"SYS_EXIT_GROUP", Const, 0},
+		{"SYS_EXTATTRCTL", Const, 0},
+		{"SYS_EXTATTR_DELETE_FD", Const, 0},
+		{"SYS_EXTATTR_DELETE_FILE", Const, 0},
+		{"SYS_EXTATTR_DELETE_LINK", Const, 0},
+		{"SYS_EXTATTR_GET_FD", Const, 0},
+		{"SYS_EXTATTR_GET_FILE", Const, 0},
+		{"SYS_EXTATTR_GET_LINK", Const, 0},
+		{"SYS_EXTATTR_LIST_FD", Const, 0},
+		{"SYS_EXTATTR_LIST_FILE", Const, 0},
+		{"SYS_EXTATTR_LIST_LINK", Const, 0},
+		{"SYS_EXTATTR_SET_FD", Const, 0},
+		{"SYS_EXTATTR_SET_FILE", Const, 0},
+		{"SYS_EXTATTR_SET_LINK", Const, 0},
+		{"SYS_FACCESSAT", Const, 0},
+		{"SYS_FADVISE64", Const, 0},
+		{"SYS_FADVISE64_64", Const, 0},
+		{"SYS_FALLOCATE", Const, 0},
+		{"SYS_FANOTIFY_INIT", Const, 0},
+		{"SYS_FANOTIFY_MARK", Const, 0},
+		{"SYS_FCHDIR", Const, 0},
+		{"SYS_FCHFLAGS", Const, 0},
+		{"SYS_FCHMOD", Const, 0},
+		{"SYS_FCHMODAT", Const, 0},
+		{"SYS_FCHMOD_EXTENDED", Const, 0},
+		{"SYS_FCHOWN", Const, 0},
+		{"SYS_FCHOWN32", Const, 0},
+		{"SYS_FCHOWNAT", Const, 0},
+		{"SYS_FCHROOT", Const, 1},
+		{"SYS_FCNTL", Const, 0},
+		{"SYS_FCNTL64", Const, 0},
+		{"SYS_FCNTL_NOCANCEL", Const, 0},
+		{"SYS_FDATASYNC", Const, 0},
+		{"SYS_FEXECVE", Const, 0},
+		{"SYS_FFCLOCK_GETCOUNTER", Const, 0},
+		{"SYS_FFCLOCK_GETESTIMATE", Const, 0},
+		{"SYS_FFCLOCK_SETESTIMATE", Const, 0},
+		{"SYS_FFSCTL", Const, 0},
+		{"SYS_FGETATTRLIST", Const, 0},
+		{"SYS_FGETXATTR", Const, 0},
+		{"SYS_FHOPEN", Const, 0},
+		{"SYS_FHSTAT", Const, 0},
+		{"SYS_FHSTATFS", Const, 0},
+		{"SYS_FILEPORT_MAKEFD", Const, 0},
+		{"SYS_FILEPORT_MAKEPORT", Const, 0},
+		{"SYS_FKTRACE", Const, 1},
+		{"SYS_FLISTXATTR", Const, 0},
+		{"SYS_FLOCK", Const, 0},
+		{"SYS_FORK", Const, 0},
+		{"SYS_FPATHCONF", Const, 0},
+		{"SYS_FREEBSD6_FTRUNCATE", Const, 0},
+		{"SYS_FREEBSD6_LSEEK", Const, 0},
+		{"SYS_FREEBSD6_MMAP", Const, 0},
+		{"SYS_FREEBSD6_PREAD", Const, 0},
+		{"SYS_FREEBSD6_PWRITE", Const, 0},
+		{"SYS_FREEBSD6_TRUNCATE", Const, 0},
+		{"SYS_FREMOVEXATTR", Const, 0},
+		{"SYS_FSCTL", Const, 0},
+		{"SYS_FSETATTRLIST", Const, 0},
+		{"SYS_FSETXATTR", Const, 0},
+		{"SYS_FSGETPATH", Const, 0},
+		{"SYS_FSTAT", Const, 0},
+		{"SYS_FSTAT64", Const, 0},
+		{"SYS_FSTAT64_EXTENDED", Const, 0},
+		{"SYS_FSTATAT", Const, 0},
+		{"SYS_FSTATAT64", Const, 0},
+		{"SYS_FSTATFS", Const, 0},
+		{"SYS_FSTATFS64", Const, 0},
+		{"SYS_FSTATV", Const, 0},
+		{"SYS_FSTATVFS1", Const, 1},
+		{"SYS_FSTAT_EXTENDED", Const, 0},
+		{"SYS_FSYNC", Const, 0},
+		{"SYS_FSYNC_NOCANCEL", Const, 0},
+		{"SYS_FSYNC_RANGE", Const, 1},
+		{"SYS_FTIME", Const, 0},
+		{"SYS_FTRUNCATE", Const, 0},
+		{"SYS_FTRUNCATE64", Const, 0},
+		{"SYS_FUTEX", Const, 0},
+		{"SYS_FUTIMENS", Const, 1},
+		{"SYS_FUTIMES", Const, 0},
+		{"SYS_FUTIMESAT", Const, 0},
+		{"SYS_GETATTRLIST", Const, 0},
+		{"SYS_GETAUDIT", Const, 0},
+		{"SYS_GETAUDIT_ADDR", Const, 0},
+		{"SYS_GETAUID", Const, 0},
+		{"SYS_GETCONTEXT", Const, 0},
+		{"SYS_GETCPU", Const, 0},
+		{"SYS_GETCWD", Const, 0},
+		{"SYS_GETDENTS", Const, 0},
+		{"SYS_GETDENTS64", Const, 0},
+		{"SYS_GETDIRENTRIES", Const, 0},
+		{"SYS_GETDIRENTRIES64", Const, 0},
+		{"SYS_GETDIRENTRIESATTR", Const, 0},
+		{"SYS_GETDTABLECOUNT", Const, 1},
+		{"SYS_GETDTABLESIZE", Const, 0},
+		{"SYS_GETEGID", Const, 0},
+		{"SYS_GETEGID32", Const, 0},
+		{"SYS_GETEUID", Const, 0},
+		{"SYS_GETEUID32", Const, 0},
+		{"SYS_GETFH", Const, 0},
+		{"SYS_GETFSSTAT", Const, 0},
+		{"SYS_GETFSSTAT64", Const, 0},
+		{"SYS_GETGID", Const, 0},
+		{"SYS_GETGID32", Const, 0},
+		{"SYS_GETGROUPS", Const, 0},
+		{"SYS_GETGROUPS32", Const, 0},
+		{"SYS_GETHOSTUUID", Const, 0},
+		{"SYS_GETITIMER", Const, 0},
+		{"SYS_GETLCID", Const, 0},
+		{"SYS_GETLOGIN", Const, 0},
+		{"SYS_GETLOGINCLASS", Const, 0},
+		{"SYS_GETPEERNAME", Const, 0},
+		{"SYS_GETPGID", Const, 0},
+		{"SYS_GETPGRP", Const, 0},
+		{"SYS_GETPID", Const, 0},
+		{"SYS_GETPMSG", Const, 0},
+		{"SYS_GETPPID", Const, 0},
+		{"SYS_GETPRIORITY", Const, 0},
+		{"SYS_GETRESGID", Const, 0},
+		{"SYS_GETRESGID32", Const, 0},
+		{"SYS_GETRESUID", Const, 0},
+		{"SYS_GETRESUID32", Const, 0},
+		{"SYS_GETRLIMIT", Const, 0},
+		{"SYS_GETRTABLE", Const, 1},
+		{"SYS_GETRUSAGE", Const, 0},
+		{"SYS_GETSGROUPS", Const, 0},
+		{"SYS_GETSID", Const, 0},
+		{"SYS_GETSOCKNAME", Const, 0},
+		{"SYS_GETSOCKOPT", Const, 0},
+		{"SYS_GETTHRID", Const, 1},
+		{"SYS_GETTID", Const, 0},
+		{"SYS_GETTIMEOFDAY", Const, 0},
+		{"SYS_GETUID", Const, 0},
+		{"SYS_GETUID32", Const, 0},
+		{"SYS_GETVFSSTAT", Const, 1},
+		{"SYS_GETWGROUPS", Const, 0},
+		{"SYS_GETXATTR", Const, 0},
+		{"SYS_GET_KERNEL_SYMS", Const, 0},
+		{"SYS_GET_MEMPOLICY", Const, 0},
+		{"SYS_GET_ROBUST_LIST", Const, 0},
+		{"SYS_GET_THREAD_AREA", Const, 0},
+		{"SYS_GSSD_SYSCALL", Const, 14},
+		{"SYS_GTTY", Const, 0},
+		{"SYS_IDENTITYSVC", Const, 0},
+		{"SYS_IDLE", Const, 0},
+		{"SYS_INITGROUPS", Const, 0},
+		{"SYS_INIT_MODULE", Const, 0},
+		{"SYS_INOTIFY_ADD_WATCH", Const, 0},
+		{"SYS_INOTIFY_INIT", Const, 0},
+		{"SYS_INOTIFY_INIT1", Const, 0},
+		{"SYS_INOTIFY_RM_WATCH", Const, 0},
+		{"SYS_IOCTL", Const, 0},
+		{"SYS_IOPERM", Const, 0},
+		{"SYS_IOPL", Const, 0},
+		{"SYS_IOPOLICYSYS", Const, 0},
+		{"SYS_IOPRIO_GET", Const, 0},
+		{"SYS_IOPRIO_SET", Const, 0},
+		{"SYS_IO_CANCEL", Const, 0},
+		{"SYS_IO_DESTROY", Const, 0},
+		{"SYS_IO_GETEVENTS", Const, 0},
+		{"SYS_IO_SETUP", Const, 0},
+		{"SYS_IO_SUBMIT", Const, 0},
+		{"SYS_IPC", Const, 0},
+		{"SYS_ISSETUGID", Const, 0},
+		{"SYS_JAIL", Const, 0},
+		{"SYS_JAIL_ATTACH", Const, 0},
+		{"SYS_JAIL_GET", Const, 0},
+		{"SYS_JAIL_REMOVE", Const, 0},
+		{"SYS_JAIL_SET", Const, 0},
+		{"SYS_KAS_INFO", Const, 16},
+		{"SYS_KDEBUG_TRACE", Const, 0},
+		{"SYS_KENV", Const, 0},
+		{"SYS_KEVENT", Const, 0},
+		{"SYS_KEVENT64", Const, 0},
+		{"SYS_KEXEC_LOAD", Const, 0},
+		{"SYS_KEYCTL", Const, 0},
+		{"SYS_KILL", Const, 0},
+		{"SYS_KLDFIND", Const, 0},
+		{"SYS_KLDFIRSTMOD", Const, 0},
+		{"SYS_KLDLOAD", Const, 0},
+		{"SYS_KLDNEXT", Const, 0},
+		{"SYS_KLDSTAT", Const, 0},
+		{"SYS_KLDSYM", Const, 0},
+		{"SYS_KLDUNLOAD", Const, 0},
+		{"SYS_KLDUNLOADF", Const, 0},
+		{"SYS_KMQ_NOTIFY", Const, 14},
+		{"SYS_KMQ_OPEN", Const, 14},
+		{"SYS_KMQ_SETATTR", Const, 14},
+		{"SYS_KMQ_TIMEDRECEIVE", Const, 14},
+		{"SYS_KMQ_TIMEDSEND", Const, 14},
+		{"SYS_KMQ_UNLINK", Const, 14},
+		{"SYS_KQUEUE", Const, 0},
+		{"SYS_KQUEUE1", Const, 1},
+		{"SYS_KSEM_CLOSE", Const, 14},
+		{"SYS_KSEM_DESTROY", Const, 14},
+		{"SYS_KSEM_GETVALUE", Const, 14},
+		{"SYS_KSEM_INIT", Const, 14},
+		{"SYS_KSEM_OPEN", Const, 14},
+		{"SYS_KSEM_POST", Const, 14},
+		{"SYS_KSEM_TIMEDWAIT", Const, 14},
+		{"SYS_KSEM_TRYWAIT", Const, 14},
+		{"SYS_KSEM_UNLINK", Const, 14},
+		{"SYS_KSEM_WAIT", Const, 14},
+		{"SYS_KTIMER_CREATE", Const, 0},
+		{"SYS_KTIMER_DELETE", Const, 0},
+		{"SYS_KTIMER_GETOVERRUN", Const, 0},
+		{"SYS_KTIMER_GETTIME", Const, 0},
+		{"SYS_KTIMER_SETTIME", Const, 0},
+		{"SYS_KTRACE", Const, 0},
+		{"SYS_LCHFLAGS", Const, 0},
+		{"SYS_LCHMOD", Const, 0},
+		{"SYS_LCHOWN", Const, 0},
+		{"SYS_LCHOWN32", Const, 0},
+		{"SYS_LEDGER", Const, 16},
+		{"SYS_LGETFH", Const, 0},
+		{"SYS_LGETXATTR", Const, 0},
+		{"SYS_LINK", Const, 0},
+		{"SYS_LINKAT", Const, 0},
+		{"SYS_LIO_LISTIO", Const, 0},
+		{"SYS_LISTEN", Const, 0},
+		{"SYS_LISTXATTR", Const, 0},
+		{"SYS_LLISTXATTR", Const, 0},
+		{"SYS_LOCK", Const, 0},
+		{"SYS_LOOKUP_DCOOKIE", Const, 0},
+		{"SYS_LPATHCONF", Const, 0},
+		{"SYS_LREMOVEXATTR", Const, 0},
+		{"SYS_LSEEK", Const, 0},
+		{"SYS_LSETXATTR", Const, 0},
+		{"SYS_LSTAT", Const, 0},
+		{"SYS_LSTAT64", Const, 0},
+		{"SYS_LSTAT64_EXTENDED", Const, 0},
+		{"SYS_LSTATV", Const, 0},
+		{"SYS_LSTAT_EXTENDED", Const, 0},
+		{"SYS_LUTIMES", Const, 0},
+		{"SYS_MAC_SYSCALL", Const, 0},
+		{"SYS_MADVISE", Const, 0},
+		{"SYS_MADVISE1", Const, 0},
+		{"SYS_MAXSYSCALL", Const, 0},
+		{"SYS_MBIND", Const, 0},
+		{"SYS_MIGRATE_PAGES", Const, 0},
+		{"SYS_MINCORE", Const, 0},
+		{"SYS_MINHERIT", Const, 0},
+		{"SYS_MKCOMPLEX", Const, 0},
+		{"SYS_MKDIR", Const, 0},
+		{"SYS_MKDIRAT", Const, 0},
+		{"SYS_MKDIR_EXTENDED", Const, 0},
+		{"SYS_MKFIFO", Const, 0},
+		{"SYS_MKFIFOAT", Const, 0},
+		{"SYS_MKFIFO_EXTENDED", Const, 0},
+		{"SYS_MKNOD", Const, 0},
+		{"SYS_MKNODAT", Const, 0},
+		{"SYS_MLOCK", Const, 0},
+		{"SYS_MLOCKALL", Const, 0},
+		{"SYS_MMAP", Const, 0},
+		{"SYS_MMAP2", Const, 0},
+		{"SYS_MODCTL", Const, 1},
+		{"SYS_MODFIND", Const, 0},
+		{"SYS_MODFNEXT", Const, 0},
+		{"SYS_MODIFY_LDT", Const, 0},
+		{"SYS_MODNEXT", Const, 0},
+		{"SYS_MODSTAT", Const, 0},
+		{"SYS_MODWATCH", Const, 0},
+		{"SYS_MOUNT", Const, 0},
+		{"SYS_MOVE_PAGES", Const, 0},
+		{"SYS_MPROTECT", Const, 0},
+		{"SYS_MPX", Const, 0},
+		{"SYS_MQUERY", Const, 1},
+		{"SYS_MQ_GETSETATTR", Const, 0},
+		{"SYS_MQ_NOTIFY", Const, 0},
+		{"SYS_MQ_OPEN", Const, 0},
+		{"SYS_MQ_TIMEDRECEIVE", Const, 0},
+		{"SYS_MQ_TIMEDSEND", Const, 0},
+		{"SYS_MQ_UNLINK", Const, 0},
+		{"SYS_MREMAP", Const, 0},
+		{"SYS_MSGCTL", Const, 0},
+		{"SYS_MSGGET", Const, 0},
+		{"SYS_MSGRCV", Const, 0},
+		{"SYS_MSGRCV_NOCANCEL", Const, 0},
+		{"SYS_MSGSND", Const, 0},
+		{"SYS_MSGSND_NOCANCEL", Const, 0},
+		{"SYS_MSGSYS", Const, 0},
+		{"SYS_MSYNC", Const, 0},
+		{"SYS_MSYNC_NOCANCEL", Const, 0},
+		{"SYS_MUNLOCK", Const, 0},
+		{"SYS_MUNLOCKALL", Const, 0},
+		{"SYS_MUNMAP", Const, 0},
+		{"SYS_NAME_TO_HANDLE_AT", Const, 0},
+		{"SYS_NANOSLEEP", Const, 0},
+		{"SYS_NEWFSTATAT", Const, 0},
+		{"SYS_NFSCLNT", Const, 0},
+		{"SYS_NFSSERVCTL", Const, 0},
+		{"SYS_NFSSVC", Const, 0},
+		{"SYS_NFSTAT", Const, 0},
+		{"SYS_NICE", Const, 0},
+		{"SYS_NLM_SYSCALL", Const, 14},
+		{"SYS_NLSTAT", Const, 0},
+		{"SYS_NMOUNT", Const, 0},
+		{"SYS_NSTAT", Const, 0},
+		{"SYS_NTP_ADJTIME", Const, 0},
+		{"SYS_NTP_GETTIME", Const, 0},
+		{"SYS_NUMA_GETAFFINITY", Const, 14},
+		{"SYS_NUMA_SETAFFINITY", Const, 14},
+		{"SYS_OABI_SYSCALL_BASE", Const, 0},
+		{"SYS_OBREAK", Const, 0},
+		{"SYS_OLDFSTAT", Const, 0},
+		{"SYS_OLDLSTAT", Const, 0},
+		{"SYS_OLDOLDUNAME", Const, 0},
+		{"SYS_OLDSTAT", Const, 0},
+		{"SYS_OLDUNAME", Const, 0},
+		{"SYS_OPEN", Const, 0},
+		{"SYS_OPENAT", Const, 0},
+		{"SYS_OPENBSD_POLL", Const, 0},
+		{"SYS_OPEN_BY_HANDLE_AT", Const, 0},
+		{"SYS_OPEN_DPROTECTED_NP", Const, 16},
+		{"SYS_OPEN_EXTENDED", Const, 0},
+		{"SYS_OPEN_NOCANCEL", Const, 0},
+		{"SYS_OVADVISE", Const, 0},
+		{"SYS_PACCEPT", Const, 1},
+		{"SYS_PATHCONF", Const, 0},
+		{"SYS_PAUSE", Const, 0},
+		{"SYS_PCICONFIG_IOBASE", Const, 0},
+		{"SYS_PCICONFIG_READ", Const, 0},
+		{"SYS_PCICONFIG_WRITE", Const, 0},
+		{"SYS_PDFORK", Const, 0},
+		{"SYS_PDGETPID", Const, 0},
+		{"SYS_PDKILL", Const, 0},
+		{"SYS_PERF_EVENT_OPEN", Const, 0},
+		{"SYS_PERSONALITY", Const, 0},
+		{"SYS_PID_HIBERNATE", Const, 0},
+		{"SYS_PID_RESUME", Const, 0},
+		{"SYS_PID_SHUTDOWN_SOCKETS", Const, 0},
+		{"SYS_PID_SUSPEND", Const, 0},
+		{"SYS_PIPE", Const, 0},
+		{"SYS_PIPE2", Const, 0},
+		{"SYS_PIVOT_ROOT", Const, 0},
+		{"SYS_PMC_CONTROL", Const, 1},
+		{"SYS_PMC_GET_INFO", Const, 1},
+		{"SYS_POLL", Const, 0},
+		{"SYS_POLLTS", Const, 1},
+		{"SYS_POLL_NOCANCEL", Const, 0},
+		{"SYS_POSIX_FADVISE", Const, 0},
+		{"SYS_POSIX_FALLOCATE", Const, 0},
+		{"SYS_POSIX_OPENPT", Const, 0},
+		{"SYS_POSIX_SPAWN", Const, 0},
+		{"SYS_PPOLL", Const, 0},
+		{"SYS_PRCTL", Const, 0},
+		{"SYS_PREAD", Const, 0},
+		{"SYS_PREAD64", Const, 0},
+		{"SYS_PREADV", Const, 0},
+		{"SYS_PREAD_NOCANCEL", Const, 0},
+		{"SYS_PRLIMIT64", Const, 0},
+		{"SYS_PROCCTL", Const, 3},
+		{"SYS_PROCESS_POLICY", Const, 0},
+		{"SYS_PROCESS_VM_READV", Const, 0},
+		{"SYS_PROCESS_VM_WRITEV", Const, 0},
+		{"SYS_PROC_INFO", Const, 0},
+		{"SYS_PROF", Const, 0},
+		{"SYS_PROFIL", Const, 0},
+		{"SYS_PSELECT", Const, 0},
+		{"SYS_PSELECT6", Const, 0},
+		{"SYS_PSET_ASSIGN", Const, 1},
+		{"SYS_PSET_CREATE", Const, 1},
+		{"SYS_PSET_DESTROY", Const, 1},
+		{"SYS_PSYNCH_CVBROAD", Const, 0},
+		{"SYS_PSYNCH_CVCLRPREPOST", Const, 0},
+		{"SYS_PSYNCH_CVSIGNAL", Const, 0},
+		{"SYS_PSYNCH_CVWAIT", Const, 0},
+		{"SYS_PSYNCH_MUTEXDROP", Const, 0},
+		{"SYS_PSYNCH_MUTEXWAIT", Const, 0},
+		{"SYS_PSYNCH_RW_DOWNGRADE", Const, 0},
+		{"SYS_PSYNCH_RW_LONGRDLOCK", Const, 0},
+		{"SYS_PSYNCH_RW_RDLOCK", Const, 0},
+		{"SYS_PSYNCH_RW_UNLOCK", Const, 0},
+		{"SYS_PSYNCH_RW_UNLOCK2", Const, 0},
+		{"SYS_PSYNCH_RW_UPGRADE", Const, 0},
+		{"SYS_PSYNCH_RW_WRLOCK", Const, 0},
+		{"SYS_PSYNCH_RW_YIELDWRLOCK", Const, 0},
+		{"SYS_PTRACE", Const, 0},
+		{"SYS_PUTPMSG", Const, 0},
+		{"SYS_PWRITE", Const, 0},
+		{"SYS_PWRITE64", Const, 0},
+		{"SYS_PWRITEV", Const, 0},
+		{"SYS_PWRITE_NOCANCEL", Const, 0},
+		{"SYS_QUERY_MODULE", Const, 0},
+		{"SYS_QUOTACTL", Const, 0},
+		{"SYS_RASCTL", Const, 1},
+		{"SYS_RCTL_ADD_RULE", Const, 0},
+		{"SYS_RCTL_GET_LIMITS", Const, 0},
+		{"SYS_RCTL_GET_RACCT", Const, 0},
+		{"SYS_RCTL_GET_RULES", Const, 0},
+		{"SYS_RCTL_REMOVE_RULE", Const, 0},
+		{"SYS_READ", Const, 0},
+		{"SYS_READAHEAD", Const, 0},
+		{"SYS_READDIR", Const, 0},
+		{"SYS_READLINK", Const, 0},
+		{"SYS_READLINKAT", Const, 0},
+		{"SYS_READV", Const, 0},
+		{"SYS_READV_NOCANCEL", Const, 0},
+		{"SYS_READ_NOCANCEL", Const, 0},
+		{"SYS_REBOOT", Const, 0},
+		{"SYS_RECV", Const, 0},
+		{"SYS_RECVFROM", Const, 0},
+		{"SYS_RECVFROM_NOCANCEL", Const, 0},
+		{"SYS_RECVMMSG", Const, 0},
+		{"SYS_RECVMSG", Const, 0},
+		{"SYS_RECVMSG_NOCANCEL", Const, 0},
+		{"SYS_REMAP_FILE_PAGES", Const, 0},
+		{"SYS_REMOVEXATTR", Const, 0},
+		{"SYS_RENAME", Const, 0},
+		{"SYS_RENAMEAT", Const, 0},
+		{"SYS_REQUEST_KEY", Const, 0},
+		{"SYS_RESTART_SYSCALL", Const, 0},
+		{"SYS_REVOKE", Const, 0},
+		{"SYS_RFORK", Const, 0},
+		{"SYS_RMDIR", Const, 0},
+		{"SYS_RTPRIO", Const, 0},
+		{"SYS_RTPRIO_THREAD", Const, 0},
+		{"SYS_RT_SIGACTION", Const, 0},
+		{"SYS_RT_SIGPENDING", Const, 0},
+		{"SYS_RT_SIGPROCMASK", Const, 0},
+		{"SYS_RT_SIGQUEUEINFO", Const, 0},
+		{"SYS_RT_SIGRETURN", Const, 0},
+		{"SYS_RT_SIGSUSPEND", Const, 0},
+		{"SYS_RT_SIGTIMEDWAIT", Const, 0},
+		{"SYS_RT_TGSIGQUEUEINFO", Const, 0},
+		{"SYS_SBRK", Const, 0},
+		{"SYS_SCHED_GETAFFINITY", Const, 0},
+		{"SYS_SCHED_GETPARAM", Const, 0},
+		{"SYS_SCHED_GETSCHEDULER", Const, 0},
+		{"SYS_SCHED_GET_PRIORITY_MAX", Const, 0},
+		{"SYS_SCHED_GET_PRIORITY_MIN", Const, 0},
+		{"SYS_SCHED_RR_GET_INTERVAL", Const, 0},
+		{"SYS_SCHED_SETAFFINITY", Const, 0},
+		{"SYS_SCHED_SETPARAM", Const, 0},
+		{"SYS_SCHED_SETSCHEDULER", Const, 0},
+		{"SYS_SCHED_YIELD", Const, 0},
+		{"SYS_SCTP_GENERIC_RECVMSG", Const, 0},
+		{"SYS_SCTP_GENERIC_SENDMSG", Const, 0},
+		{"SYS_SCTP_GENERIC_SENDMSG_IOV", Const, 0},
+		{"SYS_SCTP_PEELOFF", Const, 0},
+		{"SYS_SEARCHFS", Const, 0},
+		{"SYS_SECURITY", Const, 0},
+		{"SYS_SELECT", Const, 0},
+		{"SYS_SELECT_NOCANCEL", Const, 0},
+		{"SYS_SEMCONFIG", Const, 1},
+		{"SYS_SEMCTL", Const, 0},
+		{"SYS_SEMGET", Const, 0},
+		{"SYS_SEMOP", Const, 0},
+		{"SYS_SEMSYS", Const, 0},
+		{"SYS_SEMTIMEDOP", Const, 0},
+		{"SYS_SEM_CLOSE", Const, 0},
+		{"SYS_SEM_DESTROY", Const, 0},
+		{"SYS_SEM_GETVALUE", Const, 0},
+		{"SYS_SEM_INIT", Const, 0},
+		{"SYS_SEM_OPEN", Const, 0},
+		{"SYS_SEM_POST", Const, 0},
+		{"SYS_SEM_TRYWAIT", Const, 0},
+		{"SYS_SEM_UNLINK", Const, 0},
+		{"SYS_SEM_WAIT", Const, 0},
+		{"SYS_SEM_WAIT_NOCANCEL", Const, 0},
+		{"SYS_SEND", Const, 0},
+		{"SYS_SENDFILE", Const, 0},
+		{"SYS_SENDFILE64", Const, 0},
+		{"SYS_SENDMMSG", Const, 0},
+		{"SYS_SENDMSG", Const, 0},
+		{"SYS_SENDMSG_NOCANCEL", Const, 0},
+		{"SYS_SENDTO", Const, 0},
+		{"SYS_SENDTO_NOCANCEL", Const, 0},
+		{"SYS_SETATTRLIST", Const, 0},
+		{"SYS_SETAUDIT", Const, 0},
+		{"SYS_SETAUDIT_ADDR", Const, 0},
+		{"SYS_SETAUID", Const, 0},
+		{"SYS_SETCONTEXT", Const, 0},
+		{"SYS_SETDOMAINNAME", Const, 0},
+		{"SYS_SETEGID", Const, 0},
+		{"SYS_SETEUID", Const, 0},
+		{"SYS_SETFIB", Const, 0},
+		{"SYS_SETFSGID", Const, 0},
+		{"SYS_SETFSGID32", Const, 0},
+		{"SYS_SETFSUID", Const, 0},
+		{"SYS_SETFSUID32", Const, 0},
+		{"SYS_SETGID", Const, 0},
+		{"SYS_SETGID32", Const, 0},
+		{"SYS_SETGROUPS", Const, 0},
+		{"SYS_SETGROUPS32", Const, 0},
+		{"SYS_SETHOSTNAME", Const, 0},
+		{"SYS_SETITIMER", Const, 0},
+		{"SYS_SETLCID", Const, 0},
+		{"SYS_SETLOGIN", Const, 0},
+		{"SYS_SETLOGINCLASS", Const, 0},
+		{"SYS_SETNS", Const, 0},
+		{"SYS_SETPGID", Const, 0},
+		{"SYS_SETPRIORITY", Const, 0},
+		{"SYS_SETPRIVEXEC", Const, 0},
+		{"SYS_SETREGID", Const, 0},
+		{"SYS_SETREGID32", Const, 0},
+		{"SYS_SETRESGID", Const, 0},
+		{"SYS_SETRESGID32", Const, 0},
+		{"SYS_SETRESUID", Const, 0},
+		{"SYS_SETRESUID32", Const, 0},
+		{"SYS_SETREUID", Const, 0},
+		{"SYS_SETREUID32", Const, 0},
+		{"SYS_SETRLIMIT", Const, 0},
+		{"SYS_SETRTABLE", Const, 1},
+		{"SYS_SETSGROUPS", Const, 0},
+		{"SYS_SETSID", Const, 0},
+		{"SYS_SETSOCKOPT", Const, 0},
+		{"SYS_SETTID", Const, 0},
+		{"SYS_SETTID_WITH_PID", Const, 0},
+		{"SYS_SETTIMEOFDAY", Const, 0},
+		{"SYS_SETUID", Const, 0},
+		{"SYS_SETUID32", Const, 0},
+		{"SYS_SETWGROUPS", Const, 0},
+		{"SYS_SETXATTR", Const, 0},
+		{"SYS_SET_MEMPOLICY", Const, 0},
+		{"SYS_SET_ROBUST_LIST", Const, 0},
+		{"SYS_SET_THREAD_AREA", Const, 0},
+		{"SYS_SET_TID_ADDRESS", Const, 0},
+		{"SYS_SGETMASK", Const, 0},
+		{"SYS_SHARED_REGION_CHECK_NP", Const, 0},
+		{"SYS_SHARED_REGION_MAP_AND_SLIDE_NP", Const, 0},
+		{"SYS_SHMAT", Const, 0},
+		{"SYS_SHMCTL", Const, 0},
+		{"SYS_SHMDT", Const, 0},
+		{"SYS_SHMGET", Const, 0},
+		{"SYS_SHMSYS", Const, 0},
+		{"SYS_SHM_OPEN", Const, 0},
+		{"SYS_SHM_UNLINK", Const, 0},
+		{"SYS_SHUTDOWN", Const, 0},
+		{"SYS_SIGACTION", Const, 0},
+		{"SYS_SIGALTSTACK", Const, 0},
+		{"SYS_SIGNAL", Const, 0},
+		{"SYS_SIGNALFD", Const, 0},
+		{"SYS_SIGNALFD4", Const, 0},
+		{"SYS_SIGPENDING", Const, 0},
+		{"SYS_SIGPROCMASK", Const, 0},
+		{"SYS_SIGQUEUE", Const, 0},
+		{"SYS_SIGQUEUEINFO", Const, 1},
+		{"SYS_SIGRETURN", Const, 0},
+		{"SYS_SIGSUSPEND", Const, 0},
+		{"SYS_SIGSUSPEND_NOCANCEL", Const, 0},
+		{"SYS_SIGTIMEDWAIT", Const, 0},
+		{"SYS_SIGWAIT", Const, 0},
+		{"SYS_SIGWAITINFO", Const, 0},
+		{"SYS_SOCKET", Const, 0},
+		{"SYS_SOCKETCALL", Const, 0},
+		{"SYS_SOCKETPAIR", Const, 0},
+		{"SYS_SPLICE", Const, 0},
+		{"SYS_SSETMASK", Const, 0},
+		{"SYS_SSTK", Const, 0},
+		{"SYS_STACK_SNAPSHOT", Const, 0},
+		{"SYS_STAT", Const, 0},
+		{"SYS_STAT64", Const, 0},
+		{"SYS_STAT64_EXTENDED", Const, 0},
+		{"SYS_STATFS", Const, 0},
+		{"SYS_STATFS64", Const, 0},
+		{"SYS_STATV", Const, 0},
+		{"SYS_STATVFS1", Const, 1},
+		{"SYS_STAT_EXTENDED", Const, 0},
+		{"SYS_STIME", Const, 0},
+		{"SYS_STTY", Const, 0},
+		{"SYS_SWAPCONTEXT", Const, 0},
+		{"SYS_SWAPCTL", Const, 1},
+		{"SYS_SWAPOFF", Const, 0},
+		{"SYS_SWAPON", Const, 0},
+		{"SYS_SYMLINK", Const, 0},
+		{"SYS_SYMLINKAT", Const, 0},
+		{"SYS_SYNC", Const, 0},
+		{"SYS_SYNCFS", Const, 0},
+		{"SYS_SYNC_FILE_RANGE", Const, 0},
+		{"SYS_SYSARCH", Const, 0},
+		{"SYS_SYSCALL", Const, 0},
+		{"SYS_SYSCALL_BASE", Const, 0},
+		{"SYS_SYSFS", Const, 0},
+		{"SYS_SYSINFO", Const, 0},
+		{"SYS_SYSLOG", Const, 0},
+		{"SYS_TEE", Const, 0},
+		{"SYS_TGKILL", Const, 0},
+		{"SYS_THREAD_SELFID", Const, 0},
+		{"SYS_THR_CREATE", Const, 0},
+		{"SYS_THR_EXIT", Const, 0},
+		{"SYS_THR_KILL", Const, 0},
+		{"SYS_THR_KILL2", Const, 0},
+		{"SYS_THR_NEW", Const, 0},
+		{"SYS_THR_SELF", Const, 0},
+		{"SYS_THR_SET_NAME", Const, 0},
+		{"SYS_THR_SUSPEND", Const, 0},
+		{"SYS_THR_WAKE", Const, 0},
+		{"SYS_TIME", Const, 0},
+		{"SYS_TIMERFD_CREATE", Const, 0},
+		{"SYS_TIMERFD_GETTIME", Const, 0},
+		{"SYS_TIMERFD_SETTIME", Const, 0},
+		{"SYS_TIMER_CREATE", Const, 0},
+		{"SYS_TIMER_DELETE", Const, 0},
+		{"SYS_TIMER_GETOVERRUN", Const, 0},
+		{"SYS_TIMER_GETTIME", Const, 0},
+		{"SYS_TIMER_SETTIME", Const, 0},
+		{"SYS_TIMES", Const, 0},
+		{"SYS_TKILL", Const, 0},
+		{"SYS_TRUNCATE", Const, 0},
+		{"SYS_TRUNCATE64", Const, 0},
+		{"SYS_TUXCALL", Const, 0},
+		{"SYS_UGETRLIMIT", Const, 0},
+		{"SYS_ULIMIT", Const, 0},
+		{"SYS_UMASK", Const, 0},
+		{"SYS_UMASK_EXTENDED", Const, 0},
+		{"SYS_UMOUNT", Const, 0},
+		{"SYS_UMOUNT2", Const, 0},
+		{"SYS_UNAME", Const, 0},
+		{"SYS_UNDELETE", Const, 0},
+		{"SYS_UNLINK", Const, 0},
+		{"SYS_UNLINKAT", Const, 0},
+		{"SYS_UNMOUNT", Const, 0},
+		{"SYS_UNSHARE", Const, 0},
+		{"SYS_USELIB", Const, 0},
+		{"SYS_USTAT", Const, 0},
+		{"SYS_UTIME", Const, 0},
+		{"SYS_UTIMENSAT", Const, 0},
+		{"SYS_UTIMES", Const, 0},
+		{"SYS_UTRACE", Const, 0},
+		{"SYS_UUIDGEN", Const, 0},
+		{"SYS_VADVISE", Const, 1},
+		{"SYS_VFORK", Const, 0},
+		{"SYS_VHANGUP", Const, 0},
+		{"SYS_VM86", Const, 0},
+		{"SYS_VM86OLD", Const, 0},
+		{"SYS_VMSPLICE", Const, 0},
+		{"SYS_VM_PRESSURE_MONITOR", Const, 0},
+		{"SYS_VSERVER", Const, 0},
+		{"SYS_WAIT4", Const, 0},
+		{"SYS_WAIT4_NOCANCEL", Const, 0},
+		{"SYS_WAIT6", Const, 1},
+		{"SYS_WAITEVENT", Const, 0},
+		{"SYS_WAITID", Const, 0},
+		{"SYS_WAITID_NOCANCEL", Const, 0},
+		{"SYS_WAITPID", Const, 0},
+		{"SYS_WATCHEVENT", Const, 0},
+		{"SYS_WORKQ_KERNRETURN", Const, 0},
+		{"SYS_WORKQ_OPEN", Const, 0},
+		{"SYS_WRITE", Const, 0},
+		{"SYS_WRITEV", Const, 0},
+		{"SYS_WRITEV_NOCANCEL", Const, 0},
+		{"SYS_WRITE_NOCANCEL", Const, 0},
+		{"SYS_YIELD", Const, 0},
+		{"SYS__LLSEEK", Const, 0},
+		{"SYS__LWP_CONTINUE", Const, 1},
+		{"SYS__LWP_CREATE", Const, 1},
+		{"SYS__LWP_CTL", Const, 1},
+		{"SYS__LWP_DETACH", Const, 1},
+		{"SYS__LWP_EXIT", Const, 1},
+		{"SYS__LWP_GETNAME", Const, 1},
+		{"SYS__LWP_GETPRIVATE", Const, 1},
+		{"SYS__LWP_KILL", Const, 1},
+		{"SYS__LWP_PARK", Const, 1},
+		{"SYS__LWP_SELF", Const, 1},
+		{"SYS__LWP_SETNAME", Const, 1},
+		{"SYS__LWP_SETPRIVATE", Const, 1},
+		{"SYS__LWP_SUSPEND", Const, 1},
+		{"SYS__LWP_UNPARK", Const, 1},
+		{"SYS__LWP_UNPARK_ALL", Const, 1},
+		{"SYS__LWP_WAIT", Const, 1},
+		{"SYS__LWP_WAKEUP", Const, 1},
+		{"SYS__NEWSELECT", Const, 0},
+		{"SYS__PSET_BIND", Const, 1},
+		{"SYS__SCHED_GETAFFINITY", Const, 1},
+		{"SYS__SCHED_GETPARAM", Const, 1},
+		{"SYS__SCHED_SETAFFINITY", Const, 1},
+		{"SYS__SCHED_SETPARAM", Const, 1},
+		{"SYS__SYSCTL", Const, 0},
+		{"SYS__UMTX_LOCK", Const, 0},
+		{"SYS__UMTX_OP", Const, 0},
+		{"SYS__UMTX_UNLOCK", Const, 0},
+		{"SYS___ACL_ACLCHECK_FD", Const, 0},
+		{"SYS___ACL_ACLCHECK_FILE", Const, 0},
+		{"SYS___ACL_ACLCHECK_LINK", Const, 0},
+		{"SYS___ACL_DELETE_FD", Const, 0},
+		{"SYS___ACL_DELETE_FILE", Const, 0},
+		{"SYS___ACL_DELETE_LINK", Const, 0},
+		{"SYS___ACL_GET_FD", Const, 0},
+		{"SYS___ACL_GET_FILE", Const, 0},
+		{"SYS___ACL_GET_LINK", Const, 0},
+		{"SYS___ACL_SET_FD", Const, 0},
+		{"SYS___ACL_SET_FILE", Const, 0},
+		{"SYS___ACL_SET_LINK", Const, 0},
+		{"SYS___CAP_RIGHTS_GET", Const, 14},
+		{"SYS___CLONE", Const, 1},
+		{"SYS___DISABLE_THREADSIGNAL", Const, 0},
+		{"SYS___GETCWD", Const, 0},
+		{"SYS___GETLOGIN", Const, 1},
+		{"SYS___GET_TCB", Const, 1},
+		{"SYS___MAC_EXECVE", Const, 0},
+		{"SYS___MAC_GETFSSTAT", Const, 0},
+		{"SYS___MAC_GET_FD", Const, 0},
+		{"SYS___MAC_GET_FILE", Const, 0},
+		{"SYS___MAC_GET_LCID", Const, 0},
+		{"SYS___MAC_GET_LCTX", Const, 0},
+		{"SYS___MAC_GET_LINK", Const, 0},
+		{"SYS___MAC_GET_MOUNT", Const, 0},
+		{"SYS___MAC_GET_PID", Const, 0},
+		{"SYS___MAC_GET_PROC", Const, 0},
+		{"SYS___MAC_MOUNT", Const, 0},
+		{"SYS___MAC_SET_FD", Const, 0},
+		{"SYS___MAC_SET_FILE", Const, 0},
+		{"SYS___MAC_SET_LCTX", Const, 0},
+		{"SYS___MAC_SET_LINK", Const, 0},
+		{"SYS___MAC_SET_PROC", Const, 0},
+		{"SYS___MAC_SYSCALL", Const, 0},
+		{"SYS___OLD_SEMWAIT_SIGNAL", Const, 0},
+		{"SYS___OLD_SEMWAIT_SIGNAL_NOCANCEL", Const, 0},
+		{"SYS___POSIX_CHOWN", Const, 1},
+		{"SYS___POSIX_FCHOWN", Const, 1},
+		{"SYS___POSIX_LCHOWN", Const, 1},
+		{"SYS___POSIX_RENAME", Const, 1},
+		{"SYS___PTHREAD_CANCELED", Const, 0},
+		{"SYS___PTHREAD_CHDIR", Const, 0},
+		{"SYS___PTHREAD_FCHDIR", Const, 0},
+		{"SYS___PTHREAD_KILL", Const, 0},
+		{"SYS___PTHREAD_MARKCANCEL", Const, 0},
+		{"SYS___PTHREAD_SIGMASK", Const, 0},
+		{"SYS___QUOTACTL", Const, 1},
+		{"SYS___SEMCTL", Const, 1},
+		{"SYS___SEMWAIT_SIGNAL", Const, 0},
+		{"SYS___SEMWAIT_SIGNAL_NOCANCEL", Const, 0},
+		{"SYS___SETLOGIN", Const, 1},
+		{"SYS___SETUGID", Const, 0},
+		{"SYS___SET_TCB", Const, 1},
+		{"SYS___SIGACTION_SIGTRAMP", Const, 1},
+		{"SYS___SIGTIMEDWAIT", Const, 1},
+		{"SYS___SIGWAIT", Const, 0},
+		{"SYS___SIGWAIT_NOCANCEL", Const, 0},
+		{"SYS___SYSCTL", Const, 0},
+		{"SYS___TFORK", Const, 1},
+		{"SYS___THREXIT", Const, 1},
+		{"SYS___THRSIGDIVERT", Const, 1},
+		{"SYS___THRSLEEP", Const, 1},
+		{"SYS___THRWAKEUP", Const, 1},
+		{"S_ARCH1", Const, 1},
+		{"S_ARCH2", Const, 1},
+		{"S_BLKSIZE", Const, 0},
+		{"S_IEXEC", Const, 0},
+		{"S_IFBLK", Const, 0},
+		{"S_IFCHR", Const, 0},
+		{"S_IFDIR", Const, 0},
+		{"S_IFIFO", Const, 0},
+		{"S_IFLNK", Const, 0},
+		{"S_IFMT", Const, 0},
+		{"S_IFREG", Const, 0},
+		{"S_IFSOCK", Const, 0},
+		{"S_IFWHT", Const, 0},
+		{"S_IREAD", Const, 0},
+		{"S_IRGRP", Const, 0},
+		{"S_IROTH", Const, 0},
+		{"S_IRUSR", Const, 0},
+		{"S_IRWXG", Const, 0},
+		{"S_IRWXO", Const, 0},
+		{"S_IRWXU", Const, 0},
+		{"S_ISGID", Const, 0},
+		{"S_ISTXT", Const, 0},
+		{"S_ISUID", Const, 0},
+		{"S_ISVTX", Const, 0},
+		{"S_IWGRP", Const, 0},
+		{"S_IWOTH", Const, 0},
+		{"S_IWRITE", Const, 0},
+		{"S_IWUSR", Const, 0},
+		{"S_IXGRP", Const, 0},
+		{"S_IXOTH", Const, 0},
+		{"S_IXUSR", Const, 0},
+		{"S_LOGIN_SET", Const, 1},
+		{"SecurityAttributes", Type, 0},
+		{"SecurityAttributes.InheritHandle", Field, 0},
+		{"SecurityAttributes.Length", Field, 0},
+		{"SecurityAttributes.SecurityDescriptor", Field, 0},
+		{"Seek", Func, 0},
+		{"Select", Func, 0},
+		{"Sendfile", Func, 0},
+		{"Sendmsg", Func, 0},
+		{"SendmsgN", Func, 3},
+		{"Sendto", Func, 0},
+		{"Servent", Type, 0},
+		{"Servent.Aliases", Field, 0},
+		{"Servent.Name", Field, 0},
+		{"Servent.Port", Field, 0},
+		{"Servent.Proto", Field, 0},
+		{"SetBpf", Func, 0},
+		{"SetBpfBuflen", Func, 0},
+		{"SetBpfDatalink", Func, 0},
+		{"SetBpfHeadercmpl", Func, 0},
+		{"SetBpfImmediate", Func, 0},
+		{"SetBpfInterface", Func, 0},
+		{"SetBpfPromisc", Func, 0},
+		{"SetBpfTimeout", Func, 0},
+		{"SetCurrentDirectory", Func, 0},
+		{"SetEndOfFile", Func, 0},
+		{"SetEnvironmentVariable", Func, 0},
+		{"SetFileAttributes", Func, 0},
+		{"SetFileCompletionNotificationModes", Func, 2},
+		{"SetFilePointer", Func, 0},
+		{"SetFileTime", Func, 0},
+		{"SetHandleInformation", Func, 0},
+		{"SetKevent", Func, 0},
+		{"SetLsfPromisc", Func, 0},
+		{"SetNonblock", Func, 0},
+		{"Setdomainname", Func, 0},
+		{"Setegid", Func, 0},
+		{"Setenv", Func, 0},
+		{"Seteuid", Func, 0},
+		{"Setfsgid", Func, 0},
+		{"Setfsuid", Func, 0},
+		{"Setgid", Func, 0},
+		{"Setgroups", Func, 0},
+		{"Sethostname", Func, 0},
+		{"Setlogin", Func, 0},
+		{"Setpgid", Func, 0},
+		{"Setpriority", Func, 0},
+		{"Setprivexec", Func, 0},
+		{"Setregid", Func, 0},
+		{"Setresgid", Func, 0},
+		{"Setresuid", Func, 0},
+		{"Setreuid", Func, 0},
+		{"Setrlimit", Func, 0},
+		{"Setsid", Func, 0},
+		{"Setsockopt", Func, 0},
+		{"SetsockoptByte", Func, 0},
+		{"SetsockoptICMPv6Filter", Func, 2},
+		{"SetsockoptIPMreq", Func, 0},
+		{"SetsockoptIPMreqn", Func, 0},
+		{"SetsockoptIPv6Mreq", Func, 0},
+		{"SetsockoptInet4Addr", Func, 0},
+		{"SetsockoptInt", Func, 0},
+		{"SetsockoptLinger", Func, 0},
+		{"SetsockoptString", Func, 0},
+		{"SetsockoptTimeval", Func, 0},
+		{"Settimeofday", Func, 0},
+		{"Setuid", Func, 0},
+		{"Setxattr", Func, 1},
+		{"Shutdown", Func, 0},
+		{"SidTypeAlias", Const, 0},
+		{"SidTypeComputer", Const, 0},
+		{"SidTypeDeletedAccount", Const, 0},
+		{"SidTypeDomain", Const, 0},
+		{"SidTypeGroup", Const, 0},
+		{"SidTypeInvalid", Const, 0},
+		{"SidTypeLabel", Const, 0},
+		{"SidTypeUnknown", Const, 0},
+		{"SidTypeUser", Const, 0},
+		{"SidTypeWellKnownGroup", Const, 0},
+		{"Signal", Type, 0},
+		{"SizeofBpfHdr", Const, 0},
+		{"SizeofBpfInsn", Const, 0},
+		{"SizeofBpfProgram", Const, 0},
+		{"SizeofBpfStat", Const, 0},
+		{"SizeofBpfVersion", Const, 0},
+		{"SizeofBpfZbuf", Const, 0},
+		{"SizeofBpfZbufHeader", Const, 0},
+		{"SizeofCmsghdr", Const, 0},
+		{"SizeofICMPv6Filter", Const, 2},
+		{"SizeofIPMreq", Const, 0},
+		{"SizeofIPMreqn", Const, 0},
+		{"SizeofIPv6MTUInfo", Const, 2},
+		{"SizeofIPv6Mreq", Const, 0},
+		{"SizeofIfAddrmsg", Const, 0},
+		{"SizeofIfAnnounceMsghdr", Const, 1},
+		{"SizeofIfData", Const, 0},
+		{"SizeofIfInfomsg", Const, 0},
+		{"SizeofIfMsghdr", Const, 0},
+		{"SizeofIfaMsghdr", Const, 0},
+		{"SizeofIfmaMsghdr", Const, 0},
+		{"SizeofIfmaMsghdr2", Const, 0},
+		{"SizeofInet4Pktinfo", Const, 0},
+		{"SizeofInet6Pktinfo", Const, 0},
+		{"SizeofInotifyEvent", Const, 0},
+		{"SizeofLinger", Const, 0},
+		{"SizeofMsghdr", Const, 0},
+		{"SizeofNlAttr", Const, 0},
+		{"SizeofNlMsgerr", Const, 0},
+		{"SizeofNlMsghdr", Const, 0},
+		{"SizeofRtAttr", Const, 0},
+		{"SizeofRtGenmsg", Const, 0},
+		{"SizeofRtMetrics", Const, 0},
+		{"SizeofRtMsg", Const, 0},
+		{"SizeofRtMsghdr", Const, 0},
+		{"SizeofRtNexthop", Const, 0},
+		{"SizeofSockFilter", Const, 0},
+		{"SizeofSockFprog", Const, 0},
+		{"SizeofSockaddrAny", Const, 0},
+		{"SizeofSockaddrDatalink", Const, 0},
+		{"SizeofSockaddrInet4", Const, 0},
+		{"SizeofSockaddrInet6", Const, 0},
+		{"SizeofSockaddrLinklayer", Const, 0},
+		{"SizeofSockaddrNetlink", Const, 0},
+		{"SizeofSockaddrUnix", Const, 0},
+		{"SizeofTCPInfo", Const, 1},
+		{"SizeofUcred", Const, 0},
+		{"SlicePtrFromStrings", Func, 1},
+		{"SockFilter", Type, 0},
+		{"SockFilter.Code", Field, 0},
+		{"SockFilter.Jf", Field, 0},
+		{"SockFilter.Jt", Field, 0},
+		{"SockFilter.K", Field, 0},
+		{"SockFprog", Type, 0},
+		{"SockFprog.Filter", Field, 0},
+		{"SockFprog.Len", Field, 0},
+		{"SockFprog.Pad_cgo_0", Field, 0},
+		{"Sockaddr", Type, 0},
+		{"SockaddrDatalink", Type, 0},
+		{"SockaddrDatalink.Alen", Field, 0},
+		{"SockaddrDatalink.Data", Field, 0},
+		{"SockaddrDatalink.Family", Field, 0},
+		{"SockaddrDatalink.Index", Field, 0},
+		{"SockaddrDatalink.Len", Field, 0},
+		{"SockaddrDatalink.Nlen", Field, 0},
+		{"SockaddrDatalink.Slen", Field, 0},
+		{"SockaddrDatalink.Type", Field, 0},
+		{"SockaddrGen", Type, 0},
+		{"SockaddrInet4", Type, 0},
+		{"SockaddrInet4.Addr", Field, 0},
+		{"SockaddrInet4.Port", Field, 0},
+		{"SockaddrInet6", Type, 0},
+		{"SockaddrInet6.Addr", Field, 0},
+		{"SockaddrInet6.Port", Field, 0},
+		{"SockaddrInet6.ZoneId", Field, 0},
+		{"SockaddrLinklayer", Type, 0},
+		{"SockaddrLinklayer.Addr", Field, 0},
+		{"SockaddrLinklayer.Halen", Field, 0},
+		{"SockaddrLinklayer.Hatype", Field, 0},
+		{"SockaddrLinklayer.Ifindex", Field, 0},
+		{"SockaddrLinklayer.Pkttype", Field, 0},
+		{"SockaddrLinklayer.Protocol", Field, 0},
+		{"SockaddrNetlink", Type, 0},
+		{"SockaddrNetlink.Family", Field, 0},
+		{"SockaddrNetlink.Groups", Field, 0},
+		{"SockaddrNetlink.Pad", Field, 0},
+		{"SockaddrNetlink.Pid", Field, 0},
+		{"SockaddrUnix", Type, 0},
+		{"SockaddrUnix.Name", Field, 0},
+		{"Socket", Func, 0},
+		{"SocketControlMessage", Type, 0},
+		{"SocketControlMessage.Data", Field, 0},
+		{"SocketControlMessage.Header", Field, 0},
+		{"SocketDisableIPv6", Var, 0},
+		{"Socketpair", Func, 0},
+		{"Splice", Func, 0},
+		{"StartProcess", Func, 0},
+		{"StartupInfo", Type, 0},
+		{"StartupInfo.Cb", Field, 0},
+		{"StartupInfo.Desktop", Field, 0},
+		{"StartupInfo.FillAttribute", Field, 0},
+		{"StartupInfo.Flags", Field, 0},
+		{"StartupInfo.ShowWindow", Field, 0},
+		{"StartupInfo.StdErr", Field, 0},
+		{"StartupInfo.StdInput", Field, 0},
+		{"StartupInfo.StdOutput", Field, 0},
+		{"StartupInfo.Title", Field, 0},
+		{"StartupInfo.X", Field, 0},
+		{"StartupInfo.XCountChars", Field, 0},
+		{"StartupInfo.XSize", Field, 0},
+		{"StartupInfo.Y", Field, 0},
+		{"StartupInfo.YCountChars", Field, 0},
+		{"StartupInfo.YSize", Field, 0},
+		{"Stat", Func, 0},
+		{"Stat_t", Type, 0},
+		{"Stat_t.Atim", Field, 0},
+		{"Stat_t.Atim_ext", Field, 12},
+		{"Stat_t.Atimespec", Field, 0},
+		{"Stat_t.Birthtimespec", Field, 0},
+		{"Stat_t.Blksize", Field, 0},
+		{"Stat_t.Blocks", Field, 0},
+		{"Stat_t.Btim_ext", Field, 12},
+		{"Stat_t.Ctim", Field, 0},
+		{"Stat_t.Ctim_ext", Field, 12},
+		{"Stat_t.Ctimespec", Field, 0},
+		{"Stat_t.Dev", Field, 0},
+		{"Stat_t.Flags", Field, 0},
+		{"Stat_t.Gen", Field, 0},
+		{"Stat_t.Gid", Field, 0},
+		{"Stat_t.Ino", Field, 0},
+		{"Stat_t.Lspare", Field, 0},
+		{"Stat_t.Lspare0", Field, 2},
+		{"Stat_t.Lspare1", Field, 2},
+		{"Stat_t.Mode", Field, 0},
+		{"Stat_t.Mtim", Field, 0},
+		{"Stat_t.Mtim_ext", Field, 12},
+		{"Stat_t.Mtimespec", Field, 0},
+		{"Stat_t.Nlink", Field, 0},
+		{"Stat_t.Pad_cgo_0", Field, 0},
+		{"Stat_t.Pad_cgo_1", Field, 0},
+		{"Stat_t.Pad_cgo_2", Field, 0},
+		{"Stat_t.Padding0", Field, 12},
+		{"Stat_t.Padding1", Field, 12},
+		{"Stat_t.Qspare", Field, 0},
+		{"Stat_t.Rdev", Field, 0},
+		{"Stat_t.Size", Field, 0},
+		{"Stat_t.Spare", Field, 2},
+		{"Stat_t.Uid", Field, 0},
+		{"Stat_t.X__pad0", Field, 0},
+		{"Stat_t.X__pad1", Field, 0},
+		{"Stat_t.X__pad2", Field, 0},
+		{"Stat_t.X__st_birthtim", Field, 2},
+		{"Stat_t.X__st_ino", Field, 0},
+		{"Stat_t.X__unused", Field, 0},
+		{"Statfs", Func, 0},
+		{"Statfs_t", Type, 0},
+		{"Statfs_t.Asyncreads", Field, 0},
+		{"Statfs_t.Asyncwrites", Field, 0},
+		{"Statfs_t.Bavail", Field, 0},
+		{"Statfs_t.Bfree", Field, 0},
+		{"Statfs_t.Blocks", Field, 0},
+		{"Statfs_t.Bsize", Field, 0},
+		{"Statfs_t.Charspare", Field, 0},
+		{"Statfs_t.F_asyncreads", Field, 2},
+		{"Statfs_t.F_asyncwrites", Field, 2},
+		{"Statfs_t.F_bavail", Field, 2},
+		{"Statfs_t.F_bfree", Field, 2},
+		{"Statfs_t.F_blocks", Field, 2},
+		{"Statfs_t.F_bsize", Field, 2},
+		{"Statfs_t.F_ctime", Field, 2},
+		{"Statfs_t.F_favail", Field, 2},
+		{"Statfs_t.F_ffree", Field, 2},
+		{"Statfs_t.F_files", Field, 2},
+		{"Statfs_t.F_flags", Field, 2},
+		{"Statfs_t.F_fsid", Field, 2},
+		{"Statfs_t.F_fstypename", Field, 2},
+		{"Statfs_t.F_iosize", Field, 2},
+		{"Statfs_t.F_mntfromname", Field, 2},
+		{"Statfs_t.F_mntfromspec", Field, 3},
+		{"Statfs_t.F_mntonname", Field, 2},
+		{"Statfs_t.F_namemax", Field, 2},
+		{"Statfs_t.F_owner", Field, 2},
+		{"Statfs_t.F_spare", Field, 2},
+		{"Statfs_t.F_syncreads", Field, 2},
+		{"Statfs_t.F_syncwrites", Field, 2},
+		{"Statfs_t.Ffree", Field, 0},
+		{"Statfs_t.Files", Field, 0},
+		{"Statfs_t.Flags", Field, 0},
+		{"Statfs_t.Frsize", Field, 0},
+		{"Statfs_t.Fsid", Field, 0},
+		{"Statfs_t.Fssubtype", Field, 0},
+		{"Statfs_t.Fstypename", Field, 0},
+		{"Statfs_t.Iosize", Field, 0},
+		{"Statfs_t.Mntfromname", Field, 0},
+		{"Statfs_t.Mntonname", Field, 0},
+		{"Statfs_t.Mount_info", Field, 2},
+		{"Statfs_t.Namelen", Field, 0},
+		{"Statfs_t.Namemax", Field, 0},
+		{"Statfs_t.Owner", Field, 0},
+		{"Statfs_t.Pad_cgo_0", Field, 0},
+		{"Statfs_t.Pad_cgo_1", Field, 2},
+		{"Statfs_t.Reserved", Field, 0},
+		{"Statfs_t.Spare", Field, 0},
+		{"Statfs_t.Syncreads", Field, 0},
+		{"Statfs_t.Syncwrites", Field, 0},
+		{"Statfs_t.Type", Field, 0},
+		{"Statfs_t.Version", Field, 0},
+		{"Stderr", Var, 0},
+		{"Stdin", Var, 0},
+		{"Stdout", Var, 0},
+		{"StringBytePtr", Func, 0},
+		{"StringByteSlice", Func, 0},
+		{"StringSlicePtr", Func, 0},
+		{"StringToSid", Func, 0},
+		{"StringToUTF16", Func, 0},
+		{"StringToUTF16Ptr", Func, 0},
+		{"Symlink", Func, 0},
+		{"Sync", Func, 0},
+		{"SyncFileRange", Func, 0},
+		{"SysProcAttr", Type, 0},
+		{"SysProcAttr.AdditionalInheritedHandles", Field, 17},
+		{"SysProcAttr.AmbientCaps", Field, 9},
+		{"SysProcAttr.CgroupFD", Field, 20},
+		{"SysProcAttr.Chroot", Field, 0},
+		{"SysProcAttr.Cloneflags", Field, 2},
+		{"SysProcAttr.CmdLine", Field, 0},
+		{"SysProcAttr.CreationFlags", Field, 1},
+		{"SysProcAttr.Credential", Field, 0},
+		{"SysProcAttr.Ctty", Field, 1},
+		{"SysProcAttr.Foreground", Field, 5},
+		{"SysProcAttr.GidMappings", Field, 4},
+		{"SysProcAttr.GidMappingsEnableSetgroups", Field, 5},
+		{"SysProcAttr.HideWindow", Field, 0},
+		{"SysProcAttr.Jail", Field, 21},
+		{"SysProcAttr.NoInheritHandles", Field, 16},
+		{"SysProcAttr.Noctty", Field, 0},
+		{"SysProcAttr.ParentProcess", Field, 17},
+		{"SysProcAttr.Pdeathsig", Field, 0},
+		{"SysProcAttr.Pgid", Field, 5},
+		{"SysProcAttr.PidFD", Field, 22},
+		{"SysProcAttr.ProcessAttributes", Field, 13},
+		{"SysProcAttr.Ptrace", Field, 0},
+		{"SysProcAttr.Setctty", Field, 0},
+		{"SysProcAttr.Setpgid", Field, 0},
+		{"SysProcAttr.Setsid", Field, 0},
+		{"SysProcAttr.ThreadAttributes", Field, 13},
+		{"SysProcAttr.Token", Field, 10},
+		{"SysProcAttr.UidMappings", Field, 4},
+		{"SysProcAttr.Unshareflags", Field, 7},
+		{"SysProcAttr.UseCgroupFD", Field, 20},
+		{"SysProcIDMap", Type, 4},
+		{"SysProcIDMap.ContainerID", Field, 4},
+		{"SysProcIDMap.HostID", Field, 4},
+		{"SysProcIDMap.Size", Field, 4},
+		{"Syscall", Func, 0},
+		{"Syscall12", Func, 0},
+		{"Syscall15", Func, 0},
+		{"Syscall18", Func, 12},
+		{"Syscall6", Func, 0},
+		{"Syscall9", Func, 0},
+		{"SyscallN", Func, 18},
+		{"Sysctl", Func, 0},
+		{"SysctlUint32", Func, 0},
+		{"Sysctlnode", Type, 2},
+		{"Sysctlnode.Flags", Field, 2},
+		{"Sysctlnode.Name", Field, 2},
+		{"Sysctlnode.Num", Field, 2},
+		{"Sysctlnode.Un", Field, 2},
+		{"Sysctlnode.Ver", Field, 2},
+		{"Sysctlnode.X__rsvd", Field, 2},
+		{"Sysctlnode.X_sysctl_desc", Field, 2},
+		{"Sysctlnode.X_sysctl_func", Field, 2},
+		{"Sysctlnode.X_sysctl_parent", Field, 2},
+		{"Sysctlnode.X_sysctl_size", Field, 2},
+		{"Sysinfo", Func, 0},
+		{"Sysinfo_t", Type, 0},
+		{"Sysinfo_t.Bufferram", Field, 0},
+		{"Sysinfo_t.Freehigh", Field, 0},
+		{"Sysinfo_t.Freeram", Field, 0},
+		{"Sysinfo_t.Freeswap", Field, 0},
+		{"Sysinfo_t.Loads", Field, 0},
+		{"Sysinfo_t.Pad", Field, 0},
+		{"Sysinfo_t.Pad_cgo_0", Field, 0},
+		{"Sysinfo_t.Pad_cgo_1", Field, 0},
+		{"Sysinfo_t.Procs", Field, 0},
+		{"Sysinfo_t.Sharedram", Field, 0},
+		{"Sysinfo_t.Totalhigh", Field, 0},
+		{"Sysinfo_t.Totalram", Field, 0},
+		{"Sysinfo_t.Totalswap", Field, 0},
+		{"Sysinfo_t.Unit", Field, 0},
+		{"Sysinfo_t.Uptime", Field, 0},
+		{"Sysinfo_t.X_f", Field, 0},
+		{"Systemtime", Type, 0},
+		{"Systemtime.Day", Field, 0},
+		{"Systemtime.DayOfWeek", Field, 0},
+		{"Systemtime.Hour", Field, 0},
+		{"Systemtime.Milliseconds", Field, 0},
+		{"Systemtime.Minute", Field, 0},
+		{"Systemtime.Month", Field, 0},
+		{"Systemtime.Second", Field, 0},
+		{"Systemtime.Year", Field, 0},
+		{"TCGETS", Const, 0},
+		{"TCIFLUSH", Const, 1},
+		{"TCIOFLUSH", Const, 1},
+		{"TCOFLUSH", Const, 1},
+		{"TCPInfo", Type, 1},
+		{"TCPInfo.Advmss", Field, 1},
+		{"TCPInfo.Ato", Field, 1},
+		{"TCPInfo.Backoff", Field, 1},
+		{"TCPInfo.Ca_state", Field, 1},
+		{"TCPInfo.Fackets", Field, 1},
+		{"TCPInfo.Last_ack_recv", Field, 1},
+		{"TCPInfo.Last_ack_sent", Field, 1},
+		{"TCPInfo.Last_data_recv", Field, 1},
+		{"TCPInfo.Last_data_sent", Field, 1},
+		{"TCPInfo.Lost", Field, 1},
+		{"TCPInfo.Options", Field, 1},
+		{"TCPInfo.Pad_cgo_0", Field, 1},
+		{"TCPInfo.Pmtu", Field, 1},
+		{"TCPInfo.Probes", Field, 1},
+		{"TCPInfo.Rcv_mss", Field, 1},
+		{"TCPInfo.Rcv_rtt", Field, 1},
+		{"TCPInfo.Rcv_space", Field, 1},
+		{"TCPInfo.Rcv_ssthresh", Field, 1},
+		{"TCPInfo.Reordering", Field, 1},
+		{"TCPInfo.Retrans", Field, 1},
+		{"TCPInfo.Retransmits", Field, 1},
+		{"TCPInfo.Rto", Field, 1},
+		{"TCPInfo.Rtt", Field, 1},
+		{"TCPInfo.Rttvar", Field, 1},
+		{"TCPInfo.Sacked", Field, 1},
+		{"TCPInfo.Snd_cwnd", Field, 1},
+		{"TCPInfo.Snd_mss", Field, 1},
+		{"TCPInfo.Snd_ssthresh", Field, 1},
+		{"TCPInfo.State", Field, 1},
+		{"TCPInfo.Total_retrans", Field, 1},
+		{"TCPInfo.Unacked", Field, 1},
+		{"TCPKeepalive", Type, 3},
+		{"TCPKeepalive.Interval", Field, 3},
+		{"TCPKeepalive.OnOff", Field, 3},
+		{"TCPKeepalive.Time", Field, 3},
+		{"TCP_CA_NAME_MAX", Const, 0},
+		{"TCP_CONGCTL", Const, 1},
+		{"TCP_CONGESTION", Const, 0},
+		{"TCP_CONNECTIONTIMEOUT", Const, 0},
+		{"TCP_CORK", Const, 0},
+		{"TCP_DEFER_ACCEPT", Const, 0},
+		{"TCP_ENABLE_ECN", Const, 16},
+		{"TCP_INFO", Const, 0},
+		{"TCP_KEEPALIVE", Const, 0},
+		{"TCP_KEEPCNT", Const, 0},
+		{"TCP_KEEPIDLE", Const, 0},
+		{"TCP_KEEPINIT", Const, 1},
+		{"TCP_KEEPINTVL", Const, 0},
+		{"TCP_LINGER2", Const, 0},
+		{"TCP_MAXBURST", Const, 0},
+		{"TCP_MAXHLEN", Const, 0},
+		{"TCP_MAXOLEN", Const, 0},
+		{"TCP_MAXSEG", Const, 0},
+		{"TCP_MAXWIN", Const, 0},
+		{"TCP_MAX_SACK", Const, 0},
+		{"TCP_MAX_WINSHIFT", Const, 0},
+		{"TCP_MD5SIG", Const, 0},
+		{"TCP_MD5SIG_MAXKEYLEN", Const, 0},
+		{"TCP_MINMSS", Const, 0},
+		{"TCP_MINMSSOVERLOAD", Const, 0},
+		{"TCP_MSS", Const, 0},
+		{"TCP_NODELAY", Const, 0},
+		{"TCP_NOOPT", Const, 0},
+		{"TCP_NOPUSH", Const, 0},
+		{"TCP_NOTSENT_LOWAT", Const, 16},
+		{"TCP_NSTATES", Const, 1},
+		{"TCP_QUICKACK", Const, 0},
+		{"TCP_RXT_CONNDROPTIME", Const, 0},
+		{"TCP_RXT_FINDROP", Const, 0},
+		{"TCP_SACK_ENABLE", Const, 1},
+		{"TCP_SENDMOREACKS", Const, 16},
+		{"TCP_SYNCNT", Const, 0},
+		{"TCP_VENDOR", Const, 3},
+		{"TCP_WINDOW_CLAMP", Const, 0},
+		{"TCSAFLUSH", Const, 1},
+		{"TCSETS", Const, 0},
+		{"TF_DISCONNECT", Const, 0},
+		{"TF_REUSE_SOCKET", Const, 0},
+		{"TF_USE_DEFAULT_WORKER", Const, 0},
+		{"TF_USE_KERNEL_APC", Const, 0},
+		{"TF_USE_SYSTEM_THREAD", Const, 0},
+		{"TF_WRITE_BEHIND", Const, 0},
+		{"TH32CS_INHERIT", Const, 4},
+		{"TH32CS_SNAPALL", Const, 4},
+		{"TH32CS_SNAPHEAPLIST", Const, 4},
+		{"TH32CS_SNAPMODULE", Const, 4},
+		{"TH32CS_SNAPMODULE32", Const, 4},
+		{"TH32CS_SNAPPROCESS", Const, 4},
+		{"TH32CS_SNAPTHREAD", Const, 4},
+		{"TIME_ZONE_ID_DAYLIGHT", Const, 0},
+		{"TIME_ZONE_ID_STANDARD", Const, 0},
+		{"TIME_ZONE_ID_UNKNOWN", Const, 0},
+		{"TIOCCBRK", Const, 0},
+		{"TIOCCDTR", Const, 0},
+		{"TIOCCONS", Const, 0},
+		{"TIOCDCDTIMESTAMP", Const, 0},
+		{"TIOCDRAIN", Const, 0},
+		{"TIOCDSIMICROCODE", Const, 0},
+		{"TIOCEXCL", Const, 0},
+		{"TIOCEXT", Const, 0},
+		{"TIOCFLAG_CDTRCTS", Const, 1},
+		{"TIOCFLAG_CLOCAL", Const, 1},
+		{"TIOCFLAG_CRTSCTS", Const, 1},
+		{"TIOCFLAG_MDMBUF", Const, 1},
+		{"TIOCFLAG_PPS", Const, 1},
+		{"TIOCFLAG_SOFTCAR", Const, 1},
+		{"TIOCFLUSH", Const, 0},
+		{"TIOCGDEV", Const, 0},
+		{"TIOCGDRAINWAIT", Const, 0},
+		{"TIOCGETA", Const, 0},
+		{"TIOCGETD", Const, 0},
+		{"TIOCGFLAGS", Const, 1},
+		{"TIOCGICOUNT", Const, 0},
+		{"TIOCGLCKTRMIOS", Const, 0},
+		{"TIOCGLINED", Const, 1},
+		{"TIOCGPGRP", Const, 0},
+		{"TIOCGPTN", Const, 0},
+		{"TIOCGQSIZE", Const, 1},
+		{"TIOCGRANTPT", Const, 1},
+		{"TIOCGRS485", Const, 0},
+		{"TIOCGSERIAL", Const, 0},
+		{"TIOCGSID", Const, 0},
+		{"TIOCGSIZE", Const, 1},
+		{"TIOCGSOFTCAR", Const, 0},
+		{"TIOCGTSTAMP", Const, 1},
+		{"TIOCGWINSZ", Const, 0},
+		{"TIOCINQ", Const, 0},
+		{"TIOCIXOFF", Const, 0},
+		{"TIOCIXON", Const, 0},
+		{"TIOCLINUX", Const, 0},
+		{"TIOCMBIC", Const, 0},
+		{"TIOCMBIS", Const, 0},
+		{"TIOCMGDTRWAIT", Const, 0},
+		{"TIOCMGET", Const, 0},
+		{"TIOCMIWAIT", Const, 0},
+		{"TIOCMODG", Const, 0},
+		{"TIOCMODS", Const, 0},
+		{"TIOCMSDTRWAIT", Const, 0},
+		{"TIOCMSET", Const, 0},
+		{"TIOCM_CAR", Const, 0},
+		{"TIOCM_CD", Const, 0},
+		{"TIOCM_CTS", Const, 0},
+		{"TIOCM_DCD", Const, 0},
+		{"TIOCM_DSR", Const, 0},
+		{"TIOCM_DTR", Const, 0},
+		{"TIOCM_LE", Const, 0},
+		{"TIOCM_RI", Const, 0},
+		{"TIOCM_RNG", Const, 0},
+		{"TIOCM_RTS", Const, 0},
+		{"TIOCM_SR", Const, 0},
+		{"TIOCM_ST", Const, 0},
+		{"TIOCNOTTY", Const, 0},
+		{"TIOCNXCL", Const, 0},
+		{"TIOCOUTQ", Const, 0},
+		{"TIOCPKT", Const, 0},
+		{"TIOCPKT_DATA", Const, 0},
+		{"TIOCPKT_DOSTOP", Const, 0},
+		{"TIOCPKT_FLUSHREAD", Const, 0},
+		{"TIOCPKT_FLUSHWRITE", Const, 0},
+		{"TIOCPKT_IOCTL", Const, 0},
+		{"TIOCPKT_NOSTOP", Const, 0},
+		{"TIOCPKT_START", Const, 0},
+		{"TIOCPKT_STOP", Const, 0},
+		{"TIOCPTMASTER", Const, 0},
+		{"TIOCPTMGET", Const, 1},
+		{"TIOCPTSNAME", Const, 1},
+		{"TIOCPTYGNAME", Const, 0},
+		{"TIOCPTYGRANT", Const, 0},
+		{"TIOCPTYUNLK", Const, 0},
+		{"TIOCRCVFRAME", Const, 1},
+		{"TIOCREMOTE", Const, 0},
+		{"TIOCSBRK", Const, 0},
+		{"TIOCSCONS", Const, 0},
+		{"TIOCSCTTY", Const, 0},
+		{"TIOCSDRAINWAIT", Const, 0},
+		{"TIOCSDTR", Const, 0},
+		{"TIOCSERCONFIG", Const, 0},
+		{"TIOCSERGETLSR", Const, 0},
+		{"TIOCSERGETMULTI", Const, 0},
+		{"TIOCSERGSTRUCT", Const, 0},
+		{"TIOCSERGWILD", Const, 0},
+		{"TIOCSERSETMULTI", Const, 0},
+		{"TIOCSERSWILD", Const, 0},
+		{"TIOCSER_TEMT", Const, 0},
+		{"TIOCSETA", Const, 0},
+		{"TIOCSETAF", Const, 0},
+		{"TIOCSETAW", Const, 0},
+		{"TIOCSETD", Const, 0},
+		{"TIOCSFLAGS", Const, 1},
+		{"TIOCSIG", Const, 0},
+		{"TIOCSLCKTRMIOS", Const, 0},
+		{"TIOCSLINED", Const, 1},
+		{"TIOCSPGRP", Const, 0},
+		{"TIOCSPTLCK", Const, 0},
+		{"TIOCSQSIZE", Const, 1},
+		{"TIOCSRS485", Const, 0},
+		{"TIOCSSERIAL", Const, 0},
+		{"TIOCSSIZE", Const, 1},
+		{"TIOCSSOFTCAR", Const, 0},
+		{"TIOCSTART", Const, 0},
+		{"TIOCSTAT", Const, 0},
+		{"TIOCSTI", Const, 0},
+		{"TIOCSTOP", Const, 0},
+		{"TIOCSTSTAMP", Const, 1},
+		{"TIOCSWINSZ", Const, 0},
+		{"TIOCTIMESTAMP", Const, 0},
+		{"TIOCUCNTL", Const, 0},
+		{"TIOCVHANGUP", Const, 0},
+		{"TIOCXMTFRAME", Const, 1},
+		{"TOKEN_ADJUST_DEFAULT", Const, 0},
+		{"TOKEN_ADJUST_GROUPS", Const, 0},
+		{"TOKEN_ADJUST_PRIVILEGES", Const, 0},
+		{"TOKEN_ADJUST_SESSIONID", Const, 11},
+		{"TOKEN_ALL_ACCESS", Const, 0},
+		{"TOKEN_ASSIGN_PRIMARY", Const, 0},
+		{"TOKEN_DUPLICATE", Const, 0},
+		{"TOKEN_EXECUTE", Const, 0},
+		{"TOKEN_IMPERSONATE", Const, 0},
+		{"TOKEN_QUERY", Const, 0},
+		{"TOKEN_QUERY_SOURCE", Const, 0},
+		{"TOKEN_READ", Const, 0},
+		{"TOKEN_WRITE", Const, 0},
+		{"TOSTOP", Const, 0},
+		{"TRUNCATE_EXISTING", Const, 0},
+		{"TUNATTACHFILTER", Const, 0},
+		{"TUNDETACHFILTER", Const, 0},
+		{"TUNGETFEATURES", Const, 0},
+		{"TUNGETIFF", Const, 0},
+		{"TUNGETSNDBUF", Const, 0},
+		{"TUNGETVNETHDRSZ", Const, 0},
+		{"TUNSETDEBUG", Const, 0},
+		{"TUNSETGROUP", Const, 0},
+		{"TUNSETIFF", Const, 0},
+		{"TUNSETLINK", Const, 0},
+		{"TUNSETNOCSUM", Const, 0},
+		{"TUNSETOFFLOAD", Const, 0},
+		{"TUNSETOWNER", Const, 0},
+		{"TUNSETPERSIST", Const, 0},
+		{"TUNSETSNDBUF", Const, 0},
+		{"TUNSETTXFILTER", Const, 0},
+		{"TUNSETVNETHDRSZ", Const, 0},
+		{"Tee", Func, 0},
+		{"TerminateProcess", Func, 0},
+		{"Termios", Type, 0},
+		{"Termios.Cc", Field, 0},
+		{"Termios.Cflag", Field, 0},
+		{"Termios.Iflag", Field, 0},
+		{"Termios.Ispeed", Field, 0},
+		{"Termios.Lflag", Field, 0},
+		{"Termios.Line", Field, 0},
+		{"Termios.Oflag", Field, 0},
+		{"Termios.Ospeed", Field, 0},
+		{"Termios.Pad_cgo_0", Field, 0},
+		{"Tgkill", Func, 0},
+		{"Time", Func, 0},
+		{"Time_t", Type, 0},
+		{"Times", Func, 0},
+		{"Timespec", Type, 0},
+		{"Timespec.Nsec", Field, 0},
+		{"Timespec.Pad_cgo_0", Field, 2},
+		{"Timespec.Sec", Field, 0},
+		{"TimespecToNsec", Func, 0},
+		{"Timeval", Type, 0},
+		{"Timeval.Pad_cgo_0", Field, 0},
+		{"Timeval.Sec", Field, 0},
+		{"Timeval.Usec", Field, 0},
+		{"Timeval32", Type, 0},
+		{"Timeval32.Sec", Field, 0},
+		{"Timeval32.Usec", Field, 0},
+		{"TimevalToNsec", Func, 0},
+		{"Timex", Type, 0},
+		{"Timex.Calcnt", Field, 0},
+		{"Timex.Constant", Field, 0},
+		{"Timex.Errcnt", Field, 0},
+		{"Timex.Esterror", Field, 0},
+		{"Timex.Freq", Field, 0},
+		{"Timex.Jitcnt", Field, 0},
+		{"Timex.Jitter", Field, 0},
+		{"Timex.Maxerror", Field, 0},
+		{"Timex.Modes", Field, 0},
+		{"Timex.Offset", Field, 0},
+		{"Timex.Pad_cgo_0", Field, 0},
+		{"Timex.Pad_cgo_1", Field, 0},
+		{"Timex.Pad_cgo_2", Field, 0},
+		{"Timex.Pad_cgo_3", Field, 0},
+		{"Timex.Ppsfreq", Field, 0},
+		{"Timex.Precision", Field, 0},
+		{"Timex.Shift", Field, 0},
+		{"Timex.Stabil", Field, 0},
+		{"Timex.Status", Field, 0},
+		{"Timex.Stbcnt", Field, 0},
+		{"Timex.Tai", Field, 0},
+		{"Timex.Tick", Field, 0},
+		{"Timex.Time", Field, 0},
+		{"Timex.Tolerance", Field, 0},
+		{"Timezoneinformation", Type, 0},
+		{"Timezoneinformation.Bias", Field, 0},
+		{"Timezoneinformation.DaylightBias", Field, 0},
+		{"Timezoneinformation.DaylightDate", Field, 0},
+		{"Timezoneinformation.DaylightName", Field, 0},
+		{"Timezoneinformation.StandardBias", Field, 0},
+		{"Timezoneinformation.StandardDate", Field, 0},
+		{"Timezoneinformation.StandardName", Field, 0},
+		{"Tms", Type, 0},
+		{"Tms.Cstime", Field, 0},
+		{"Tms.Cutime", Field, 0},
+		{"Tms.Stime", Field, 0},
+		{"Tms.Utime", Field, 0},
+		{"Token", Type, 0},
+		{"TokenAccessInformation", Const, 0},
+		{"TokenAuditPolicy", Const, 0},
+		{"TokenDefaultDacl", Const, 0},
+		{"TokenElevation", Const, 0},
+		{"TokenElevationType", Const, 0},
+		{"TokenGroups", Const, 0},
+		{"TokenGroupsAndPrivileges", Const, 0},
+		{"TokenHasRestrictions", Const, 0},
+		{"TokenImpersonationLevel", Const, 0},
+		{"TokenIntegrityLevel", Const, 0},
+		{"TokenLinkedToken", Const, 0},
+		{"TokenLogonSid", Const, 0},
+		{"TokenMandatoryPolicy", Const, 0},
+		{"TokenOrigin", Const, 0},
+		{"TokenOwner", Const, 0},
+		{"TokenPrimaryGroup", Const, 0},
+		{"TokenPrivileges", Const, 0},
+		{"TokenRestrictedSids", Const, 0},
+		{"TokenSandBoxInert", Const, 0},
+		{"TokenSessionId", Const, 0},
+		{"TokenSessionReference", Const, 0},
+		{"TokenSource", Const, 0},
+		{"TokenStatistics", Const, 0},
+		{"TokenType", Const, 0},
+		{"TokenUIAccess", Const, 0},
+		{"TokenUser", Const, 0},
+		{"TokenVirtualizationAllowed", Const, 0},
+		{"TokenVirtualizationEnabled", Const, 0},
+		{"Tokenprimarygroup", Type, 0},
+		{"Tokenprimarygroup.PrimaryGroup", Field, 0},
+		{"Tokenuser", Type, 0},
+		{"Tokenuser.User", Field, 0},
+		{"TranslateAccountName", Func, 0},
+		{"TranslateName", Func, 0},
+		{"TransmitFile", Func, 0},
+		{"TransmitFileBuffers", Type, 0},
+		{"TransmitFileBuffers.Head", Field, 0},
+		{"TransmitFileBuffers.HeadLength", Field, 0},
+		{"TransmitFileBuffers.Tail", Field, 0},
+		{"TransmitFileBuffers.TailLength", Field, 0},
+		{"Truncate", Func, 0},
+		{"UNIX_PATH_MAX", Const, 12},
+		{"USAGE_MATCH_TYPE_AND", Const, 0},
+		{"USAGE_MATCH_TYPE_OR", Const, 0},
+		{"UTF16FromString", Func, 1},
+		{"UTF16PtrFromString", Func, 1},
+		{"UTF16ToString", Func, 0},
+		{"Ucred", Type, 0},
+		{"Ucred.Gid", Field, 0},
+		{"Ucred.Pid", Field, 0},
+		{"Ucred.Uid", Field, 0},
+		{"Umask", Func, 0},
+		{"Uname", Func, 0},
+		{"Undelete", Func, 0},
+		{"UnixCredentials", Func, 0},
+		{"UnixRights", Func, 0},
+		{"Unlink", Func, 0},
+		{"Unlinkat", Func, 0},
+		{"UnmapViewOfFile", Func, 0},
+		{"Unmount", Func, 0},
+		{"Unsetenv", Func, 4},
+		{"Unshare", Func, 0},
+		{"UserInfo10", Type, 0},
+		{"UserInfo10.Comment", Field, 0},
+		{"UserInfo10.FullName", Field, 0},
+		{"UserInfo10.Name", Field, 0},
+		{"UserInfo10.UsrComment", Field, 0},
+		{"Ustat", Func, 0},
+		{"Ustat_t", Type, 0},
+		{"Ustat_t.Fname", Field, 0},
+		{"Ustat_t.Fpack", Field, 0},
+		{"Ustat_t.Pad_cgo_0", Field, 0},
+		{"Ustat_t.Pad_cgo_1", Field, 0},
+		{"Ustat_t.Tfree", Field, 0},
+		{"Ustat_t.Tinode", Field, 0},
+		{"Utimbuf", Type, 0},
+		{"Utimbuf.Actime", Field, 0},
+		{"Utimbuf.Modtime", Field, 0},
+		{"Utime", Func, 0},
+		{"Utimes", Func, 0},
+		{"UtimesNano", Func, 1},
+		{"Utsname", Type, 0},
+		{"Utsname.Domainname", Field, 0},
+		{"Utsname.Machine", Field, 0},
+		{"Utsname.Nodename", Field, 0},
+		{"Utsname.Release", Field, 0},
+		{"Utsname.Sysname", Field, 0},
+		{"Utsname.Version", Field, 0},
+		{"VDISCARD", Const, 0},
+		{"VDSUSP", Const, 1},
+		{"VEOF", Const, 0},
+		{"VEOL", Const, 0},
+		{"VEOL2", Const, 0},
+		{"VERASE", Const, 0},
+		{"VERASE2", Const, 1},
+		{"VINTR", Const, 0},
+		{"VKILL", Const, 0},
+		{"VLNEXT", Const, 0},
+		{"VMIN", Const, 0},
+		{"VQUIT", Const, 0},
+		{"VREPRINT", Const, 0},
+		{"VSTART", Const, 0},
+		{"VSTATUS", Const, 1},
+		{"VSTOP", Const, 0},
+		{"VSUSP", Const, 0},
+		{"VSWTC", Const, 0},
+		{"VT0", Const, 1},
+		{"VT1", Const, 1},
+		{"VTDLY", Const, 1},
+		{"VTIME", Const, 0},
+		{"VWERASE", Const, 0},
+		{"VirtualLock", Func, 0},
+		{"VirtualUnlock", Func, 0},
+		{"WAIT_ABANDONED", Const, 0},
+		{"WAIT_FAILED", Const, 0},
+		{"WAIT_OBJECT_0", Const, 0},
+		{"WAIT_TIMEOUT", Const, 0},
+		{"WALL", Const, 0},
+		{"WALLSIG", Const, 1},
+		{"WALTSIG", Const, 1},
+		{"WCLONE", Const, 0},
+		{"WCONTINUED", Const, 0},
+		{"WCOREFLAG", Const, 0},
+		{"WEXITED", Const, 0},
+		{"WLINUXCLONE", Const, 0},
+		{"WNOHANG", Const, 0},
+		{"WNOTHREAD", Const, 0},
+		{"WNOWAIT", Const, 0},
+		{"WNOZOMBIE", Const, 1},
+		{"WOPTSCHECKED", Const, 1},
+		{"WORDSIZE", Const, 0},
+		{"WSABuf", Type, 0},
+		{"WSABuf.Buf", Field, 0},
+		{"WSABuf.Len", Field, 0},
+		{"WSACleanup", Func, 0},
+		{"WSADESCRIPTION_LEN", Const, 0},
+		{"WSAData", Type, 0},
+		{"WSAData.Description", Field, 0},
+		{"WSAData.HighVersion", Field, 0},
+		{"WSAData.MaxSockets", Field, 0},
+		{"WSAData.MaxUdpDg", Field, 0},
+		{"WSAData.SystemStatus", Field, 0},
+		{"WSAData.VendorInfo", Field, 0},
+		{"WSAData.Version", Field, 0},
+		{"WSAEACCES", Const, 2},
+		{"WSAECONNABORTED", Const, 9},
+		{"WSAECONNRESET", Const, 3},
+		{"WSAEnumProtocols", Func, 2},
+		{"WSAID_CONNECTEX", Var, 1},
+		{"WSAIoctl", Func, 0},
+		{"WSAPROTOCOL_LEN", Const, 2},
+		{"WSAProtocolChain", Type, 2},
+		{"WSAProtocolChain.ChainEntries", Field, 2},
+		{"WSAProtocolChain.ChainLen", Field, 2},
+		{"WSAProtocolInfo", Type, 2},
+		{"WSAProtocolInfo.AddressFamily", Field, 2},
+		{"WSAProtocolInfo.CatalogEntryId", Field, 2},
+		{"WSAProtocolInfo.MaxSockAddr", Field, 2},
+		{"WSAProtocolInfo.MessageSize", Field, 2},
+		{"WSAProtocolInfo.MinSockAddr", Field, 2},
+		{"WSAProtocolInfo.NetworkByteOrder", Field, 2},
+		{"WSAProtocolInfo.Protocol", Field, 2},
+		{"WSAProtocolInfo.ProtocolChain", Field, 2},
+		{"WSAProtocolInfo.ProtocolMaxOffset", Field, 2},
+		{"WSAProtocolInfo.ProtocolName", Field, 2},
+		{"WSAProtocolInfo.ProviderFlags", Field, 2},
+		{"WSAProtocolInfo.ProviderId", Field, 2},
+		{"WSAProtocolInfo.ProviderReserved", Field, 2},
+		{"WSAProtocolInfo.SecurityScheme", Field, 2},
+		{"WSAProtocolInfo.ServiceFlags1", Field, 2},
+		{"WSAProtocolInfo.ServiceFlags2", Field, 2},
+		{"WSAProtocolInfo.ServiceFlags3", Field, 2},
+		{"WSAProtocolInfo.ServiceFlags4", Field, 2},
+		{"WSAProtocolInfo.SocketType", Field, 2},
+		{"WSAProtocolInfo.Version", Field, 2},
+		{"WSARecv", Func, 0},
+		{"WSARecvFrom", Func, 0},
+		{"WSASYS_STATUS_LEN", Const, 0},
+		{"WSASend", Func, 0},
+		{"WSASendTo", Func, 0},
+		{"WSASendto", Func, 0},
+		{"WSAStartup", Func, 0},
+		{"WSTOPPED", Const, 0},
+		{"WTRAPPED", Const, 1},
+		{"WUNTRACED", Const, 0},
+		{"Wait4", Func, 0},
+		{"WaitForSingleObject", Func, 0},
+		{"WaitStatus", Type, 0},
+		{"WaitStatus.ExitCode", Field, 0},
+		{"Win32FileAttributeData", Type, 0},
+		{"Win32FileAttributeData.CreationTime", Field, 0},
+		{"Win32FileAttributeData.FileAttributes", Field, 0},
+		{"Win32FileAttributeData.FileSizeHigh", Field, 0},
+		{"Win32FileAttributeData.FileSizeLow", Field, 0},
+		{"Win32FileAttributeData.LastAccessTime", Field, 0},
+		{"Win32FileAttributeData.LastWriteTime", Field, 0},
+		{"Win32finddata", Type, 0},
+		{"Win32finddata.AlternateFileName", Field, 0},
+		{"Win32finddata.CreationTime", Field, 0},
+		{"Win32finddata.FileAttributes", Field, 0},
+		{"Win32finddata.FileName", Field, 0},
+		{"Win32finddata.FileSizeHigh", Field, 0},
+		{"Win32finddata.FileSizeLow", Field, 0},
+		{"Win32finddata.LastAccessTime", Field, 0},
+		{"Win32finddata.LastWriteTime", Field, 0},
+		{"Win32finddata.Reserved0", Field, 0},
+		{"Win32finddata.Reserved1", Field, 0},
+		{"Write", Func, 0},
+		{"WriteConsole", Func, 1},
+		{"WriteFile", Func, 0},
+		{"X509_ASN_ENCODING", Const, 0},
+		{"XCASE", Const, 0},
+		{"XP1_CONNECTIONLESS", Const, 2},
+		{"XP1_CONNECT_DATA", Const, 2},
+		{"XP1_DISCONNECT_DATA", Const, 2},
+		{"XP1_EXPEDITED_DATA", Const, 2},
+		{"XP1_GRACEFUL_CLOSE", Const, 2},
+		{"XP1_GUARANTEED_DELIVERY", Const, 2},
+		{"XP1_GUARANTEED_ORDER", Const, 2},
+		{"XP1_IFS_HANDLES", Const, 2},
+		{"XP1_MESSAGE_ORIENTED", Const, 2},
+		{"XP1_MULTIPOINT_CONTROL_PLANE", Const, 2},
+		{"XP1_MULTIPOINT_DATA_PLANE", Const, 2},
+		{"XP1_PARTIAL_MESSAGE", Const, 2},
+		{"XP1_PSEUDO_STREAM", Const, 2},
+		{"XP1_QOS_SUPPORTED", Const, 2},
+		{"XP1_SAN_SUPPORT_SDP", Const, 2},
+		{"XP1_SUPPORT_BROADCAST", Const, 2},
+		{"XP1_SUPPORT_MULTIPOINT", Const, 2},
+		{"XP1_UNI_RECV", Const, 2},
+		{"XP1_UNI_SEND", Const, 2},
+	},
+	"syscall/js": {
+		{"CopyBytesToGo", Func, 0},
+		{"CopyBytesToJS", Func, 0},
+		{"Error", Type, 0},
+		{"Func", Type, 0},
+		{"FuncOf", Func, 0},
+		{"Global", Func, 0},
+		{"Null", Func, 0},
+		{"Type", Type, 0},
+		{"TypeBoolean", Const, 0},
+		{"TypeFunction", Const, 0},
+		{"TypeNull", Const, 0},
+		{"TypeNumber", Const, 0},
+		{"TypeObject", Const, 0},
+		{"TypeString", Const, 0},
+		{"TypeSymbol", Const, 0},
+		{"TypeUndefined", Const, 0},
+		{"Undefined", Func, 0},
+		{"Value", Type, 0},
+		{"ValueError", Type, 0},
+		{"ValueOf", Func, 0},
+	},
+	"testing": {
+		{"(*B).Cleanup", Method, 14},
+		{"(*B).Elapsed", Method, 20},
+		{"(*B).Error", Method, 0},
+		{"(*B).Errorf", Method, 0},
+		{"(*B).Fail", Method, 0},
+		{"(*B).FailNow", Method, 0},
+		{"(*B).Failed", Method, 0},
+		{"(*B).Fatal", Method, 0},
+		{"(*B).Fatalf", Method, 0},
+		{"(*B).Helper", Method, 9},
+		{"(*B).Log", Method, 0},
+		{"(*B).Logf", Method, 0},
+		{"(*B).Name", Method, 8},
+		{"(*B).ReportAllocs", Method, 1},
+		{"(*B).ReportMetric", Method, 13},
+		{"(*B).ResetTimer", Method, 0},
+		{"(*B).Run", Method, 7},
+		{"(*B).RunParallel", Method, 3},
+		{"(*B).SetBytes", Method, 0},
+		{"(*B).SetParallelism", Method, 3},
+		{"(*B).Setenv", Method, 17},
+		{"(*B).Skip", Method, 1},
+		{"(*B).SkipNow", Method, 1},
+		{"(*B).Skipf", Method, 1},
+		{"(*B).Skipped", Method, 1},
+		{"(*B).StartTimer", Method, 0},
+		{"(*B).StopTimer", Method, 0},
+		{"(*B).TempDir", Method, 15},
+		{"(*F).Add", Method, 18},
+		{"(*F).Cleanup", Method, 18},
+		{"(*F).Error", Method, 18},
+		{"(*F).Errorf", Method, 18},
+		{"(*F).Fail", Method, 18},
+		{"(*F).FailNow", Method, 18},
+		{"(*F).Failed", Method, 18},
+		{"(*F).Fatal", Method, 18},
+		{"(*F).Fatalf", Method, 18},
+		{"(*F).Fuzz", Method, 18},
+		{"(*F).Helper", Method, 18},
+		{"(*F).Log", Method, 18},
+		{"(*F).Logf", Method, 18},
+		{"(*F).Name", Method, 18},
+		{"(*F).Setenv", Method, 18},
+		{"(*F).Skip", Method, 18},
+		{"(*F).SkipNow", Method, 18},
+		{"(*F).Skipf", Method, 18},
+		{"(*F).Skipped", Method, 18},
+		{"(*F).TempDir", Method, 18},
+		{"(*M).Run", Method, 4},
+		{"(*PB).Next", Method, 3},
+		{"(*T).Cleanup", Method, 14},
+		{"(*T).Deadline", Method, 15},
+		{"(*T).Error", Method, 0},
+		{"(*T).Errorf", Method, 0},
+		{"(*T).Fail", Method, 0},
+		{"(*T).FailNow", Method, 0},
+		{"(*T).Failed", Method, 0},
+		{"(*T).Fatal", Method, 0},
+		{"(*T).Fatalf", Method, 0},
+		{"(*T).Helper", Method, 9},
+		{"(*T).Log", Method, 0},
+		{"(*T).Logf", Method, 0},
+		{"(*T).Name", Method, 8},
+		{"(*T).Parallel", Method, 0},
+		{"(*T).Run", Method, 7},
+		{"(*T).Setenv", Method, 17},
+		{"(*T).Skip", Method, 1},
+		{"(*T).SkipNow", Method, 1},
+		{"(*T).Skipf", Method, 1},
+		{"(*T).Skipped", Method, 1},
+		{"(*T).TempDir", Method, 15},
+		{"(BenchmarkResult).AllocedBytesPerOp", Method, 1},
+		{"(BenchmarkResult).AllocsPerOp", Method, 1},
+		{"(BenchmarkResult).MemString", Method, 1},
+		{"(BenchmarkResult).NsPerOp", Method, 0},
+		{"(BenchmarkResult).String", Method, 0},
+		{"AllocsPerRun", Func, 1},
+		{"B", Type, 0},
+		{"B.N", Field, 0},
+		{"Benchmark", Func, 0},
+		{"BenchmarkResult", Type, 0},
+		{"BenchmarkResult.Bytes", Field, 0},
+		{"BenchmarkResult.Extra", Field, 13},
+		{"BenchmarkResult.MemAllocs", Field, 1},
+		{"BenchmarkResult.MemBytes", Field, 1},
+		{"BenchmarkResult.N", Field, 0},
+		{"BenchmarkResult.T", Field, 0},
+		{"Cover", Type, 2},
+		{"Cover.Blocks", Field, 2},
+		{"Cover.Counters", Field, 2},
+		{"Cover.CoveredPackages", Field, 2},
+		{"Cover.Mode", Field, 2},
+		{"CoverBlock", Type, 2},
+		{"CoverBlock.Col0", Field, 2},
+		{"CoverBlock.Col1", Field, 2},
+		{"CoverBlock.Line0", Field, 2},
+		{"CoverBlock.Line1", Field, 2},
+		{"CoverBlock.Stmts", Field, 2},
+		{"CoverMode", Func, 8},
+		{"Coverage", Func, 4},
+		{"F", Type, 18},
+		{"Init", Func, 13},
+		{"InternalBenchmark", Type, 0},
+		{"InternalBenchmark.F", Field, 0},
+		{"InternalBenchmark.Name", Field, 0},
+		{"InternalExample", Type, 0},
+		{"InternalExample.F", Field, 0},
+		{"InternalExample.Name", Field, 0},
+		{"InternalExample.Output", Field, 0},
+		{"InternalExample.Unordered", Field, 7},
+		{"InternalFuzzTarget", Type, 18},
+		{"InternalFuzzTarget.Fn", Field, 18},
+		{"InternalFuzzTarget.Name", Field, 18},
+		{"InternalTest", Type, 0},
+		{"InternalTest.F", Field, 0},
+		{"InternalTest.Name", Field, 0},
+		{"M", Type, 4},
+		{"Main", Func, 0},
+		{"MainStart", Func, 4},
+		{"PB", Type, 3},
+		{"RegisterCover", Func, 2},
+		{"RunBenchmarks", Func, 0},
+		{"RunExamples", Func, 0},
+		{"RunTests", Func, 0},
+		{"Short", Func, 0},
+		{"T", Type, 0},
+		{"TB", Type, 2},
+		{"Testing", Func, 21},
+		{"Verbose", Func, 1},
+	},
+	"testing/fstest": {
+		{"(MapFS).Glob", Method, 16},
+		{"(MapFS).Open", Method, 16},
+		{"(MapFS).ReadDir", Method, 16},
+		{"(MapFS).ReadFile", Method, 16},
+		{"(MapFS).Stat", Method, 16},
+		{"(MapFS).Sub", Method, 16},
+		{"MapFS", Type, 16},
+		{"MapFile", Type, 16},
+		{"MapFile.Data", Field, 16},
+		{"MapFile.ModTime", Field, 16},
+		{"MapFile.Mode", Field, 16},
+		{"MapFile.Sys", Field, 16},
+		{"TestFS", Func, 16},
+	},
+	"testing/iotest": {
+		{"DataErrReader", Func, 0},
+		{"ErrReader", Func, 16},
+		{"ErrTimeout", Var, 0},
+		{"HalfReader", Func, 0},
+		{"NewReadLogger", Func, 0},
+		{"NewWriteLogger", Func, 0},
+		{"OneByteReader", Func, 0},
+		{"TestReader", Func, 16},
+		{"TimeoutReader", Func, 0},
+		{"TruncateWriter", Func, 0},
+	},
+	"testing/quick": {
+		{"(*CheckEqualError).Error", Method, 0},
+		{"(*CheckError).Error", Method, 0},
+		{"(SetupError).Error", Method, 0},
+		{"Check", Func, 0},
+		{"CheckEqual", Func, 0},
+		{"CheckEqualError", Type, 0},
+		{"CheckEqualError.CheckError", Field, 0},
+		{"CheckEqualError.Out1", Field, 0},
+		{"CheckEqualError.Out2", Field, 0},
+		{"CheckError", Type, 0},
+		{"CheckError.Count", Field, 0},
+		{"CheckError.In", Field, 0},
+		{"Config", Type, 0},
+		{"Config.MaxCount", Field, 0},
+		{"Config.MaxCountScale", Field, 0},
+		{"Config.Rand", Field, 0},
+		{"Config.Values", Field, 0},
+		{"Generator", Type, 0},
+		{"SetupError", Type, 0},
+		{"Value", Func, 0},
+	},
+	"testing/slogtest": {
+		{"Run", Func, 22},
+		{"TestHandler", Func, 21},
+	},
+	"text/scanner": {
+		{"(*Position).IsValid", Method, 0},
+		{"(*Scanner).Init", Method, 0},
+		{"(*Scanner).IsValid", Method, 0},
+		{"(*Scanner).Next", Method, 0},
+		{"(*Scanner).Peek", Method, 0},
+		{"(*Scanner).Pos", Method, 0},
+		{"(*Scanner).Scan", Method, 0},
+		{"(*Scanner).TokenText", Method, 0},
+		{"(Position).String", Method, 0},
+		{"(Scanner).String", Method, 0},
+		{"Char", Const, 0},
+		{"Comment", Const, 0},
+		{"EOF", Const, 0},
+		{"Float", Const, 0},
+		{"GoTokens", Const, 0},
+		{"GoWhitespace", Const, 0},
+		{"Ident", Const, 0},
+		{"Int", Const, 0},
+		{"Position", Type, 0},
+		{"Position.Column", Field, 0},
+		{"Position.Filename", Field, 0},
+		{"Position.Line", Field, 0},
+		{"Position.Offset", Field, 0},
+		{"RawString", Const, 0},
+		{"ScanChars", Const, 0},
+		{"ScanComments", Const, 0},
+		{"ScanFloats", Const, 0},
+		{"ScanIdents", Const, 0},
+		{"ScanInts", Const, 0},
+		{"ScanRawStrings", Const, 0},
+		{"ScanStrings", Const, 0},
+		{"Scanner", Type, 0},
+		{"Scanner.Error", Field, 0},
+		{"Scanner.ErrorCount", Field, 0},
+		{"Scanner.IsIdentRune", Field, 4},
+		{"Scanner.Mode", Field, 0},
+		{"Scanner.Position", Field, 0},
+		{"Scanner.Whitespace", Field, 0},
+		{"SkipComments", Const, 0},
+		{"String", Const, 0},
+		{"TokenString", Func, 0},
+	},
+	"text/tabwriter": {
+		{"(*Writer).Flush", Method, 0},
+		{"(*Writer).Init", Method, 0},
+		{"(*Writer).Write", Method, 0},
+		{"AlignRight", Const, 0},
+		{"Debug", Const, 0},
+		{"DiscardEmptyColumns", Const, 0},
+		{"Escape", Const, 0},
+		{"FilterHTML", Const, 0},
+		{"NewWriter", Func, 0},
+		{"StripEscape", Const, 0},
+		{"TabIndent", Const, 0},
+		{"Writer", Type, 0},
+	},
+	"text/template": {
+		{"(*Template).AddParseTree", Method, 0},
+		{"(*Template).Clone", Method, 0},
+		{"(*Template).DefinedTemplates", Method, 5},
+		{"(*Template).Delims", Method, 0},
+		{"(*Template).Execute", Method, 0},
+		{"(*Template).ExecuteTemplate", Method, 0},
+		{"(*Template).Funcs", Method, 0},
+		{"(*Template).Lookup", Method, 0},
+		{"(*Template).Name", Method, 0},
+		{"(*Template).New", Method, 0},
+		{"(*Template).Option", Method, 5},
+		{"(*Template).Parse", Method, 0},
+		{"(*Template).ParseFS", Method, 16},
+		{"(*Template).ParseFiles", Method, 0},
+		{"(*Template).ParseGlob", Method, 0},
+		{"(*Template).Templates", Method, 0},
+		{"(ExecError).Error", Method, 6},
+		{"(ExecError).Unwrap", Method, 13},
+		{"(Template).Copy", Method, 2},
+		{"(Template).ErrorContext", Method, 1},
+		{"ExecError", Type, 6},
+		{"ExecError.Err", Field, 6},
+		{"ExecError.Name", Field, 6},
+		{"FuncMap", Type, 0},
+		{"HTMLEscape", Func, 0},
+		{"HTMLEscapeString", Func, 0},
+		{"HTMLEscaper", Func, 0},
+		{"IsTrue", Func, 6},
+		{"JSEscape", Func, 0},
+		{"JSEscapeString", Func, 0},
+		{"JSEscaper", Func, 0},
+		{"Must", Func, 0},
+		{"New", Func, 0},
+		{"ParseFS", Func, 16},
+		{"ParseFiles", Func, 0},
+		{"ParseGlob", Func, 0},
+		{"Template", Type, 0},
+		{"Template.Tree", Field, 0},
+		{"URLQueryEscaper", Func, 0},
+	},
+	"text/template/parse": {
+		{"(*ActionNode).Copy", Method, 0},
+		{"(*ActionNode).String", Method, 0},
+		{"(*BoolNode).Copy", Method, 0},
+		{"(*BoolNode).String", Method, 0},
+		{"(*BranchNode).Copy", Method, 4},
+		{"(*BranchNode).String", Method, 0},
+		{"(*BreakNode).Copy", Method, 18},
+		{"(*BreakNode).String", Method, 18},
+		{"(*ChainNode).Add", Method, 1},
+		{"(*ChainNode).Copy", Method, 1},
+		{"(*ChainNode).String", Method, 1},
+		{"(*CommandNode).Copy", Method, 0},
+		{"(*CommandNode).String", Method, 0},
+		{"(*CommentNode).Copy", Method, 16},
+		{"(*CommentNode).String", Method, 16},
+		{"(*ContinueNode).Copy", Method, 18},
+		{"(*ContinueNode).String", Method, 18},
+		{"(*DotNode).Copy", Method, 0},
+		{"(*DotNode).String", Method, 0},
+		{"(*DotNode).Type", Method, 0},
+		{"(*FieldNode).Copy", Method, 0},
+		{"(*FieldNode).String", Method, 0},
+		{"(*IdentifierNode).Copy", Method, 0},
+		{"(*IdentifierNode).SetPos", Method, 1},
+		{"(*IdentifierNode).SetTree", Method, 4},
+		{"(*IdentifierNode).String", Method, 0},
+		{"(*IfNode).Copy", Method, 0},
+		{"(*IfNode).String", Method, 0},
+		{"(*ListNode).Copy", Method, 0},
+		{"(*ListNode).CopyList", Method, 0},
+		{"(*ListNode).String", Method, 0},
+		{"(*NilNode).Copy", Method, 1},
+		{"(*NilNode).String", Method, 1},
+		{"(*NilNode).Type", Method, 1},
+		{"(*NumberNode).Copy", Method, 0},
+		{"(*NumberNode).String", Method, 0},
+		{"(*PipeNode).Copy", Method, 0},
+		{"(*PipeNode).CopyPipe", Method, 0},
+		{"(*PipeNode).String", Method, 0},
+		{"(*RangeNode).Copy", Method, 0},
+		{"(*RangeNode).String", Method, 0},
+		{"(*StringNode).Copy", Method, 0},
+		{"(*StringNode).String", Method, 0},
+		{"(*TemplateNode).Copy", Method, 0},
+		{"(*TemplateNode).String", Method, 0},
+		{"(*TextNode).Copy", Method, 0},
+		{"(*TextNode).String", Method, 0},
+		{"(*Tree).Copy", Method, 2},
+		{"(*Tree).ErrorContext", Method, 1},
+		{"(*Tree).Parse", Method, 0},
+		{"(*VariableNode).Copy", Method, 0},
+		{"(*VariableNode).String", Method, 0},
+		{"(*WithNode).Copy", Method, 0},
+		{"(*WithNode).String", Method, 0},
+		{"(ActionNode).Position", Method, 1},
+		{"(ActionNode).Type", Method, 0},
+		{"(BoolNode).Position", Method, 1},
+		{"(BoolNode).Type", Method, 0},
+		{"(BranchNode).Position", Method, 1},
+		{"(BranchNode).Type", Method, 0},
+		{"(BreakNode).Position", Method, 18},
+		{"(BreakNode).Type", Method, 18},
+		{"(ChainNode).Position", Method, 1},
+		{"(ChainNode).Type", Method, 1},
+		{"(CommandNode).Position", Method, 1},
+		{"(CommandNode).Type", Method, 0},
+		{"(CommentNode).Position", Method, 16},
+		{"(CommentNode).Type", Method, 16},
+		{"(ContinueNode).Position", Method, 18},
+		{"(ContinueNode).Type", Method, 18},
+		{"(DotNode).Position", Method, 1},
+		{"(FieldNode).Position", Method, 1},
+		{"(FieldNode).Type", Method, 0},
+		{"(IdentifierNode).Position", Method, 1},
+		{"(IdentifierNode).Type", Method, 0},
+		{"(IfNode).Position", Method, 1},
+		{"(IfNode).Type", Method, 0},
+		{"(ListNode).Position", Method, 1},
+		{"(ListNode).Type", Method, 0},
+		{"(NilNode).Position", Method, 1},
+		{"(NodeType).Type", Method, 0},
+		{"(NumberNode).Position", Method, 1},
+		{"(NumberNode).Type", Method, 0},
+		{"(PipeNode).Position", Method, 1},
+		{"(PipeNode).Type", Method, 0},
+		{"(Pos).Position", Method, 1},
+		{"(RangeNode).Position", Method, 1},
+		{"(RangeNode).Type", Method, 0},
+		{"(StringNode).Position", Method, 1},
+		{"(StringNode).Type", Method, 0},
+		{"(TemplateNode).Position", Method, 1},
+		{"(TemplateNode).Type", Method, 0},
+		{"(TextNode).Position", Method, 1},
+		{"(TextNode).Type", Method, 0},
+		{"(VariableNode).Position", Method, 1},
+		{"(VariableNode).Type", Method, 0},
+		{"(WithNode).Position", Method, 1},
+		{"(WithNode).Type", Method, 0},
+		{"ActionNode", Type, 0},
+		{"ActionNode.Line", Field, 0},
+		{"ActionNode.NodeType", Field, 0},
+		{"ActionNode.Pipe", Field, 0},
+		{"ActionNode.Pos", Field, 1},
+		{"BoolNode", Type, 0},
+		{"BoolNode.NodeType", Field, 0},
+		{"BoolNode.Pos", Field, 1},
+		{"BoolNode.True", Field, 0},
+		{"BranchNode", Type, 0},
+		{"BranchNode.ElseList", Field, 0},
+		{"BranchNode.Line", Field, 0},
+		{"BranchNode.List", Field, 0},
+		{"BranchNode.NodeType", Field, 0},
+		{"BranchNode.Pipe", Field, 0},
+		{"BranchNode.Pos", Field, 1},
+		{"BreakNode", Type, 18},
+		{"BreakNode.Line", Field, 18},
+		{"BreakNode.NodeType", Field, 18},
+		{"BreakNode.Pos", Field, 18},
+		{"ChainNode", Type, 1},
+		{"ChainNode.Field", Field, 1},
+		{"ChainNode.Node", Field, 1},
+		{"ChainNode.NodeType", Field, 1},
+		{"ChainNode.Pos", Field, 1},
+		{"CommandNode", Type, 0},
+		{"CommandNode.Args", Field, 0},
+		{"CommandNode.NodeType", Field, 0},
+		{"CommandNode.Pos", Field, 1},
+		{"CommentNode", Type, 16},
+		{"CommentNode.NodeType", Field, 16},
+		{"CommentNode.Pos", Field, 16},
+		{"CommentNode.Text", Field, 16},
+		{"ContinueNode", Type, 18},
+		{"ContinueNode.Line", Field, 18},
+		{"ContinueNode.NodeType", Field, 18},
+		{"ContinueNode.Pos", Field, 18},
+		{"DotNode", Type, 0},
+		{"DotNode.NodeType", Field, 4},
+		{"DotNode.Pos", Field, 1},
+		{"FieldNode", Type, 0},
+		{"FieldNode.Ident", Field, 0},
+		{"FieldNode.NodeType", Field, 0},
+		{"FieldNode.Pos", Field, 1},
+		{"IdentifierNode", Type, 0},
+		{"IdentifierNode.Ident", Field, 0},
+		{"IdentifierNode.NodeType", Field, 0},
+		{"IdentifierNode.Pos", Field, 1},
+		{"IfNode", Type, 0},
+		{"IfNode.BranchNode", Field, 0},
+		{"IsEmptyTree", Func, 0},
+		{"ListNode", Type, 0},
+		{"ListNode.NodeType", Field, 0},
+		{"ListNode.Nodes", Field, 0},
+		{"ListNode.Pos", Field, 1},
+		{"Mode", Type, 16},
+		{"New", Func, 0},
+		{"NewIdentifier", Func, 0},
+		{"NilNode", Type, 1},
+		{"NilNode.NodeType", Field, 4},
+		{"NilNode.Pos", Field, 1},
+		{"Node", Type, 0},
+		{"NodeAction", Const, 0},
+		{"NodeBool", Const, 0},
+		{"NodeBreak", Const, 18},
+		{"NodeChain", Const, 1},
+		{"NodeCommand", Const, 0},
+		{"NodeComment", Const, 16},
+		{"NodeContinue", Const, 18},
+		{"NodeDot", Const, 0},
+		{"NodeField", Const, 0},
+		{"NodeIdentifier", Const, 0},
+		{"NodeIf", Const, 0},
+		{"NodeList", Const, 0},
+		{"NodeNil", Const, 1},
+		{"NodeNumber", Const, 0},
+		{"NodePipe", Const, 0},
+		{"NodeRange", Const, 0},
+		{"NodeString", Const, 0},
+		{"NodeTemplate", Const, 0},
+		{"NodeText", Const, 0},
+		{"NodeType", Type, 0},
+		{"NodeVariable", Const, 0},
+		{"NodeWith", Const, 0},
+		{"NumberNode", Type, 0},
+		{"NumberNode.Complex128", Field, 0},
+		{"NumberNode.Float64", Field, 0},
+		{"NumberNode.Int64", Field, 0},
+		{"NumberNode.IsComplex", Field, 0},
+		{"NumberNode.IsFloat", Field, 0},
+		{"NumberNode.IsInt", Field, 0},
+		{"NumberNode.IsUint", Field, 0},
+		{"NumberNode.NodeType", Field, 0},
+		{"NumberNode.Pos", Field, 1},
+		{"NumberNode.Text", Field, 0},
+		{"NumberNode.Uint64", Field, 0},
+		{"Parse", Func, 0},
+		{"ParseComments", Const, 16},
+		{"PipeNode", Type, 0},
+		{"PipeNode.Cmds", Field, 0},
+		{"PipeNode.Decl", Field, 0},
+		{"PipeNode.IsAssign", Field, 11},
+		{"PipeNode.Line", Field, 0},
+		{"PipeNode.NodeType", Field, 0},
+		{"PipeNode.Pos", Field, 1},
+		{"Pos", Type, 1},
+		{"RangeNode", Type, 0},
+		{"RangeNode.BranchNode", Field, 0},
+		{"SkipFuncCheck", Const, 17},
+		{"StringNode", Type, 0},
+		{"StringNode.NodeType", Field, 0},
+		{"StringNode.Pos", Field, 1},
+		{"StringNode.Quoted", Field, 0},
+		{"StringNode.Text", Field, 0},
+		{"TemplateNode", Type, 0},
+		{"TemplateNode.Line", Field, 0},
+		{"TemplateNode.Name", Field, 0},
+		{"TemplateNode.NodeType", Field, 0},
+		{"TemplateNode.Pipe", Field, 0},
+		{"TemplateNode.Pos", Field, 1},
+		{"TextNode", Type, 0},
+		{"TextNode.NodeType", Field, 0},
+		{"TextNode.Pos", Field, 1},
+		{"TextNode.Text", Field, 0},
+		{"Tree", Type, 0},
+		{"Tree.Mode", Field, 16},
+		{"Tree.Name", Field, 0},
+		{"Tree.ParseName", Field, 1},
+		{"Tree.Root", Field, 0},
+		{"VariableNode", Type, 0},
+		{"VariableNode.Ident", Field, 0},
+		{"VariableNode.NodeType", Field, 0},
+		{"VariableNode.Pos", Field, 1},
+		{"WithNode", Type, 0},
+		{"WithNode.BranchNode", Field, 0},
+	},
+	"time": {
+		{"(*Location).String", Method, 0},
+		{"(*ParseError).Error", Method, 0},
+		{"(*Ticker).Reset", Method, 15},
+		{"(*Ticker).Stop", Method, 0},
+		{"(*Time).GobDecode", Method, 0},
+		{"(*Time).UnmarshalBinary", Method, 2},
+		{"(*Time).UnmarshalJSON", Method, 0},
+		{"(*Time).UnmarshalText", Method, 2},
+		{"(*Timer).Reset", Method, 1},
+		{"(*Timer).Stop", Method, 0},
+		{"(Duration).Abs", Method, 19},
+		{"(Duration).Hours", Method, 0},
+		{"(Duration).Microseconds", Method, 13},
+		{"(Duration).Milliseconds", Method, 13},
+		{"(Duration).Minutes", Method, 0},
+		{"(Duration).Nanoseconds", Method, 0},
+		{"(Duration).Round", Method, 9},
+		{"(Duration).Seconds", Method, 0},
+		{"(Duration).String", Method, 0},
+		{"(Duration).Truncate", Method, 9},
+		{"(Month).String", Method, 0},
+		{"(Time).Add", Method, 0},
+		{"(Time).AddDate", Method, 0},
+		{"(Time).After", Method, 0},
+		{"(Time).AppendFormat", Method, 5},
+		{"(Time).Before", Method, 0},
+		{"(Time).Clock", Method, 0},
+		{"(Time).Compare", Method, 20},
+		{"(Time).Date", Method, 0},
+		{"(Time).Day", Method, 0},
+		{"(Time).Equal", Method, 0},
+		{"(Time).Format", Method, 0},
+		{"(Time).GoString", Method, 17},
+		{"(Time).GobEncode", Method, 0},
+		{"(Time).Hour", Method, 0},
+		{"(Time).ISOWeek", Method, 0},
+		{"(Time).In", Method, 0},
+		{"(Time).IsDST", Method, 17},
+		{"(Time).IsZero", Method, 0},
+		{"(Time).Local", Method, 0},
+		{"(Time).Location", Method, 0},
+		{"(Time).MarshalBinary", Method, 2},
+		{"(Time).MarshalJSON", Method, 0},
+		{"(Time).MarshalText", Method, 2},
+		{"(Time).Minute", Method, 0},
+		{"(Time).Month", Method, 0},
+		{"(Time).Nanosecond", Method, 0},
+		{"(Time).Round", Method, 1},
+		{"(Time).Second", Method, 0},
+		{"(Time).String", Method, 0},
+		{"(Time).Sub", Method, 0},
+		{"(Time).Truncate", Method, 1},
+		{"(Time).UTC", Method, 0},
+		{"(Time).Unix", Method, 0},
+		{"(Time).UnixMicro", Method, 17},
+		{"(Time).UnixMilli", Method, 17},
+		{"(Time).UnixNano", Method, 0},
+		{"(Time).Weekday", Method, 0},
+		{"(Time).Year", Method, 0},
+		{"(Time).YearDay", Method, 1},
+		{"(Time).Zone", Method, 0},
+		{"(Time).ZoneBounds", Method, 19},
+		{"(Weekday).String", Method, 0},
+		{"ANSIC", Const, 0},
+		{"After", Func, 0},
+		{"AfterFunc", Func, 0},
+		{"April", Const, 0},
+		{"August", Const, 0},
+		{"Date", Func, 0},
+		{"DateOnly", Const, 20},
+		{"DateTime", Const, 20},
+		{"December", Const, 0},
+		{"Duration", Type, 0},
+		{"February", Const, 0},
+		{"FixedZone", Func, 0},
+		{"Friday", Const, 0},
+		{"Hour", Const, 0},
+		{"January", Const, 0},
+		{"July", Const, 0},
+		{"June", Const, 0},
+		{"Kitchen", Const, 0},
+		{"Layout", Const, 17},
+		{"LoadLocation", Func, 0},
+		{"LoadLocationFromTZData", Func, 10},
+		{"Local", Var, 0},
+		{"Location", Type, 0},
+		{"March", Const, 0},
+		{"May", Const, 0},
+		{"Microsecond", Const, 0},
+		{"Millisecond", Const, 0},
+		{"Minute", Const, 0},
+		{"Monday", Const, 0},
+		{"Month", Type, 0},
+		{"Nanosecond", Const, 0},
+		{"NewTicker", Func, 0},
+		{"NewTimer", Func, 0},
+		{"November", Const, 0},
+		{"Now", Func, 0},
+		{"October", Const, 0},
+		{"Parse", Func, 0},
+		{"ParseDuration", Func, 0},
+		{"ParseError", Type, 0},
+		{"ParseError.Layout", Field, 0},
+		{"ParseError.LayoutElem", Field, 0},
+		{"ParseError.Message", Field, 0},
+		{"ParseError.Value", Field, 0},
+		{"ParseError.ValueElem", Field, 0},
+		{"ParseInLocation", Func, 1},
+		{"RFC1123", Const, 0},
+		{"RFC1123Z", Const, 0},
+		{"RFC3339", Const, 0},
+		{"RFC3339Nano", Const, 0},
+		{"RFC822", Const, 0},
+		{"RFC822Z", Const, 0},
+		{"RFC850", Const, 0},
+		{"RubyDate", Const, 0},
+		{"Saturday", Const, 0},
+		{"Second", Const, 0},
+		{"September", Const, 0},
+		{"Since", Func, 0},
+		{"Sleep", Func, 0},
+		{"Stamp", Const, 0},
+		{"StampMicro", Const, 0},
+		{"StampMilli", Const, 0},
+		{"StampNano", Const, 0},
+		{"Sunday", Const, 0},
+		{"Thursday", Const, 0},
+		{"Tick", Func, 0},
+		{"Ticker", Type, 0},
+		{"Ticker.C", Field, 0},
+		{"Time", Type, 0},
+		{"TimeOnly", Const, 20},
+		{"Timer", Type, 0},
+		{"Timer.C", Field, 0},
+		{"Tuesday", Const, 0},
+		{"UTC", Var, 0},
+		{"Unix", Func, 0},
+		{"UnixDate", Const, 0},
+		{"UnixMicro", Func, 17},
+		{"UnixMilli", Func, 17},
+		{"Until", Func, 8},
+		{"Wednesday", Const, 0},
+		{"Weekday", Type, 0},
+	},
+	"unicode": {
+		{"(SpecialCase).ToLower", Method, 0},
+		{"(SpecialCase).ToTitle", Method, 0},
+		{"(SpecialCase).ToUpper", Method, 0},
+		{"ASCII_Hex_Digit", Var, 0},
+		{"Adlam", Var, 7},
+		{"Ahom", Var, 5},
+		{"Anatolian_Hieroglyphs", Var, 5},
+		{"Arabic", Var, 0},
+		{"Armenian", Var, 0},
+		{"Avestan", Var, 0},
+		{"AzeriCase", Var, 0},
+		{"Balinese", Var, 0},
+		{"Bamum", Var, 0},
+		{"Bassa_Vah", Var, 4},
+		{"Batak", Var, 0},
+		{"Bengali", Var, 0},
+		{"Bhaiksuki", Var, 7},
+		{"Bidi_Control", Var, 0},
+		{"Bopomofo", Var, 0},
+		{"Brahmi", Var, 0},
+		{"Braille", Var, 0},
+		{"Buginese", Var, 0},
+		{"Buhid", Var, 0},
+		{"C", Var, 0},
+		{"Canadian_Aboriginal", Var, 0},
+		{"Carian", Var, 0},
+		{"CaseRange", Type, 0},
+		{"CaseRange.Delta", Field, 0},
+		{"CaseRange.Hi", Field, 0},
+		{"CaseRange.Lo", Field, 0},
+		{"CaseRanges", Var, 0},
+		{"Categories", Var, 0},
+		{"Caucasian_Albanian", Var, 4},
+		{"Cc", Var, 0},
+		{"Cf", Var, 0},
+		{"Chakma", Var, 1},
+		{"Cham", Var, 0},
+		{"Cherokee", Var, 0},
+		{"Chorasmian", Var, 16},
+		{"Co", Var, 0},
+		{"Common", Var, 0},
+		{"Coptic", Var, 0},
+		{"Cs", Var, 0},
+		{"Cuneiform", Var, 0},
+		{"Cypriot", Var, 0},
+		{"Cypro_Minoan", Var, 21},
+		{"Cyrillic", Var, 0},
+		{"Dash", Var, 0},
+		{"Deprecated", Var, 0},
+		{"Deseret", Var, 0},
+		{"Devanagari", Var, 0},
+		{"Diacritic", Var, 0},
+		{"Digit", Var, 0},
+		{"Dives_Akuru", Var, 16},
+		{"Dogra", Var, 13},
+		{"Duployan", Var, 4},
+		{"Egyptian_Hieroglyphs", Var, 0},
+		{"Elbasan", Var, 4},
+		{"Elymaic", Var, 14},
+		{"Ethiopic", Var, 0},
+		{"Extender", Var, 0},
+		{"FoldCategory", Var, 0},
+		{"FoldScript", Var, 0},
+		{"Georgian", Var, 0},
+		{"Glagolitic", Var, 0},
+		{"Gothic", Var, 0},
+		{"Grantha", Var, 4},
+		{"GraphicRanges", Var, 0},
+		{"Greek", Var, 0},
+		{"Gujarati", Var, 0},
+		{"Gunjala_Gondi", Var, 13},
+		{"Gurmukhi", Var, 0},
+		{"Han", Var, 0},
+		{"Hangul", Var, 0},
+		{"Hanifi_Rohingya", Var, 13},
+		{"Hanunoo", Var, 0},
+		{"Hatran", Var, 5},
+		{"Hebrew", Var, 0},
+		{"Hex_Digit", Var, 0},
+		{"Hiragana", Var, 0},
+		{"Hyphen", Var, 0},
+		{"IDS_Binary_Operator", Var, 0},
+		{"IDS_Trinary_Operator", Var, 0},
+		{"Ideographic", Var, 0},
+		{"Imperial_Aramaic", Var, 0},
+		{"In", Func, 2},
+		{"Inherited", Var, 0},
+		{"Inscriptional_Pahlavi", Var, 0},
+		{"Inscriptional_Parthian", Var, 0},
+		{"Is", Func, 0},
+		{"IsControl", Func, 0},
+		{"IsDigit", Func, 0},
+		{"IsGraphic", Func, 0},
+		{"IsLetter", Func, 0},
+		{"IsLower", Func, 0},
+		{"IsMark", Func, 0},
+		{"IsNumber", Func, 0},
+		{"IsOneOf", Func, 0},
+		{"IsPrint", Func, 0},
+		{"IsPunct", Func, 0},
+		{"IsSpace", Func, 0},
+		{"IsSymbol", Func, 0},
+		{"IsTitle", Func, 0},
+		{"IsUpper", Func, 0},
+		{"Javanese", Var, 0},
+		{"Join_Control", Var, 0},
+		{"Kaithi", Var, 0},
+		{"Kannada", Var, 0},
+		{"Katakana", Var, 0},
+		{"Kawi", Var, 21},
+		{"Kayah_Li", Var, 0},
+		{"Kharoshthi", Var, 0},
+		{"Khitan_Small_Script", Var, 16},
+		{"Khmer", Var, 0},
+		{"Khojki", Var, 4},
+		{"Khudawadi", Var, 4},
+		{"L", Var, 0},
+		{"Lao", Var, 0},
+		{"Latin", Var, 0},
+		{"Lepcha", Var, 0},
+		{"Letter", Var, 0},
+		{"Limbu", Var, 0},
+		{"Linear_A", Var, 4},
+		{"Linear_B", Var, 0},
+		{"Lisu", Var, 0},
+		{"Ll", Var, 0},
+		{"Lm", Var, 0},
+		{"Lo", Var, 0},
+		{"Logical_Order_Exception", Var, 0},
+		{"Lower", Var, 0},
+		{"LowerCase", Const, 0},
+		{"Lt", Var, 0},
+		{"Lu", Var, 0},
+		{"Lycian", Var, 0},
+		{"Lydian", Var, 0},
+		{"M", Var, 0},
+		{"Mahajani", Var, 4},
+		{"Makasar", Var, 13},
+		{"Malayalam", Var, 0},
+		{"Mandaic", Var, 0},
+		{"Manichaean", Var, 4},
+		{"Marchen", Var, 7},
+		{"Mark", Var, 0},
+		{"Masaram_Gondi", Var, 10},
+		{"MaxASCII", Const, 0},
+		{"MaxCase", Const, 0},
+		{"MaxLatin1", Const, 0},
+		{"MaxRune", Const, 0},
+		{"Mc", Var, 0},
+		{"Me", Var, 0},
+		{"Medefaidrin", Var, 13},
+		{"Meetei_Mayek", Var, 0},
+		{"Mende_Kikakui", Var, 4},
+		{"Meroitic_Cursive", Var, 1},
+		{"Meroitic_Hieroglyphs", Var, 1},
+		{"Miao", Var, 1},
+		{"Mn", Var, 0},
+		{"Modi", Var, 4},
+		{"Mongolian", Var, 0},
+		{"Mro", Var, 4},
+		{"Multani", Var, 5},
+		{"Myanmar", Var, 0},
+		{"N", Var, 0},
+		{"Nabataean", Var, 4},
+		{"Nag_Mundari", Var, 21},
+		{"Nandinagari", Var, 14},
+		{"Nd", Var, 0},
+		{"New_Tai_Lue", Var, 0},
+		{"Newa", Var, 7},
+		{"Nko", Var, 0},
+		{"Nl", Var, 0},
+		{"No", Var, 0},
+		{"Noncharacter_Code_Point", Var, 0},
+		{"Number", Var, 0},
+		{"Nushu", Var, 10},
+		{"Nyiakeng_Puachue_Hmong", Var, 14},
+		{"Ogham", Var, 0},
+		{"Ol_Chiki", Var, 0},
+		{"Old_Hungarian", Var, 5},
+		{"Old_Italic", Var, 0},
+		{"Old_North_Arabian", Var, 4},
+		{"Old_Permic", Var, 4},
+		{"Old_Persian", Var, 0},
+		{"Old_Sogdian", Var, 13},
+		{"Old_South_Arabian", Var, 0},
+		{"Old_Turkic", Var, 0},
+		{"Old_Uyghur", Var, 21},
+		{"Oriya", Var, 0},
+		{"Osage", Var, 7},
+		{"Osmanya", Var, 0},
+		{"Other", Var, 0},
+		{"Other_Alphabetic", Var, 0},
+		{"Other_Default_Ignorable_Code_Point", Var, 0},
+		{"Other_Grapheme_Extend", Var, 0},
+		{"Other_ID_Continue", Var, 0},
+		{"Other_ID_Start", Var, 0},
+		{"Other_Lowercase", Var, 0},
+		{"Other_Math", Var, 0},
+		{"Other_Uppercase", Var, 0},
+		{"P", Var, 0},
+		{"Pahawh_Hmong", Var, 4},
+		{"Palmyrene", Var, 4},
+		{"Pattern_Syntax", Var, 0},
+		{"Pattern_White_Space", Var, 0},
+		{"Pau_Cin_Hau", Var, 4},
+		{"Pc", Var, 0},
+		{"Pd", Var, 0},
+		{"Pe", Var, 0},
+		{"Pf", Var, 0},
+		{"Phags_Pa", Var, 0},
+		{"Phoenician", Var, 0},
+		{"Pi", Var, 0},
+		{"Po", Var, 0},
+		{"Prepended_Concatenation_Mark", Var, 7},
+		{"PrintRanges", Var, 0},
+		{"Properties", Var, 0},
+		{"Ps", Var, 0},
+		{"Psalter_Pahlavi", Var, 4},
+		{"Punct", Var, 0},
+		{"Quotation_Mark", Var, 0},
+		{"Radical", Var, 0},
+		{"Range16", Type, 0},
+		{"Range16.Hi", Field, 0},
+		{"Range16.Lo", Field, 0},
+		{"Range16.Stride", Field, 0},
+		{"Range32", Type, 0},
+		{"Range32.Hi", Field, 0},
+		{"Range32.Lo", Field, 0},
+		{"Range32.Stride", Field, 0},
+		{"RangeTable", Type, 0},
+		{"RangeTable.LatinOffset", Field, 1},
+		{"RangeTable.R16", Field, 0},
+		{"RangeTable.R32", Field, 0},
+		{"Regional_Indicator", Var, 10},
+		{"Rejang", Var, 0},
+		{"ReplacementChar", Const, 0},
+		{"Runic", Var, 0},
+		{"S", Var, 0},
+		{"STerm", Var, 0},
+		{"Samaritan", Var, 0},
+		{"Saurashtra", Var, 0},
+		{"Sc", Var, 0},
+		{"Scripts", Var, 0},
+		{"Sentence_Terminal", Var, 7},
+		{"Sharada", Var, 1},
+		{"Shavian", Var, 0},
+		{"Siddham", Var, 4},
+		{"SignWriting", Var, 5},
+		{"SimpleFold", Func, 0},
+		{"Sinhala", Var, 0},
+		{"Sk", Var, 0},
+		{"Sm", Var, 0},
+		{"So", Var, 0},
+		{"Soft_Dotted", Var, 0},
+		{"Sogdian", Var, 13},
+		{"Sora_Sompeng", Var, 1},
+		{"Soyombo", Var, 10},
+		{"Space", Var, 0},
+		{"SpecialCase", Type, 0},
+		{"Sundanese", Var, 0},
+		{"Syloti_Nagri", Var, 0},
+		{"Symbol", Var, 0},
+		{"Syriac", Var, 0},
+		{"Tagalog", Var, 0},
+		{"Tagbanwa", Var, 0},
+		{"Tai_Le", Var, 0},
+		{"Tai_Tham", Var, 0},
+		{"Tai_Viet", Var, 0},
+		{"Takri", Var, 1},
+		{"Tamil", Var, 0},
+		{"Tangsa", Var, 21},
+		{"Tangut", Var, 7},
+		{"Telugu", Var, 0},
+		{"Terminal_Punctuation", Var, 0},
+		{"Thaana", Var, 0},
+		{"Thai", Var, 0},
+		{"Tibetan", Var, 0},
+		{"Tifinagh", Var, 0},
+		{"Tirhuta", Var, 4},
+		{"Title", Var, 0},
+		{"TitleCase", Const, 0},
+		{"To", Func, 0},
+		{"ToLower", Func, 0},
+		{"ToTitle", Func, 0},
+		{"ToUpper", Func, 0},
+		{"Toto", Var, 21},
+		{"TurkishCase", Var, 0},
+		{"Ugaritic", Var, 0},
+		{"Unified_Ideograph", Var, 0},
+		{"Upper", Var, 0},
+		{"UpperCase", Const, 0},
+		{"UpperLower", Const, 0},
+		{"Vai", Var, 0},
+		{"Variation_Selector", Var, 0},
+		{"Version", Const, 0},
+		{"Vithkuqi", Var, 21},
+		{"Wancho", Var, 14},
+		{"Warang_Citi", Var, 4},
+		{"White_Space", Var, 0},
+		{"Yezidi", Var, 16},
+		{"Yi", Var, 0},
+		{"Z", Var, 0},
+		{"Zanabazar_Square", Var, 10},
+		{"Zl", Var, 0},
+		{"Zp", Var, 0},
+		{"Zs", Var, 0},
+	},
+	"unicode/utf16": {
+		{"AppendRune", Func, 20},
+		{"Decode", Func, 0},
+		{"DecodeRune", Func, 0},
+		{"Encode", Func, 0},
+		{"EncodeRune", Func, 0},
+		{"IsSurrogate", Func, 0},
+	},
+	"unicode/utf8": {
+		{"AppendRune", Func, 18},
+		{"DecodeLastRune", Func, 0},
+		{"DecodeLastRuneInString", Func, 0},
+		{"DecodeRune", Func, 0},
+		{"DecodeRuneInString", Func, 0},
+		{"EncodeRune", Func, 0},
+		{"FullRune", Func, 0},
+		{"FullRuneInString", Func, 0},
+		{"MaxRune", Const, 0},
+		{"RuneCount", Func, 0},
+		{"RuneCountInString", Func, 0},
+		{"RuneError", Const, 0},
+		{"RuneLen", Func, 0},
+		{"RuneSelf", Const, 0},
+		{"RuneStart", Func, 0},
+		{"UTFMax", Const, 0},
+		{"Valid", Func, 0},
+		{"ValidRune", Func, 1},
+		{"ValidString", Func, 0},
+	},
+	"unsafe": {
+		{"Add", Func, 0},
+		{"Alignof", Func, 0},
+		{"Offsetof", Func, 0},
+		{"Pointer", Type, 0},
+		{"Sizeof", Func, 0},
+		{"Slice", Func, 0},
+		{"SliceData", Func, 0},
+		{"String", Func, 0},
+		{"StringData", Func, 0},
+	},
+}
diff --git a/vendor/golang.org/x/tools/internal/stdlib/stdlib.go b/vendor/golang.org/x/tools/internal/stdlib/stdlib.go
new file mode 100644
index 000000000..98904017f
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/stdlib/stdlib.go
@@ -0,0 +1,97 @@
+// Copyright 2022 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run generate.go
+
+// Package stdlib provides a table of all exported symbols in the
+// standard library, along with the version at which they first
+// appeared.
+package stdlib
+
+import (
+	"fmt"
+	"strings"
+)
+
+type Symbol struct {
+	Name    string
+	Kind    Kind
+	Version Version // Go version that first included the symbol
+}
+
+// A Kind indicates the kind of a symbol:
+// function, variable, constant, type, and so on.
+type Kind int8
+
+const (
+	Invalid Kind = iota // Example name:
+	Type                // "Buffer"
+	Func                // "Println"
+	Var                 // "EOF"
+	Const               // "Pi"
+	Field               // "Point.X"
+	Method              // "(*Buffer).Grow"
+)
+
+func (kind Kind) String() string {
+	return [...]string{
+		Invalid: "invalid",
+		Type:    "type",
+		Func:    "func",
+		Var:     "var",
+		Const:   "const",
+		Field:   "field",
+		Method:  "method",
+	}[kind]
+}
+
+// A Version represents a version of Go of the form "go1.%d".
+type Version int8
+
+// String returns a version string of the form "go1.23", without allocating.
+func (v Version) String() string { return versions[v] }
+
+var versions [30]string // (increase constant as needed)
+
+func init() {
+	for i := range versions {
+		versions[i] = fmt.Sprintf("go1.%d", i)
+	}
+}
+
+// HasPackage reports whether the specified package path is part of
+// the standard library's public API.
+func HasPackage(path string) bool {
+	_, ok := PackageSymbols[path]
+	return ok
+}
+
+// SplitField splits the field symbol name into type and field
+// components. It must be called only on Field symbols.
+//
+// Example: "File.Package" -> ("File", "Package")
+func (sym *Symbol) SplitField() (typename, name string) {
+	if sym.Kind != Field {
+		panic("not a field")
+	}
+	typename, name, _ = strings.Cut(sym.Name, ".")
+	return
+}
+
+// SplitMethod splits the method symbol name into pointer, receiver,
+// and method components. It must be called only on Method symbols.
+//
+// Example: "(*Buffer).Grow" -> (true, "Buffer", "Grow")
+func (sym *Symbol) SplitMethod() (ptr bool, recv, name string) {
+	if sym.Kind != Method {
+		panic("not a method")
+	}
+	recv, name, _ = strings.Cut(sym.Name, ".")
+	recv = recv[len("(") : len(recv)-len(")")]
+	ptr = recv[0] == '*'
+	if ptr {
+		recv = recv[len("*"):]
+	}
+	return
+}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/common.go b/vendor/golang.org/x/tools/internal/typeparams/common.go
deleted file mode 100644
index cfba8189f..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/common.go
+++ /dev/null
@@ -1,178 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package typeparams contains common utilities for writing tools that interact
-// with generic Go code, as introduced with Go 1.18.
-//
-// Many of the types and functions in this package are proxies for the new APIs
-// introduced in the standard library with Go 1.18. For example, the
-// typeparams.Union type is an alias for go/types.Union, and the ForTypeSpec
-// function returns the value of the go/ast.TypeSpec.TypeParams field. At Go
-// versions older than 1.18 these helpers are implemented as stubs, allowing
-// users of this package to write code that handles generic constructs inline,
-// even if the Go version being used to compile does not support generics.
-//
-// Additionally, this package contains common utilities for working with the
-// new generic constructs, to supplement the standard library APIs. Notably,
-// the StructuralTerms API computes a minimal representation of the structural
-// restrictions on a type parameter.
-//
-// An external version of these APIs is available in the
-// golang.org/x/exp/typeparams module.
-package typeparams
-
-import (
-	"go/ast"
-	"go/token"
-	"go/types"
-)
-
-// UnpackIndexExpr extracts data from AST nodes that represent index
-// expressions.
-//
-// For an ast.IndexExpr, the resulting indices slice will contain exactly one
-// index expression. For an ast.IndexListExpr (go1.18+), it may have a variable
-// number of index expressions.
-//
-// For nodes that don't represent index expressions, the first return value of
-// UnpackIndexExpr will be nil.
-func UnpackIndexExpr(n ast.Node) (x ast.Expr, lbrack token.Pos, indices []ast.Expr, rbrack token.Pos) {
-	switch e := n.(type) {
-	case *ast.IndexExpr:
-		return e.X, e.Lbrack, []ast.Expr{e.Index}, e.Rbrack
-	case *IndexListExpr:
-		return e.X, e.Lbrack, e.Indices, e.Rbrack
-	}
-	return nil, token.NoPos, nil, token.NoPos
-}
-
-// PackIndexExpr returns an *ast.IndexExpr or *ast.IndexListExpr, depending on
-// the cardinality of indices. Calling PackIndexExpr with len(indices) == 0
-// will panic.
-func PackIndexExpr(x ast.Expr, lbrack token.Pos, indices []ast.Expr, rbrack token.Pos) ast.Expr {
-	switch len(indices) {
-	case 0:
-		panic("empty indices")
-	case 1:
-		return &ast.IndexExpr{
-			X:      x,
-			Lbrack: lbrack,
-			Index:  indices[0],
-			Rbrack: rbrack,
-		}
-	default:
-		return &IndexListExpr{
-			X:       x,
-			Lbrack:  lbrack,
-			Indices: indices,
-			Rbrack:  rbrack,
-		}
-	}
-}
-
-// IsTypeParam reports whether t is a type parameter.
-func IsTypeParam(t types.Type) bool {
-	_, ok := t.(*TypeParam)
-	return ok
-}
-
-// OriginMethod returns the origin method associated with the method fn.
-// For methods on a non-generic receiver base type, this is just
-// fn. However, for methods with a generic receiver, OriginMethod returns the
-// corresponding method in the method set of the origin type.
-//
-// As a special case, if fn is not a method (has no receiver), OriginMethod
-// returns fn.
-func OriginMethod(fn *types.Func) *types.Func {
-	recv := fn.Type().(*types.Signature).Recv()
-	if recv == nil {
-		return fn
-	}
-	base := recv.Type()
-	p, isPtr := base.(*types.Pointer)
-	if isPtr {
-		base = p.Elem()
-	}
-	named, isNamed := base.(*types.Named)
-	if !isNamed {
-		// Receiver is a *types.Interface.
-		return fn
-	}
-	if ForNamed(named).Len() == 0 {
-		// Receiver base has no type parameters, so we can avoid the lookup below.
-		return fn
-	}
-	orig := NamedTypeOrigin(named)
-	gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name())
-	return gfn.(*types.Func)
-}
-
-// GenericAssignableTo is a generalization of types.AssignableTo that
-// implements the following rule for uninstantiated generic types:
-//
-// If V and T are generic named types, then V is considered assignable to T if,
-// for every possible instantation of V[A_1, ..., A_N], the instantiation
-// T[A_1, ..., A_N] is valid and V[A_1, ..., A_N] implements T[A_1, ..., A_N].
-//
-// If T has structural constraints, they must be satisfied by V.
-//
-// For example, consider the following type declarations:
-//
-//	type Interface[T any] interface {
-//		Accept(T)
-//	}
-//
-//	type Container[T any] struct {
-//		Element T
-//	}
-//
-//	func (c Container[T]) Accept(t T) { c.Element = t }
-//
-// In this case, GenericAssignableTo reports that instantiations of Container
-// are assignable to the corresponding instantiation of Interface.
-func GenericAssignableTo(ctxt *Context, V, T types.Type) bool {
-	// If V and T are not both named, or do not have matching non-empty type
-	// parameter lists, fall back on types.AssignableTo.
-
-	VN, Vnamed := V.(*types.Named)
-	TN, Tnamed := T.(*types.Named)
-	if !Vnamed || !Tnamed {
-		return types.AssignableTo(V, T)
-	}
-
-	vtparams := ForNamed(VN)
-	ttparams := ForNamed(TN)
-	if vtparams.Len() == 0 || vtparams.Len() != ttparams.Len() || NamedTypeArgs(VN).Len() != 0 || NamedTypeArgs(TN).Len() != 0 {
-		return types.AssignableTo(V, T)
-	}
-
-	// V and T have the same (non-zero) number of type params. Instantiate both
-	// with the type parameters of V. This must always succeed for V, and will
-	// succeed for T if and only if the type set of each type parameter of V is a
-	// subset of the type set of the corresponding type parameter of T, meaning
-	// that every instantiation of V corresponds to a valid instantiation of T.
-
-	// Minor optimization: ensure we share a context across the two
-	// instantiations below.
-	if ctxt == nil {
-		ctxt = NewContext()
-	}
-
-	var targs []types.Type
-	for i := 0; i < vtparams.Len(); i++ {
-		targs = append(targs, vtparams.At(i))
-	}
-
-	vinst, err := Instantiate(ctxt, V, targs, true)
-	if err != nil {
-		panic("type parameters should satisfy their own constraints")
-	}
-
-	tinst, err := Instantiate(ctxt, T, targs, true)
-	if err != nil {
-		return false
-	}
-
-	return types.AssignableTo(vinst, tinst)
-}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/coretype.go b/vendor/golang.org/x/tools/internal/typeparams/coretype.go
deleted file mode 100644
index 993135ec9..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/coretype.go
+++ /dev/null
@@ -1,122 +0,0 @@
-// Copyright 2022 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package typeparams
-
-import (
-	"go/types"
-)
-
-// CoreType returns the core type of T or nil if T does not have a core type.
-//
-// See https://go.dev/ref/spec#Core_types for the definition of a core type.
-func CoreType(T types.Type) types.Type {
-	U := T.Underlying()
-	if _, ok := U.(*types.Interface); !ok {
-		return U // for non-interface types,
-	}
-
-	terms, err := _NormalTerms(U)
-	if len(terms) == 0 || err != nil {
-		// len(terms) -> empty type set of interface.
-		// err != nil => U is invalid, exceeds complexity bounds, or has an empty type set.
-		return nil // no core type.
-	}
-
-	U = terms[0].Type().Underlying()
-	var identical int // i in [0,identical) => Identical(U, terms[i].Type().Underlying())
-	for identical = 1; identical < len(terms); identical++ {
-		if !types.Identical(U, terms[identical].Type().Underlying()) {
-			break
-		}
-	}
-
-	if identical == len(terms) {
-		// https://go.dev/ref/spec#Core_types
-		// "There is a single type U which is the underlying type of all types in the type set of T"
-		return U
-	}
-	ch, ok := U.(*types.Chan)
-	if !ok {
-		return nil // no core type as identical < len(terms) and U is not a channel.
-	}
-	// https://go.dev/ref/spec#Core_types
-	// "the type chan E if T contains only bidirectional channels, or the type chan<- E or
-	// <-chan E depending on the direction of the directional channels present."
-	for chans := identical; chans < len(terms); chans++ {
-		curr, ok := terms[chans].Type().Underlying().(*types.Chan)
-		if !ok {
-			return nil
-		}
-		if !types.Identical(ch.Elem(), curr.Elem()) {
-			return nil // channel elements are not identical.
-		}
-		if ch.Dir() == types.SendRecv {
-			// ch is bidirectional. We can safely always use curr's direction.
-			ch = curr
-		} else if curr.Dir() != types.SendRecv && ch.Dir() != curr.Dir() {
-			// ch and curr are not bidirectional and not the same direction.
-			return nil
-		}
-	}
-	return ch
-}
-
-// _NormalTerms returns a slice of terms representing the normalized structural
-// type restrictions of a type, if any.
-//
-// For all types other than *types.TypeParam, *types.Interface, and
-// *types.Union, this is just a single term with Tilde() == false and
-// Type() == typ. For *types.TypeParam, *types.Interface, and *types.Union, see
-// below.
-//
-// Structural type restrictions of a type parameter are created via
-// non-interface types embedded in its constraint interface (directly, or via a
-// chain of interface embeddings). For example, in the declaration type
-// T[P interface{~int; m()}] int the structural restriction of the type
-// parameter P is ~int.
-//
-// With interface embedding and unions, the specification of structural type
-// restrictions may be arbitrarily complex. For example, consider the
-// following:
-//
-//  type A interface{ ~string|~[]byte }
-//
-//  type B interface{ int|string }
-//
-//  type C interface { ~string|~int }
-//
-//  type T[P interface{ A|B; C }] int
-//
-// In this example, the structural type restriction of P is ~string|int: A|B
-// expands to ~string|~[]byte|int|string, which reduces to ~string|~[]byte|int,
-// which when intersected with C (~string|~int) yields ~string|int.
-//
-// _NormalTerms computes these expansions and reductions, producing a
-// "normalized" form of the embeddings. A structural restriction is normalized
-// if it is a single union containing no interface terms, and is minimal in the
-// sense that removing any term changes the set of types satisfying the
-// constraint. It is left as a proof for the reader that, modulo sorting, there
-// is exactly one such normalized form.
-//
-// Because the minimal representation always takes this form, _NormalTerms
-// returns a slice of tilde terms corresponding to the terms of the union in
-// the normalized structural restriction. An error is returned if the type is
-// invalid, exceeds complexity bounds, or has an empty type set. In the latter
-// case, _NormalTerms returns ErrEmptyTypeSet.
-//
-// _NormalTerms makes no guarantees about the order of terms, except that it
-// is deterministic.
-func _NormalTerms(typ types.Type) ([]*Term, error) {
-	switch typ := typ.(type) {
-	case *TypeParam:
-		return StructuralTerms(typ)
-	case *Union:
-		return UnionTermSet(typ)
-	case *types.Interface:
-		return InterfaceTermSet(typ)
-	default:
-		return []*Term{NewTerm(false, typ)}, nil
-	}
-}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/enabled_go117.go b/vendor/golang.org/x/tools/internal/typeparams/enabled_go117.go
deleted file mode 100644
index 18212390e..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/enabled_go117.go
+++ /dev/null
@@ -1,12 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build !go1.18
-// +build !go1.18
-
-package typeparams
-
-// Enabled reports whether type parameters are enabled in the current build
-// environment.
-const Enabled = false
diff --git a/vendor/golang.org/x/tools/internal/typeparams/enabled_go118.go b/vendor/golang.org/x/tools/internal/typeparams/enabled_go118.go
deleted file mode 100644
index d67148823..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/enabled_go118.go
+++ /dev/null
@@ -1,15 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build go1.18
-// +build go1.18
-
-package typeparams
-
-// Note: this constant is in a separate file as this is the only acceptable
-// diff between the <1.18 API of this package and the 1.18 API.
-
-// Enabled reports whether type parameters are enabled in the current build
-// environment.
-const Enabled = true
diff --git a/vendor/golang.org/x/tools/internal/typeparams/normalize.go b/vendor/golang.org/x/tools/internal/typeparams/normalize.go
deleted file mode 100644
index 9c631b651..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/normalize.go
+++ /dev/null
@@ -1,218 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package typeparams
-
-import (
-	"errors"
-	"fmt"
-	"go/types"
-	"os"
-	"strings"
-)
-
-//go:generate go run copytermlist.go
-
-const debug = false
-
-var ErrEmptyTypeSet = errors.New("empty type set")
-
-// StructuralTerms returns a slice of terms representing the normalized
-// structural type restrictions of a type parameter, if any.
-//
-// Structural type restrictions of a type parameter are created via
-// non-interface types embedded in its constraint interface (directly, or via a
-// chain of interface embeddings). For example, in the declaration
-//
-//	type T[P interface{~int; m()}] int
-//
-// the structural restriction of the type parameter P is ~int.
-//
-// With interface embedding and unions, the specification of structural type
-// restrictions may be arbitrarily complex. For example, consider the
-// following:
-//
-//	type A interface{ ~string|~[]byte }
-//
-//	type B interface{ int|string }
-//
-//	type C interface { ~string|~int }
-//
-//	type T[P interface{ A|B; C }] int
-//
-// In this example, the structural type restriction of P is ~string|int: A|B
-// expands to ~string|~[]byte|int|string, which reduces to ~string|~[]byte|int,
-// which when intersected with C (~string|~int) yields ~string|int.
-//
-// StructuralTerms computes these expansions and reductions, producing a
-// "normalized" form of the embeddings. A structural restriction is normalized
-// if it is a single union containing no interface terms, and is minimal in the
-// sense that removing any term changes the set of types satisfying the
-// constraint. It is left as a proof for the reader that, modulo sorting, there
-// is exactly one such normalized form.
-//
-// Because the minimal representation always takes this form, StructuralTerms
-// returns a slice of tilde terms corresponding to the terms of the union in
-// the normalized structural restriction. An error is returned if the
-// constraint interface is invalid, exceeds complexity bounds, or has an empty
-// type set. In the latter case, StructuralTerms returns ErrEmptyTypeSet.
-//
-// StructuralTerms makes no guarantees about the order of terms, except that it
-// is deterministic.
-func StructuralTerms(tparam *TypeParam) ([]*Term, error) {
-	constraint := tparam.Constraint()
-	if constraint == nil {
-		return nil, fmt.Errorf("%s has nil constraint", tparam)
-	}
-	iface, _ := constraint.Underlying().(*types.Interface)
-	if iface == nil {
-		return nil, fmt.Errorf("constraint is %T, not *types.Interface", constraint.Underlying())
-	}
-	return InterfaceTermSet(iface)
-}
-
-// InterfaceTermSet computes the normalized terms for a constraint interface,
-// returning an error if the term set cannot be computed or is empty. In the
-// latter case, the error will be ErrEmptyTypeSet.
-//
-// See the documentation of StructuralTerms for more information on
-// normalization.
-func InterfaceTermSet(iface *types.Interface) ([]*Term, error) {
-	return computeTermSet(iface)
-}
-
-// UnionTermSet computes the normalized terms for a union, returning an error
-// if the term set cannot be computed or is empty. In the latter case, the
-// error will be ErrEmptyTypeSet.
-//
-// See the documentation of StructuralTerms for more information on
-// normalization.
-func UnionTermSet(union *Union) ([]*Term, error) {
-	return computeTermSet(union)
-}
-
-func computeTermSet(typ types.Type) ([]*Term, error) {
-	tset, err := computeTermSetInternal(typ, make(map[types.Type]*termSet), 0)
-	if err != nil {
-		return nil, err
-	}
-	if tset.terms.isEmpty() {
-		return nil, ErrEmptyTypeSet
-	}
-	if tset.terms.isAll() {
-		return nil, nil
-	}
-	var terms []*Term
-	for _, term := range tset.terms {
-		terms = append(terms, NewTerm(term.tilde, term.typ))
-	}
-	return terms, nil
-}
-
-// A termSet holds the normalized set of terms for a given type.
-//
-// The name termSet is intentionally distinct from 'type set': a type set is
-// all types that implement a type (and includes method restrictions), whereas
-// a term set just represents the structural restrictions on a type.
-type termSet struct {
-	complete bool
-	terms    termlist
-}
-
-func indentf(depth int, format string, args ...interface{}) {
-	fmt.Fprintf(os.Stderr, strings.Repeat(".", depth)+format+"\n", args...)
-}
-
-func computeTermSetInternal(t types.Type, seen map[types.Type]*termSet, depth int) (res *termSet, err error) {
-	if t == nil {
-		panic("nil type")
-	}
-
-	if debug {
-		indentf(depth, "%s", t.String())
-		defer func() {
-			if err != nil {
-				indentf(depth, "=> %s", err)
-			} else {
-				indentf(depth, "=> %s", res.terms.String())
-			}
-		}()
-	}
-
-	const maxTermCount = 100
-	if tset, ok := seen[t]; ok {
-		if !tset.complete {
-			return nil, fmt.Errorf("cycle detected in the declaration of %s", t)
-		}
-		return tset, nil
-	}
-
-	// Mark the current type as seen to avoid infinite recursion.
-	tset := new(termSet)
-	defer func() {
-		tset.complete = true
-	}()
-	seen[t] = tset
-
-	switch u := t.Underlying().(type) {
-	case *types.Interface:
-		// The term set of an interface is the intersection of the term sets of its
-		// embedded types.
-		tset.terms = allTermlist
-		for i := 0; i < u.NumEmbeddeds(); i++ {
-			embedded := u.EmbeddedType(i)
-			if _, ok := embedded.Underlying().(*TypeParam); ok {
-				return nil, fmt.Errorf("invalid embedded type %T", embedded)
-			}
-			tset2, err := computeTermSetInternal(embedded, seen, depth+1)
-			if err != nil {
-				return nil, err
-			}
-			tset.terms = tset.terms.intersect(tset2.terms)
-		}
-	case *Union:
-		// The term set of a union is the union of term sets of its terms.
-		tset.terms = nil
-		for i := 0; i < u.Len(); i++ {
-			t := u.Term(i)
-			var terms termlist
-			switch t.Type().Underlying().(type) {
-			case *types.Interface:
-				tset2, err := computeTermSetInternal(t.Type(), seen, depth+1)
-				if err != nil {
-					return nil, err
-				}
-				terms = tset2.terms
-			case *TypeParam, *Union:
-				// A stand-alone type parameter or union is not permitted as union
-				// term.
-				return nil, fmt.Errorf("invalid union term %T", t)
-			default:
-				if t.Type() == types.Typ[types.Invalid] {
-					continue
-				}
-				terms = termlist{{t.Tilde(), t.Type()}}
-			}
-			tset.terms = tset.terms.union(terms)
-			if len(tset.terms) > maxTermCount {
-				return nil, fmt.Errorf("exceeded max term count %d", maxTermCount)
-			}
-		}
-	case *TypeParam:
-		panic("unreachable")
-	default:
-		// For all other types, the term set is just a single non-tilde term
-		// holding the type itself.
-		if u != types.Typ[types.Invalid] {
-			tset.terms = termlist{{false, t}}
-		}
-	}
-	return tset, nil
-}
-
-// under is a facade for the go/types internal function of the same name. It is
-// used by typeterm.go.
-func under(t types.Type) types.Type {
-	return t.Underlying()
-}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/termlist.go b/vendor/golang.org/x/tools/internal/typeparams/termlist.go
deleted file mode 100644
index 933106a23..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/termlist.go
+++ /dev/null
@@ -1,163 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Code generated by copytermlist.go DO NOT EDIT.
-
-package typeparams
-
-import (
-	"bytes"
-	"go/types"
-)
-
-// A termlist represents the type set represented by the union
-// t1 ∪ y2 ∪ ... tn of the type sets of the terms t1 to tn.
-// A termlist is in normal form if all terms are disjoint.
-// termlist operations don't require the operands to be in
-// normal form.
-type termlist []*term
-
-// allTermlist represents the set of all types.
-// It is in normal form.
-var allTermlist = termlist{new(term)}
-
-// String prints the termlist exactly (without normalization).
-func (xl termlist) String() string {
-	if len(xl) == 0 {
-		return "∅"
-	}
-	var buf bytes.Buffer
-	for i, x := range xl {
-		if i > 0 {
-			buf.WriteString(" ∪ ")
-		}
-		buf.WriteString(x.String())
-	}
-	return buf.String()
-}
-
-// isEmpty reports whether the termlist xl represents the empty set of types.
-func (xl termlist) isEmpty() bool {
-	// If there's a non-nil term, the entire list is not empty.
-	// If the termlist is in normal form, this requires at most
-	// one iteration.
-	for _, x := range xl {
-		if x != nil {
-			return false
-		}
-	}
-	return true
-}
-
-// isAll reports whether the termlist xl represents the set of all types.
-func (xl termlist) isAll() bool {
-	// If there's a � term, the entire list is �.
-	// If the termlist is in normal form, this requires at most
-	// one iteration.
-	for _, x := range xl {
-		if x != nil && x.typ == nil {
-			return true
-		}
-	}
-	return false
-}
-
-// norm returns the normal form of xl.
-func (xl termlist) norm() termlist {
-	// Quadratic algorithm, but good enough for now.
-	// TODO(gri) fix asymptotic performance
-	used := make([]bool, len(xl))
-	var rl termlist
-	for i, xi := range xl {
-		if xi == nil || used[i] {
-			continue
-		}
-		for j := i + 1; j < len(xl); j++ {
-			xj := xl[j]
-			if xj == nil || used[j] {
-				continue
-			}
-			if u1, u2 := xi.union(xj); u2 == nil {
-				// If we encounter a � term, the entire list is �.
-				// Exit early.
-				// (Note that this is not just an optimization;
-				// if we continue, we may end up with a � term
-				// and other terms and the result would not be
-				// in normal form.)
-				if u1.typ == nil {
-					return allTermlist
-				}
-				xi = u1
-				used[j] = true // xj is now unioned into xi - ignore it in future iterations
-			}
-		}
-		rl = append(rl, xi)
-	}
-	return rl
-}
-
-// union returns the union xl ∪ yl.
-func (xl termlist) union(yl termlist) termlist {
-	return append(xl, yl...).norm()
-}
-
-// intersect returns the intersection xl ∩ yl.
-func (xl termlist) intersect(yl termlist) termlist {
-	if xl.isEmpty() || yl.isEmpty() {
-		return nil
-	}
-
-	// Quadratic algorithm, but good enough for now.
-	// TODO(gri) fix asymptotic performance
-	var rl termlist
-	for _, x := range xl {
-		for _, y := range yl {
-			if r := x.intersect(y); r != nil {
-				rl = append(rl, r)
-			}
-		}
-	}
-	return rl.norm()
-}
-
-// equal reports whether xl and yl represent the same type set.
-func (xl termlist) equal(yl termlist) bool {
-	// TODO(gri) this should be more efficient
-	return xl.subsetOf(yl) && yl.subsetOf(xl)
-}
-
-// includes reports whether t ∈ xl.
-func (xl termlist) includes(t types.Type) bool {
-	for _, x := range xl {
-		if x.includes(t) {
-			return true
-		}
-	}
-	return false
-}
-
-// supersetOf reports whether y ⊆ xl.
-func (xl termlist) supersetOf(y *term) bool {
-	for _, x := range xl {
-		if y.subsetOf(x) {
-			return true
-		}
-	}
-	return false
-}
-
-// subsetOf reports whether xl ⊆ yl.
-func (xl termlist) subsetOf(yl termlist) bool {
-	if yl.isEmpty() {
-		return xl.isEmpty()
-	}
-
-	// each term x of xl must be a subset of yl
-	for _, x := range xl {
-		if !yl.supersetOf(x) {
-			return false // x is not a subset yl
-		}
-	}
-	return true
-}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go
deleted file mode 100644
index b4788978f..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go
+++ /dev/null
@@ -1,197 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build !go1.18
-// +build !go1.18
-
-package typeparams
-
-import (
-	"go/ast"
-	"go/token"
-	"go/types"
-)
-
-func unsupported() {
-	panic("type parameters are unsupported at this go version")
-}
-
-// IndexListExpr is a placeholder type, as type parameters are not supported at
-// this Go version. Its methods panic on use.
-type IndexListExpr struct {
-	ast.Expr
-	X       ast.Expr   // expression
-	Lbrack  token.Pos  // position of "["
-	Indices []ast.Expr // index expressions
-	Rbrack  token.Pos  // position of "]"
-}
-
-// ForTypeSpec returns an empty field list, as type parameters on not supported
-// at this Go version.
-func ForTypeSpec(*ast.TypeSpec) *ast.FieldList {
-	return nil
-}
-
-// ForFuncType returns an empty field list, as type parameters are not
-// supported at this Go version.
-func ForFuncType(*ast.FuncType) *ast.FieldList {
-	return nil
-}
-
-// TypeParam is a placeholder type, as type parameters are not supported at
-// this Go version. Its methods panic on use.
-type TypeParam struct{ types.Type }
-
-func (*TypeParam) Index() int             { unsupported(); return 0 }
-func (*TypeParam) Constraint() types.Type { unsupported(); return nil }
-func (*TypeParam) Obj() *types.TypeName   { unsupported(); return nil }
-
-// TypeParamList is a placeholder for an empty type parameter list.
-type TypeParamList struct{}
-
-func (*TypeParamList) Len() int          { return 0 }
-func (*TypeParamList) At(int) *TypeParam { unsupported(); return nil }
-
-// TypeList is a placeholder for an empty type list.
-type TypeList struct{}
-
-func (*TypeList) Len() int          { return 0 }
-func (*TypeList) At(int) types.Type { unsupported(); return nil }
-
-// NewTypeParam is unsupported at this Go version, and panics.
-func NewTypeParam(name *types.TypeName, constraint types.Type) *TypeParam {
-	unsupported()
-	return nil
-}
-
-// SetTypeParamConstraint is unsupported at this Go version, and panics.
-func SetTypeParamConstraint(tparam *TypeParam, constraint types.Type) {
-	unsupported()
-}
-
-// NewSignatureType calls types.NewSignature, panicking if recvTypeParams or
-// typeParams is non-empty.
-func NewSignatureType(recv *types.Var, recvTypeParams, typeParams []*TypeParam, params, results *types.Tuple, variadic bool) *types.Signature {
-	if len(recvTypeParams) != 0 || len(typeParams) != 0 {
-		panic("signatures cannot have type parameters at this Go version")
-	}
-	return types.NewSignature(recv, params, results, variadic)
-}
-
-// ForSignature returns an empty slice.
-func ForSignature(*types.Signature) *TypeParamList {
-	return nil
-}
-
-// RecvTypeParams returns a nil slice.
-func RecvTypeParams(sig *types.Signature) *TypeParamList {
-	return nil
-}
-
-// IsComparable returns false, as no interfaces are type-restricted at this Go
-// version.
-func IsComparable(*types.Interface) bool {
-	return false
-}
-
-// IsMethodSet returns true, as no interfaces are type-restricted at this Go
-// version.
-func IsMethodSet(*types.Interface) bool {
-	return true
-}
-
-// IsImplicit returns false, as no interfaces are implicit at this Go version.
-func IsImplicit(*types.Interface) bool {
-	return false
-}
-
-// MarkImplicit does nothing, because this Go version does not have implicit
-// interfaces.
-func MarkImplicit(*types.Interface) {}
-
-// ForNamed returns an empty type parameter list, as type parameters are not
-// supported at this Go version.
-func ForNamed(*types.Named) *TypeParamList {
-	return nil
-}
-
-// SetForNamed panics if tparams is non-empty.
-func SetForNamed(_ *types.Named, tparams []*TypeParam) {
-	if len(tparams) > 0 {
-		unsupported()
-	}
-}
-
-// NamedTypeArgs returns nil.
-func NamedTypeArgs(*types.Named) *TypeList {
-	return nil
-}
-
-// NamedTypeOrigin is the identity method at this Go version.
-func NamedTypeOrigin(named *types.Named) types.Type {
-	return named
-}
-
-// Term holds information about a structural type restriction.
-type Term struct {
-	tilde bool
-	typ   types.Type
-}
-
-func (m *Term) Tilde() bool      { return m.tilde }
-func (m *Term) Type() types.Type { return m.typ }
-func (m *Term) String() string {
-	pre := ""
-	if m.tilde {
-		pre = "~"
-	}
-	return pre + m.typ.String()
-}
-
-// NewTerm is unsupported at this Go version, and panics.
-func NewTerm(tilde bool, typ types.Type) *Term {
-	return &Term{tilde, typ}
-}
-
-// Union is a placeholder type, as type parameters are not supported at this Go
-// version. Its methods panic on use.
-type Union struct{ types.Type }
-
-func (*Union) Len() int         { return 0 }
-func (*Union) Term(i int) *Term { unsupported(); return nil }
-
-// NewUnion is unsupported at this Go version, and panics.
-func NewUnion(terms []*Term) *Union {
-	unsupported()
-	return nil
-}
-
-// InitInstanceInfo is a noop at this Go version.
-func InitInstanceInfo(*types.Info) {}
-
-// Instance is a placeholder type, as type parameters are not supported at this
-// Go version.
-type Instance struct {
-	TypeArgs *TypeList
-	Type     types.Type
-}
-
-// GetInstances returns a nil map, as type parameters are not supported at this
-// Go version.
-func GetInstances(info *types.Info) map[*ast.Ident]Instance { return nil }
-
-// Context is a placeholder type, as type parameters are not supported at
-// this Go version.
-type Context struct{}
-
-// NewContext returns a placeholder Context instance.
-func NewContext() *Context {
-	return &Context{}
-}
-
-// Instantiate is unsupported on this Go version, and panics.
-func Instantiate(ctxt *Context, typ types.Type, targs []types.Type, validate bool) (types.Type, error) {
-	unsupported()
-	return nil, nil
-}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go
deleted file mode 100644
index 114a36b86..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go
+++ /dev/null
@@ -1,151 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build go1.18
-// +build go1.18
-
-package typeparams
-
-import (
-	"go/ast"
-	"go/types"
-)
-
-// IndexListExpr is an alias for ast.IndexListExpr.
-type IndexListExpr = ast.IndexListExpr
-
-// ForTypeSpec returns n.TypeParams.
-func ForTypeSpec(n *ast.TypeSpec) *ast.FieldList {
-	if n == nil {
-		return nil
-	}
-	return n.TypeParams
-}
-
-// ForFuncType returns n.TypeParams.
-func ForFuncType(n *ast.FuncType) *ast.FieldList {
-	if n == nil {
-		return nil
-	}
-	return n.TypeParams
-}
-
-// TypeParam is an alias for types.TypeParam
-type TypeParam = types.TypeParam
-
-// TypeParamList is an alias for types.TypeParamList
-type TypeParamList = types.TypeParamList
-
-// TypeList is an alias for types.TypeList
-type TypeList = types.TypeList
-
-// NewTypeParam calls types.NewTypeParam.
-func NewTypeParam(name *types.TypeName, constraint types.Type) *TypeParam {
-	return types.NewTypeParam(name, constraint)
-}
-
-// SetTypeParamConstraint calls tparam.SetConstraint(constraint).
-func SetTypeParamConstraint(tparam *TypeParam, constraint types.Type) {
-	tparam.SetConstraint(constraint)
-}
-
-// NewSignatureType calls types.NewSignatureType.
-func NewSignatureType(recv *types.Var, recvTypeParams, typeParams []*TypeParam, params, results *types.Tuple, variadic bool) *types.Signature {
-	return types.NewSignatureType(recv, recvTypeParams, typeParams, params, results, variadic)
-}
-
-// ForSignature returns sig.TypeParams()
-func ForSignature(sig *types.Signature) *TypeParamList {
-	return sig.TypeParams()
-}
-
-// RecvTypeParams returns sig.RecvTypeParams().
-func RecvTypeParams(sig *types.Signature) *TypeParamList {
-	return sig.RecvTypeParams()
-}
-
-// IsComparable calls iface.IsComparable().
-func IsComparable(iface *types.Interface) bool {
-	return iface.IsComparable()
-}
-
-// IsMethodSet calls iface.IsMethodSet().
-func IsMethodSet(iface *types.Interface) bool {
-	return iface.IsMethodSet()
-}
-
-// IsImplicit calls iface.IsImplicit().
-func IsImplicit(iface *types.Interface) bool {
-	return iface.IsImplicit()
-}
-
-// MarkImplicit calls iface.MarkImplicit().
-func MarkImplicit(iface *types.Interface) {
-	iface.MarkImplicit()
-}
-
-// ForNamed extracts the (possibly empty) type parameter object list from
-// named.
-func ForNamed(named *types.Named) *TypeParamList {
-	return named.TypeParams()
-}
-
-// SetForNamed sets the type params tparams on n. Each tparam must be of
-// dynamic type *types.TypeParam.
-func SetForNamed(n *types.Named, tparams []*TypeParam) {
-	n.SetTypeParams(tparams)
-}
-
-// NamedTypeArgs returns named.TypeArgs().
-func NamedTypeArgs(named *types.Named) *TypeList {
-	return named.TypeArgs()
-}
-
-// NamedTypeOrigin returns named.Orig().
-func NamedTypeOrigin(named *types.Named) types.Type {
-	return named.Origin()
-}
-
-// Term is an alias for types.Term.
-type Term = types.Term
-
-// NewTerm calls types.NewTerm.
-func NewTerm(tilde bool, typ types.Type) *Term {
-	return types.NewTerm(tilde, typ)
-}
-
-// Union is an alias for types.Union
-type Union = types.Union
-
-// NewUnion calls types.NewUnion.
-func NewUnion(terms []*Term) *Union {
-	return types.NewUnion(terms)
-}
-
-// InitInstanceInfo initializes info to record information about type and
-// function instances.
-func InitInstanceInfo(info *types.Info) {
-	info.Instances = make(map[*ast.Ident]types.Instance)
-}
-
-// Instance is an alias for types.Instance.
-type Instance = types.Instance
-
-// GetInstances returns info.Instances.
-func GetInstances(info *types.Info) map[*ast.Ident]Instance {
-	return info.Instances
-}
-
-// Context is an alias for types.Context.
-type Context = types.Context
-
-// NewContext calls types.NewContext.
-func NewContext() *Context {
-	return types.NewContext()
-}
-
-// Instantiate calls types.Instantiate.
-func Instantiate(ctxt *Context, typ types.Type, targs []types.Type, validate bool) (types.Type, error) {
-	return types.Instantiate(ctxt, typ, targs, validate)
-}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeterm.go b/vendor/golang.org/x/tools/internal/typeparams/typeterm.go
deleted file mode 100644
index 7ddee28d9..000000000
--- a/vendor/golang.org/x/tools/internal/typeparams/typeterm.go
+++ /dev/null
@@ -1,170 +0,0 @@
-// Copyright 2021 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Code generated by copytermlist.go DO NOT EDIT.
-
-package typeparams
-
-import "go/types"
-
-// A term describes elementary type sets:
-//
-//   ∅:  (*term)(nil)     == ∅                      // set of no types (empty set)
-//   �:  &term{}          == �                      // set of all types (�niverse)
-//   T:  &term{false, T}  == {T}                    // set of type T
-//  ~t:  &term{true, t}   == {t' | under(t') == t}  // set of types with underlying type t
-//
-type term struct {
-	tilde bool // valid if typ != nil
-	typ   types.Type
-}
-
-func (x *term) String() string {
-	switch {
-	case x == nil:
-		return "∅"
-	case x.typ == nil:
-		return "�"
-	case x.tilde:
-		return "~" + x.typ.String()
-	default:
-		return x.typ.String()
-	}
-}
-
-// equal reports whether x and y represent the same type set.
-func (x *term) equal(y *term) bool {
-	// easy cases
-	switch {
-	case x == nil || y == nil:
-		return x == y
-	case x.typ == nil || y.typ == nil:
-		return x.typ == y.typ
-	}
-	// ∅ ⊂ x, y ⊂ �
-
-	return x.tilde == y.tilde && types.Identical(x.typ, y.typ)
-}
-
-// union returns the union x ∪ y: zero, one, or two non-nil terms.
-func (x *term) union(y *term) (_, _ *term) {
-	// easy cases
-	switch {
-	case x == nil && y == nil:
-		return nil, nil // ∅ ∪ ∅ == ∅
-	case x == nil:
-		return y, nil // ∅ ∪ y == y
-	case y == nil:
-		return x, nil // x ∪ ∅ == x
-	case x.typ == nil:
-		return x, nil // � ∪ y == �
-	case y.typ == nil:
-		return y, nil // x ∪ � == �
-	}
-	// ∅ ⊂ x, y ⊂ �
-
-	if x.disjoint(y) {
-		return x, y // x ∪ y == (x, y) if x ∩ y == ∅
-	}
-	// x.typ == y.typ
-
-	// ~t ∪ ~t == ~t
-	// ~t ∪  T == ~t
-	//  T ∪ ~t == ~t
-	//  T ∪  T ==  T
-	if x.tilde || !y.tilde {
-		return x, nil
-	}
-	return y, nil
-}
-
-// intersect returns the intersection x ∩ y.
-func (x *term) intersect(y *term) *term {
-	// easy cases
-	switch {
-	case x == nil || y == nil:
-		return nil // ∅ ∩ y == ∅ and ∩ ∅ == ∅
-	case x.typ == nil:
-		return y // � ∩ y == y
-	case y.typ == nil:
-		return x // x ∩ � == x
-	}
-	// ∅ ⊂ x, y ⊂ �
-
-	if x.disjoint(y) {
-		return nil // x ∩ y == ∅ if x ∩ y == ∅
-	}
-	// x.typ == y.typ
-
-	// ~t ∩ ~t == ~t
-	// ~t ∩  T ==  T
-	//  T ∩ ~t ==  T
-	//  T ∩  T ==  T
-	if !x.tilde || y.tilde {
-		return x
-	}
-	return y
-}
-
-// includes reports whether t ∈ x.
-func (x *term) includes(t types.Type) bool {
-	// easy cases
-	switch {
-	case x == nil:
-		return false // t ∈ ∅ == false
-	case x.typ == nil:
-		return true // t ∈ � == true
-	}
-	// ∅ ⊂ x ⊂ �
-
-	u := t
-	if x.tilde {
-		u = under(u)
-	}
-	return types.Identical(x.typ, u)
-}
-
-// subsetOf reports whether x ⊆ y.
-func (x *term) subsetOf(y *term) bool {
-	// easy cases
-	switch {
-	case x == nil:
-		return true // ∅ ⊆ y == true
-	case y == nil:
-		return false // x ⊆ ∅ == false since x != ∅
-	case y.typ == nil:
-		return true // x ⊆ � == true
-	case x.typ == nil:
-		return false // � ⊆ y == false since y != �
-	}
-	// ∅ ⊂ x, y ⊂ �
-
-	if x.disjoint(y) {
-		return false // x ⊆ y == false if x ∩ y == ∅
-	}
-	// x.typ == y.typ
-
-	// ~t ⊆ ~t == true
-	// ~t ⊆ T == false
-	//  T ⊆ ~t == true
-	//  T ⊆  T == true
-	return !x.tilde || y.tilde
-}
-
-// disjoint reports whether x ∩ y == ∅.
-// x.typ and y.typ must not be nil.
-func (x *term) disjoint(y *term) bool {
-	if debug && (x.typ == nil || y.typ == nil) {
-		panic("invalid argument(s)")
-	}
-	ux := x.typ
-	if y.tilde {
-		ux = under(ux)
-	}
-	uy := y.typ
-	if x.tilde {
-		uy = under(uy)
-	}
-	return !types.Identical(ux, uy)
-}
diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go
index 4921b2d4a..a45f112bc 100644
--- a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go
+++ b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go
@@ -21,7 +21,7 @@ import (
 	"google.golang.org/protobuf/reflect/protoregistry"
 )
 
-// Unmarshal reads the given []byte into the given proto.Message.
+// Unmarshal reads the given []byte into the given [proto.Message].
 // The provided message must be mutable (e.g., a non-nil pointer to a message).
 func Unmarshal(b []byte, m proto.Message) error {
 	return UnmarshalOptions{}.Unmarshal(b, m)
@@ -51,7 +51,7 @@ type UnmarshalOptions struct {
 	}
 }
 
-// Unmarshal reads the given []byte and populates the given proto.Message
+// Unmarshal reads the given []byte and populates the given [proto.Message]
 // using options in the UnmarshalOptions object.
 // The provided message must be mutable (e.g., a non-nil pointer to a message).
 func (o UnmarshalOptions) Unmarshal(b []byte, m proto.Message) error {
@@ -739,7 +739,9 @@ func (d decoder) skipValue() error {
 			case text.ListClose:
 				return nil
 			case text.MessageOpen:
-				return d.skipMessageValue()
+				if err := d.skipMessageValue(); err != nil {
+					return err
+				}
 			default:
 				// Skip items. This will not validate whether skipped values are
 				// of the same type or not, same behavior as C++
diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go
index 722a7b41d..95967e811 100644
--- a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go
+++ b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go
@@ -33,7 +33,7 @@ func Format(m proto.Message) string {
 	return MarshalOptions{Multiline: true}.Format(m)
 }
 
-// Marshal writes the given proto.Message in textproto format using default
+// Marshal writes the given [proto.Message] in textproto format using default
 // options. Do not depend on the output being stable. It may change over time
 // across different versions of the program.
 func Marshal(m proto.Message) ([]byte, error) {
@@ -97,7 +97,7 @@ func (o MarshalOptions) Format(m proto.Message) string {
 	return string(b)
 }
 
-// Marshal writes the given proto.Message in textproto format using options in
+// Marshal writes the given [proto.Message] in textproto format using options in
 // MarshalOptions object. Do not depend on the output being stable. It may
 // change over time across different versions of the program.
 func (o MarshalOptions) Marshal(m proto.Message) ([]byte, error) {
diff --git a/vendor/google.golang.org/protobuf/encoding/protowire/wire.go b/vendor/google.golang.org/protobuf/encoding/protowire/wire.go
index f4b4686cf..e942bc983 100644
--- a/vendor/google.golang.org/protobuf/encoding/protowire/wire.go
+++ b/vendor/google.golang.org/protobuf/encoding/protowire/wire.go
@@ -6,7 +6,7 @@
 // See https://protobuf.dev/programming-guides/encoding.
 //
 // For marshaling and unmarshaling entire protobuf messages,
-// use the "google.golang.org/protobuf/proto" package instead.
+// use the [google.golang.org/protobuf/proto] package instead.
 package protowire
 
 import (
@@ -87,7 +87,7 @@ func ParseError(n int) error {
 
 // ConsumeField parses an entire field record (both tag and value) and returns
 // the field number, the wire type, and the total length.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 //
 // The total length includes the tag header and the end group marker (if the
 // field is a group).
@@ -104,8 +104,8 @@ func ConsumeField(b []byte) (Number, Type, int) {
 }
 
 // ConsumeFieldValue parses a field value and returns its length.
-// This assumes that the field Number and wire Type have already been parsed.
-// This returns a negative length upon an error (see ParseError).
+// This assumes that the field [Number] and wire [Type] have already been parsed.
+// This returns a negative length upon an error (see [ParseError]).
 //
 // When parsing a group, the length includes the end group marker and
 // the end group is verified to match the starting field number.
@@ -164,7 +164,7 @@ func AppendTag(b []byte, num Number, typ Type) []byte {
 }
 
 // ConsumeTag parses b as a varint-encoded tag, reporting its length.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 func ConsumeTag(b []byte) (Number, Type, int) {
 	v, n := ConsumeVarint(b)
 	if n < 0 {
@@ -263,7 +263,7 @@ func AppendVarint(b []byte, v uint64) []byte {
 }
 
 // ConsumeVarint parses b as a varint-encoded uint64, reporting its length.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 func ConsumeVarint(b []byte) (v uint64, n int) {
 	var y uint64
 	if len(b) <= 0 {
@@ -384,7 +384,7 @@ func AppendFixed32(b []byte, v uint32) []byte {
 }
 
 // ConsumeFixed32 parses b as a little-endian uint32, reporting its length.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 func ConsumeFixed32(b []byte) (v uint32, n int) {
 	if len(b) < 4 {
 		return 0, errCodeTruncated
@@ -412,7 +412,7 @@ func AppendFixed64(b []byte, v uint64) []byte {
 }
 
 // ConsumeFixed64 parses b as a little-endian uint64, reporting its length.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 func ConsumeFixed64(b []byte) (v uint64, n int) {
 	if len(b) < 8 {
 		return 0, errCodeTruncated
@@ -432,7 +432,7 @@ func AppendBytes(b []byte, v []byte) []byte {
 }
 
 // ConsumeBytes parses b as a length-prefixed bytes value, reporting its length.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 func ConsumeBytes(b []byte) (v []byte, n int) {
 	m, n := ConsumeVarint(b)
 	if n < 0 {
@@ -456,7 +456,7 @@ func AppendString(b []byte, v string) []byte {
 }
 
 // ConsumeString parses b as a length-prefixed bytes value, reporting its length.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 func ConsumeString(b []byte) (v string, n int) {
 	bb, n := ConsumeBytes(b)
 	return string(bb), n
@@ -471,7 +471,7 @@ func AppendGroup(b []byte, num Number, v []byte) []byte {
 // ConsumeGroup parses b as a group value until the trailing end group marker,
 // and verifies that the end marker matches the provided num. The value v
 // does not contain the end marker, while the length does contain the end marker.
-// This returns a negative length upon an error (see ParseError).
+// This returns a negative length upon an error (see [ParseError]).
 func ConsumeGroup(num Number, b []byte) (v []byte, n int) {
 	n = ConsumeFieldValue(num, StartGroupType, b)
 	if n < 0 {
@@ -495,8 +495,8 @@ func SizeGroup(num Number, n int) int {
 	return n + SizeTag(num)
 }
 
-// DecodeTag decodes the field Number and wire Type from its unified form.
-// The Number is -1 if the decoded field number overflows int32.
+// DecodeTag decodes the field [Number] and wire [Type] from its unified form.
+// The [Number] is -1 if the decoded field number overflows int32.
 // Other than overflow, this does not check for field number validity.
 func DecodeTag(x uint64) (Number, Type) {
 	// NOTE: MessageSet allows for larger field numbers than normal.
@@ -506,7 +506,7 @@ func DecodeTag(x uint64) (Number, Type) {
 	return Number(x >> 3), Type(x & 7)
 }
 
-// EncodeTag encodes the field Number and wire Type into its unified form.
+// EncodeTag encodes the field [Number] and wire [Type] into its unified form.
 func EncodeTag(num Number, typ Type) uint64 {
 	return uint64(num)<<3 | uint64(typ&7)
 }
diff --git a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go
index db5248e1b..a45625c8d 100644
--- a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go
+++ b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go
@@ -83,7 +83,13 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string {
 	case protoreflect.FileImports:
 		for i := 0; i < vs.Len(); i++ {
 			var rs records
-			rs.Append(reflect.ValueOf(vs.Get(i)), "Path", "Package", "IsPublic", "IsWeak")
+			rv := reflect.ValueOf(vs.Get(i))
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Path"), "Path"},
+				{rv.MethodByName("Package"), "Package"},
+				{rv.MethodByName("IsPublic"), "IsPublic"},
+				{rv.MethodByName("IsWeak"), "IsWeak"},
+			}...)
 			ss = append(ss, "{"+rs.Join()+"}")
 		}
 		return start + joinStrings(ss, allowMulti) + end
@@ -92,34 +98,26 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string {
 		for i := 0; i < vs.Len(); i++ {
 			m := reflect.ValueOf(vs).MethodByName("Get")
 			v := m.Call([]reflect.Value{reflect.ValueOf(i)})[0].Interface()
-			ss = append(ss, formatDescOpt(v.(protoreflect.Descriptor), false, allowMulti && !isEnumValue))
+			ss = append(ss, formatDescOpt(v.(protoreflect.Descriptor), false, allowMulti && !isEnumValue, nil))
 		}
 		return start + joinStrings(ss, allowMulti && isEnumValue) + end
 	}
 }
 
-// descriptorAccessors is a list of accessors to print for each descriptor.
-//
-// Do not print all accessors since some contain redundant information,
-// while others are pointers that we do not want to follow since the descriptor
-// is actually a cyclic graph.
-//
-// Using a list allows us to print the accessors in a sensible order.
-var descriptorAccessors = map[reflect.Type][]string{
-	reflect.TypeOf((*protoreflect.FileDescriptor)(nil)).Elem():      {"Path", "Package", "Imports", "Messages", "Enums", "Extensions", "Services"},
-	reflect.TypeOf((*protoreflect.MessageDescriptor)(nil)).Elem():   {"IsMapEntry", "Fields", "Oneofs", "ReservedNames", "ReservedRanges", "RequiredNumbers", "ExtensionRanges", "Messages", "Enums", "Extensions"},
-	reflect.TypeOf((*protoreflect.FieldDescriptor)(nil)).Elem():     {"Number", "Cardinality", "Kind", "HasJSONName", "JSONName", "HasPresence", "IsExtension", "IsPacked", "IsWeak", "IsList", "IsMap", "MapKey", "MapValue", "HasDefault", "Default", "ContainingOneof", "ContainingMessage", "Message", "Enum"},
-	reflect.TypeOf((*protoreflect.OneofDescriptor)(nil)).Elem():     {"Fields"}, // not directly used; must keep in sync with formatDescOpt
-	reflect.TypeOf((*protoreflect.EnumDescriptor)(nil)).Elem():      {"Values", "ReservedNames", "ReservedRanges"},
-	reflect.TypeOf((*protoreflect.EnumValueDescriptor)(nil)).Elem(): {"Number"},
-	reflect.TypeOf((*protoreflect.ServiceDescriptor)(nil)).Elem():   {"Methods"},
-	reflect.TypeOf((*protoreflect.MethodDescriptor)(nil)).Elem():    {"Input", "Output", "IsStreamingClient", "IsStreamingServer"},
+type methodAndName struct {
+	method reflect.Value
+	name   string
 }
 
 func FormatDesc(s fmt.State, r rune, t protoreflect.Descriptor) {
-	io.WriteString(s, formatDescOpt(t, true, r == 'v' && (s.Flag('+') || s.Flag('#'))))
+	io.WriteString(s, formatDescOpt(t, true, r == 'v' && (s.Flag('+') || s.Flag('#')), nil))
 }
-func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string {
+
+func InternalFormatDescOptForTesting(t protoreflect.Descriptor, isRoot, allowMulti bool, record func(string)) string {
+	return formatDescOpt(t, isRoot, allowMulti, record)
+}
+
+func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool, record func(string)) string {
 	rv := reflect.ValueOf(t)
 	rt := rv.MethodByName("ProtoType").Type().In(0)
 
@@ -129,26 +127,60 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string {
 	}
 
 	_, isFile := t.(protoreflect.FileDescriptor)
-	rs := records{allowMulti: allowMulti}
+	rs := records{
+		allowMulti: allowMulti,
+		record:     record,
+	}
 	if t.IsPlaceholder() {
 		if isFile {
-			rs.Append(rv, "Path", "Package", "IsPlaceholder")
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Path"), "Path"},
+				{rv.MethodByName("Package"), "Package"},
+				{rv.MethodByName("IsPlaceholder"), "IsPlaceholder"},
+			}...)
 		} else {
-			rs.Append(rv, "FullName", "IsPlaceholder")
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("FullName"), "FullName"},
+				{rv.MethodByName("IsPlaceholder"), "IsPlaceholder"},
+			}...)
 		}
 	} else {
 		switch {
 		case isFile:
-			rs.Append(rv, "Syntax")
+			rs.Append(rv, methodAndName{rv.MethodByName("Syntax"), "Syntax"})
 		case isRoot:
-			rs.Append(rv, "Syntax", "FullName")
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Syntax"), "Syntax"},
+				{rv.MethodByName("FullName"), "FullName"},
+			}...)
 		default:
-			rs.Append(rv, "Name")
+			rs.Append(rv, methodAndName{rv.MethodByName("Name"), "Name"})
 		}
 		switch t := t.(type) {
 		case protoreflect.FieldDescriptor:
-			for _, s := range descriptorAccessors[rt] {
-				switch s {
+			accessors := []methodAndName{
+				{rv.MethodByName("Number"), "Number"},
+				{rv.MethodByName("Cardinality"), "Cardinality"},
+				{rv.MethodByName("Kind"), "Kind"},
+				{rv.MethodByName("HasJSONName"), "HasJSONName"},
+				{rv.MethodByName("JSONName"), "JSONName"},
+				{rv.MethodByName("HasPresence"), "HasPresence"},
+				{rv.MethodByName("IsExtension"), "IsExtension"},
+				{rv.MethodByName("IsPacked"), "IsPacked"},
+				{rv.MethodByName("IsWeak"), "IsWeak"},
+				{rv.MethodByName("IsList"), "IsList"},
+				{rv.MethodByName("IsMap"), "IsMap"},
+				{rv.MethodByName("MapKey"), "MapKey"},
+				{rv.MethodByName("MapValue"), "MapValue"},
+				{rv.MethodByName("HasDefault"), "HasDefault"},
+				{rv.MethodByName("Default"), "Default"},
+				{rv.MethodByName("ContainingOneof"), "ContainingOneof"},
+				{rv.MethodByName("ContainingMessage"), "ContainingMessage"},
+				{rv.MethodByName("Message"), "Message"},
+				{rv.MethodByName("Enum"), "Enum"},
+			}
+			for _, s := range accessors {
+				switch s.name {
 				case "MapKey":
 					if k := t.MapKey(); k != nil {
 						rs.recs = append(rs.recs, [2]string{"MapKey", k.Kind().String()})
@@ -157,20 +189,20 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string {
 					if v := t.MapValue(); v != nil {
 						switch v.Kind() {
 						case protoreflect.EnumKind:
-							rs.recs = append(rs.recs, [2]string{"MapValue", string(v.Enum().FullName())})
+							rs.AppendRecs("MapValue", [2]string{"MapValue", string(v.Enum().FullName())})
 						case protoreflect.MessageKind, protoreflect.GroupKind:
-							rs.recs = append(rs.recs, [2]string{"MapValue", string(v.Message().FullName())})
+							rs.AppendRecs("MapValue", [2]string{"MapValue", string(v.Message().FullName())})
 						default:
-							rs.recs = append(rs.recs, [2]string{"MapValue", v.Kind().String()})
+							rs.AppendRecs("MapValue", [2]string{"MapValue", v.Kind().String()})
 						}
 					}
 				case "ContainingOneof":
 					if od := t.ContainingOneof(); od != nil {
-						rs.recs = append(rs.recs, [2]string{"Oneof", string(od.Name())})
+						rs.AppendRecs("ContainingOneof", [2]string{"Oneof", string(od.Name())})
 					}
 				case "ContainingMessage":
 					if t.IsExtension() {
-						rs.recs = append(rs.recs, [2]string{"Extendee", string(t.ContainingMessage().FullName())})
+						rs.AppendRecs("ContainingMessage", [2]string{"Extendee", string(t.ContainingMessage().FullName())})
 					}
 				case "Message":
 					if !t.IsMap() {
@@ -187,13 +219,61 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string {
 				ss = append(ss, string(fs.Get(i).Name()))
 			}
 			if len(ss) > 0 {
-				rs.recs = append(rs.recs, [2]string{"Fields", "[" + joinStrings(ss, false) + "]"})
+				rs.AppendRecs("Fields", [2]string{"Fields", "[" + joinStrings(ss, false) + "]"})
 			}
-		default:
-			rs.Append(rv, descriptorAccessors[rt]...)
+
+		case protoreflect.FileDescriptor:
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Path"), "Path"},
+				{rv.MethodByName("Package"), "Package"},
+				{rv.MethodByName("Imports"), "Imports"},
+				{rv.MethodByName("Messages"), "Messages"},
+				{rv.MethodByName("Enums"), "Enums"},
+				{rv.MethodByName("Extensions"), "Extensions"},
+				{rv.MethodByName("Services"), "Services"},
+			}...)
+
+		case protoreflect.MessageDescriptor:
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("IsMapEntry"), "IsMapEntry"},
+				{rv.MethodByName("Fields"), "Fields"},
+				{rv.MethodByName("Oneofs"), "Oneofs"},
+				{rv.MethodByName("ReservedNames"), "ReservedNames"},
+				{rv.MethodByName("ReservedRanges"), "ReservedRanges"},
+				{rv.MethodByName("RequiredNumbers"), "RequiredNumbers"},
+				{rv.MethodByName("ExtensionRanges"), "ExtensionRanges"},
+				{rv.MethodByName("Messages"), "Messages"},
+				{rv.MethodByName("Enums"), "Enums"},
+				{rv.MethodByName("Extensions"), "Extensions"},
+			}...)
+
+		case protoreflect.EnumDescriptor:
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Values"), "Values"},
+				{rv.MethodByName("ReservedNames"), "ReservedNames"},
+				{rv.MethodByName("ReservedRanges"), "ReservedRanges"},
+			}...)
+
+		case protoreflect.EnumValueDescriptor:
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Number"), "Number"},
+			}...)
+
+		case protoreflect.ServiceDescriptor:
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Methods"), "Methods"},
+			}...)
+
+		case protoreflect.MethodDescriptor:
+			rs.Append(rv, []methodAndName{
+				{rv.MethodByName("Input"), "Input"},
+				{rv.MethodByName("Output"), "Output"},
+				{rv.MethodByName("IsStreamingClient"), "IsStreamingClient"},
+				{rv.MethodByName("IsStreamingServer"), "IsStreamingServer"},
+			}...)
 		}
-		if rv.MethodByName("GoType").IsValid() {
-			rs.Append(rv, "GoType")
+		if m := rv.MethodByName("GoType"); m.IsValid() {
+			rs.Append(rv, methodAndName{m, "GoType"})
 		}
 	}
 	return start + rs.Join() + end
@@ -202,19 +282,34 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string {
 type records struct {
 	recs       [][2]string
 	allowMulti bool
+
+	// record is a function that will be called for every Append() or
+	// AppendRecs() call, to be used for testing with the
+	// InternalFormatDescOptForTesting function.
+	record func(string)
 }
 
-func (rs *records) Append(v reflect.Value, accessors ...string) {
+func (rs *records) AppendRecs(fieldName string, newRecs [2]string) {
+	if rs.record != nil {
+		rs.record(fieldName)
+	}
+	rs.recs = append(rs.recs, newRecs)
+}
+
+func (rs *records) Append(v reflect.Value, accessors ...methodAndName) {
 	for _, a := range accessors {
+		if rs.record != nil {
+			rs.record(a.name)
+		}
 		var rv reflect.Value
-		if m := v.MethodByName(a); m.IsValid() {
-			rv = m.Call(nil)[0]
+		if a.method.IsValid() {
+			rv = a.method.Call(nil)[0]
 		}
 		if v.Kind() == reflect.Struct && !rv.IsValid() {
-			rv = v.FieldByName(a)
+			rv = v.FieldByName(a.name)
 		}
 		if !rv.IsValid() {
-			panic(fmt.Sprintf("unknown accessor: %v.%s", v.Type(), a))
+			panic(fmt.Sprintf("unknown accessor: %v.%s", v.Type(), a.name))
 		}
 		if _, ok := rv.Interface().(protoreflect.Value); ok {
 			rv = rv.MethodByName("Interface").Call(nil)[0]
@@ -261,7 +356,7 @@ func (rs *records) Append(v reflect.Value, accessors ...string) {
 		default:
 			s = fmt.Sprint(v)
 		}
-		rs.recs = append(rs.recs, [2]string{a, s})
+		rs.recs = append(rs.recs, [2]string{a.name, s})
 	}
 }
 
diff --git a/vendor/google.golang.org/protobuf/internal/editiondefaults/defaults.go b/vendor/google.golang.org/protobuf/internal/editiondefaults/defaults.go
new file mode 100644
index 000000000..14656b65a
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/internal/editiondefaults/defaults.go
@@ -0,0 +1,12 @@
+// Copyright 2024 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package editiondefaults contains the binary representation of the editions
+// defaults.
+package editiondefaults
+
+import _ "embed"
+
+//go:embed editions_defaults.binpb
+var Defaults []byte
diff --git a/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb b/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb
new file mode 100644
index 000000000..18f075687
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb
@@ -0,0 +1,4 @@
+
+
 (
0æ
+

 (
0
ç
+


 (
0
è æ(è
\ No newline at end of file
diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go
index 7c3689bae..8826bcf40 100644
--- a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go
+++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go
@@ -21,11 +21,26 @@ import (
 	"google.golang.org/protobuf/reflect/protoregistry"
 )
 
+// Edition is an Enum for proto2.Edition
+type Edition int32
+
+// These values align with the value of Enum in descriptor.proto which allows
+// direct conversion between the proto enum and this enum.
+const (
+	EditionUnknown     Edition = 0
+	EditionProto2      Edition = 998
+	EditionProto3      Edition = 999
+	Edition2023        Edition = 1000
+	EditionUnsupported Edition = 100000
+)
+
 // The types in this file may have a suffix:
 //	• L0: Contains fields common to all descriptors (except File) and
 //	must be initialized up front.
 //	• L1: Contains fields specific to a descriptor and
-//	must be initialized up front.
+//	must be initialized up front. If the associated proto uses Editions, the
+//  Editions features must always be resolved. If not explicitly set, the
+//  appropriate default must be resolved and set.
 //	• L2: Contains fields that are lazily initialized when constructing
 //	from the raw file descriptor. When constructing as a literal, the L2
 //	fields must be initialized up front.
@@ -44,6 +59,7 @@ type (
 	}
 	FileL1 struct {
 		Syntax  protoreflect.Syntax
+		Edition Edition // Only used if Syntax == Editions
 		Path    string
 		Package protoreflect.FullName
 
@@ -51,12 +67,41 @@ type (
 		Messages   Messages
 		Extensions Extensions
 		Services   Services
+
+		EditionFeatures EditionFeatures
 	}
 	FileL2 struct {
 		Options   func() protoreflect.ProtoMessage
 		Imports   FileImports
 		Locations SourceLocations
 	}
+
+	EditionFeatures struct {
+		// IsFieldPresence is true if field_presence is EXPLICIT
+		// https://protobuf.dev/editions/features/#field_presence
+		IsFieldPresence bool
+		// IsFieldPresence is true if field_presence is LEGACY_REQUIRED
+		// https://protobuf.dev/editions/features/#field_presence
+		IsLegacyRequired bool
+		// IsOpenEnum is true if enum_type is OPEN
+		// https://protobuf.dev/editions/features/#enum_type
+		IsOpenEnum bool
+		// IsPacked is true if repeated_field_encoding is PACKED
+		// https://protobuf.dev/editions/features/#repeated_field_encoding
+		IsPacked bool
+		// IsUTF8Validated is true if utf_validation is VERIFY
+		// https://protobuf.dev/editions/features/#utf8_validation
+		IsUTF8Validated bool
+		// IsDelimitedEncoded is true if message_encoding is DELIMITED
+		// https://protobuf.dev/editions/features/#message_encoding
+		IsDelimitedEncoded bool
+		// IsJSONCompliant is true if json_format is ALLOW
+		// https://protobuf.dev/editions/features/#json_format
+		IsJSONCompliant bool
+		// GenerateLegacyUnmarshalJSON determines if the plugin generates the
+		// UnmarshalJSON([]byte) error method for enums.
+		GenerateLegacyUnmarshalJSON bool
+	}
 )
 
 func (fd *File) ParentFile() protoreflect.FileDescriptor { return fd }
@@ -117,6 +162,8 @@ type (
 	}
 	EnumL1 struct {
 		eagerValues bool // controls whether EnumL2.Values is already populated
+
+		EditionFeatures EditionFeatures
 	}
 	EnumL2 struct {
 		Options        func() protoreflect.ProtoMessage
@@ -178,6 +225,8 @@ type (
 		Extensions   Extensions
 		IsMapEntry   bool // promoted from google.protobuf.MessageOptions
 		IsMessageSet bool // promoted from google.protobuf.MessageOptions
+
+		EditionFeatures EditionFeatures
 	}
 	MessageL2 struct {
 		Options               func() protoreflect.ProtoMessage
@@ -210,6 +259,8 @@ type (
 		ContainingOneof  protoreflect.OneofDescriptor // must be consistent with Message.Oneofs.Fields
 		Enum             protoreflect.EnumDescriptor
 		Message          protoreflect.MessageDescriptor
+
+		EditionFeatures EditionFeatures
 	}
 
 	Oneof struct {
@@ -219,6 +270,8 @@ type (
 	OneofL1 struct {
 		Options func() protoreflect.ProtoMessage
 		Fields  OneofFields // must be consistent with Message.Fields.ContainingOneof
+
+		EditionFeatures EditionFeatures
 	}
 )
 
@@ -268,23 +321,36 @@ func (fd *Field) Options() protoreflect.ProtoMessage {
 }
 func (fd *Field) Number() protoreflect.FieldNumber      { return fd.L1.Number }
 func (fd *Field) Cardinality() protoreflect.Cardinality { return fd.L1.Cardinality }
-func (fd *Field) Kind() protoreflect.Kind               { return fd.L1.Kind }
-func (fd *Field) HasJSONName() bool                     { return fd.L1.StringName.hasJSON }
-func (fd *Field) JSONName() string                      { return fd.L1.StringName.getJSON(fd) }
-func (fd *Field) TextName() string                      { return fd.L1.StringName.getText(fd) }
+func (fd *Field) Kind() protoreflect.Kind {
+	return fd.L1.Kind
+}
+func (fd *Field) HasJSONName() bool { return fd.L1.StringName.hasJSON }
+func (fd *Field) JSONName() string  { return fd.L1.StringName.getJSON(fd) }
+func (fd *Field) TextName() string  { return fd.L1.StringName.getText(fd) }
 func (fd *Field) HasPresence() bool {
-	return fd.L1.Cardinality != protoreflect.Repeated && (fd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 || fd.L1.Message != nil || fd.L1.ContainingOneof != nil)
+	if fd.L1.Cardinality == protoreflect.Repeated {
+		return false
+	}
+	explicitFieldPresence := fd.Syntax() == protoreflect.Editions && fd.L1.EditionFeatures.IsFieldPresence
+	return fd.Syntax() == protoreflect.Proto2 || explicitFieldPresence || fd.L1.Message != nil || fd.L1.ContainingOneof != nil
 }
 func (fd *Field) HasOptionalKeyword() bool {
 	return (fd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 && fd.L1.Cardinality == protoreflect.Optional && fd.L1.ContainingOneof == nil) || fd.L1.IsProto3Optional
 }
 func (fd *Field) IsPacked() bool {
-	if !fd.L1.HasPacked && fd.L0.ParentFile.L1.Syntax != protoreflect.Proto2 && fd.L1.Cardinality == protoreflect.Repeated {
-		switch fd.L1.Kind {
-		case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind, protoreflect.GroupKind:
-		default:
-			return true
-		}
+	if fd.L1.Cardinality != protoreflect.Repeated {
+		return false
+	}
+	switch fd.L1.Kind {
+	case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind, protoreflect.GroupKind:
+		return false
+	}
+	if fd.L0.ParentFile.L1.Syntax == protoreflect.Editions {
+		return fd.L1.EditionFeatures.IsPacked
+	}
+	if fd.L0.ParentFile.L1.Syntax == protoreflect.Proto3 {
+		// proto3 repeated fields are packed by default.
+		return !fd.L1.HasPacked || fd.L1.IsPacked
 	}
 	return fd.L1.IsPacked
 }
@@ -333,6 +399,9 @@ func (fd *Field) ProtoType(protoreflect.FieldDescriptor) {}
 // WARNING: This method is exempt from the compatibility promise and may be
 // removed in the future without warning.
 func (fd *Field) EnforceUTF8() bool {
+	if fd.L0.ParentFile.L1.Syntax == protoreflect.Editions {
+		return fd.L1.EditionFeatures.IsUTF8Validated
+	}
 	if fd.L1.HasEnforceUTF8 {
 		return fd.L1.EnforceUTF8
 	}
@@ -359,10 +428,11 @@ type (
 		L2 *ExtensionL2 // protected by fileDesc.once
 	}
 	ExtensionL1 struct {
-		Number      protoreflect.FieldNumber
-		Extendee    protoreflect.MessageDescriptor
-		Cardinality protoreflect.Cardinality
-		Kind        protoreflect.Kind
+		Number          protoreflect.FieldNumber
+		Extendee        protoreflect.MessageDescriptor
+		Cardinality     protoreflect.Cardinality
+		Kind            protoreflect.Kind
+		EditionFeatures EditionFeatures
 	}
 	ExtensionL2 struct {
 		Options          func() protoreflect.ProtoMessage
diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go
index 4a1584c9d..237e64fd2 100644
--- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go
+++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go
@@ -5,6 +5,7 @@
 package filedesc
 
 import (
+	"fmt"
 	"sync"
 
 	"google.golang.org/protobuf/encoding/protowire"
@@ -98,6 +99,7 @@ func (fd *File) unmarshalSeed(b []byte) {
 	var prevField protoreflect.FieldNumber
 	var numEnums, numMessages, numExtensions, numServices int
 	var posEnums, posMessages, posExtensions, posServices int
+	var options []byte
 	b0 := b
 	for len(b) > 0 {
 		num, typ, n := protowire.ConsumeTag(b)
@@ -113,6 +115,8 @@ func (fd *File) unmarshalSeed(b []byte) {
 					fd.L1.Syntax = protoreflect.Proto2
 				case "proto3":
 					fd.L1.Syntax = protoreflect.Proto3
+				case "editions":
+					fd.L1.Syntax = protoreflect.Editions
 				default:
 					panic("invalid syntax")
 				}
@@ -120,6 +124,8 @@ func (fd *File) unmarshalSeed(b []byte) {
 				fd.L1.Path = sb.MakeString(v)
 			case genid.FileDescriptorProto_Package_field_number:
 				fd.L1.Package = protoreflect.FullName(sb.MakeString(v))
+			case genid.FileDescriptorProto_Options_field_number:
+				options = v
 			case genid.FileDescriptorProto_EnumType_field_number:
 				if prevField != genid.FileDescriptorProto_EnumType_field_number {
 					if numEnums > 0 {
@@ -154,6 +160,13 @@ func (fd *File) unmarshalSeed(b []byte) {
 				numServices++
 			}
 			prevField = num
+		case protowire.VarintType:
+			v, m := protowire.ConsumeVarint(b)
+			b = b[m:]
+			switch num {
+			case genid.FileDescriptorProto_Edition_field_number:
+				fd.L1.Edition = Edition(v)
+			}
 		default:
 			m := protowire.ConsumeFieldValue(num, typ, b)
 			b = b[m:]
@@ -166,6 +179,15 @@ func (fd *File) unmarshalSeed(b []byte) {
 		fd.L1.Syntax = protoreflect.Proto2
 	}
 
+	if fd.L1.Syntax == protoreflect.Editions {
+		fd.L1.EditionFeatures = getFeaturesFor(fd.L1.Edition)
+	}
+
+	// Parse editions features from options if any
+	if options != nil {
+		fd.unmarshalSeedOptions(options)
+	}
+
 	// Must allocate all declarations before parsing each descriptor type
 	// to ensure we handled all descriptors in "flattened ordering".
 	if numEnums > 0 {
@@ -219,6 +241,28 @@ func (fd *File) unmarshalSeed(b []byte) {
 	}
 }
 
+func (fd *File) unmarshalSeedOptions(b []byte) {
+	for b := b; len(b) > 0; {
+		num, typ, n := protowire.ConsumeTag(b)
+		b = b[n:]
+		switch typ {
+		case protowire.BytesType:
+			v, m := protowire.ConsumeBytes(b)
+			b = b[m:]
+			switch num {
+			case genid.FileOptions_Features_field_number:
+				if fd.Syntax() != protoreflect.Editions {
+					panic(fmt.Sprintf("invalid descriptor: using edition features in a proto with syntax %s", fd.Syntax()))
+				}
+				fd.L1.EditionFeatures = unmarshalFeatureSet(v, fd.L1.EditionFeatures)
+			}
+		default:
+			m := protowire.ConsumeFieldValue(num, typ, b)
+			b = b[m:]
+		}
+	}
+}
+
 func (ed *Enum) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) {
 	ed.L0.ParentFile = pf
 	ed.L0.Parent = pd
@@ -275,6 +319,7 @@ func (md *Message) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protor
 	md.L0.ParentFile = pf
 	md.L0.Parent = pd
 	md.L0.Index = i
+	md.L1.EditionFeatures = featuresFromParentDesc(md.Parent())
 
 	var prevField protoreflect.FieldNumber
 	var numEnums, numMessages, numExtensions int
@@ -380,6 +425,13 @@ func (md *Message) unmarshalSeedOptions(b []byte) {
 			case genid.MessageOptions_MessageSetWireFormat_field_number:
 				md.L1.IsMessageSet = protowire.DecodeBool(v)
 			}
+		case protowire.BytesType:
+			v, m := protowire.ConsumeBytes(b)
+			b = b[m:]
+			switch num {
+			case genid.MessageOptions_Features_field_number:
+				md.L1.EditionFeatures = unmarshalFeatureSet(v, md.L1.EditionFeatures)
+			}
 		default:
 			m := protowire.ConsumeFieldValue(num, typ, b)
 			b = b[m:]
diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go
index 736a19a75..482a61cc1 100644
--- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go
+++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go
@@ -414,6 +414,7 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref
 	fd.L0.ParentFile = pf
 	fd.L0.Parent = pd
 	fd.L0.Index = i
+	fd.L1.EditionFeatures = featuresFromParentDesc(fd.Parent())
 
 	var rawTypeName []byte
 	var rawOptions []byte
@@ -465,6 +466,12 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref
 			b = b[m:]
 		}
 	}
+	if fd.Syntax() == protoreflect.Editions && fd.L1.Kind == protoreflect.MessageKind && fd.L1.EditionFeatures.IsDelimitedEncoded {
+		fd.L1.Kind = protoreflect.GroupKind
+	}
+	if fd.Syntax() == protoreflect.Editions && fd.L1.EditionFeatures.IsLegacyRequired {
+		fd.L1.Cardinality = protoreflect.Required
+	}
 	if rawTypeName != nil {
 		name := makeFullName(sb, rawTypeName)
 		switch fd.L1.Kind {
@@ -497,6 +504,13 @@ func (fd *Field) unmarshalOptions(b []byte) {
 				fd.L1.HasEnforceUTF8 = true
 				fd.L1.EnforceUTF8 = protowire.DecodeBool(v)
 			}
+		case protowire.BytesType:
+			v, m := protowire.ConsumeBytes(b)
+			b = b[m:]
+			switch num {
+			case genid.FieldOptions_Features_field_number:
+				fd.L1.EditionFeatures = unmarshalFeatureSet(v, fd.L1.EditionFeatures)
+			}
 		default:
 			m := protowire.ConsumeFieldValue(num, typ, b)
 			b = b[m:]
@@ -534,6 +548,7 @@ func (od *Oneof) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref
 func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) {
 	var rawTypeName []byte
 	var rawOptions []byte
+	xd.L1.EditionFeatures = featuresFromParentDesc(xd.L1.Extendee)
 	xd.L2 = new(ExtensionL2)
 	for len(b) > 0 {
 		num, typ, n := protowire.ConsumeTag(b)
@@ -565,6 +580,12 @@ func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) {
 			b = b[m:]
 		}
 	}
+	if xd.Syntax() == protoreflect.Editions && xd.L1.Kind == protoreflect.MessageKind && xd.L1.EditionFeatures.IsDelimitedEncoded {
+		xd.L1.Kind = protoreflect.GroupKind
+	}
+	if xd.Syntax() == protoreflect.Editions && xd.L1.EditionFeatures.IsLegacyRequired {
+		xd.L1.Cardinality = protoreflect.Required
+	}
 	if rawTypeName != nil {
 		name := makeFullName(sb, rawTypeName)
 		switch xd.L1.Kind {
@@ -589,6 +610,13 @@ func (xd *Extension) unmarshalOptions(b []byte) {
 			case genid.FieldOptions_Packed_field_number:
 				xd.L2.IsPacked = protowire.DecodeBool(v)
 			}
+		case protowire.BytesType:
+			v, m := protowire.ConsumeBytes(b)
+			b = b[m:]
+			switch num {
+			case genid.FieldOptions_Features_field_number:
+				xd.L1.EditionFeatures = unmarshalFeatureSet(v, xd.L1.EditionFeatures)
+			}
 		default:
 			m := protowire.ConsumeFieldValue(num, typ, b)
 			b = b[m:]
diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/editions.go b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go
new file mode 100644
index 000000000..0375a49d4
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go
@@ -0,0 +1,142 @@
+// Copyright 2024 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package filedesc
+
+import (
+	"fmt"
+
+	"google.golang.org/protobuf/encoding/protowire"
+	"google.golang.org/protobuf/internal/editiondefaults"
+	"google.golang.org/protobuf/internal/genid"
+	"google.golang.org/protobuf/reflect/protoreflect"
+)
+
+var defaultsCache = make(map[Edition]EditionFeatures)
+
+func init() {
+	unmarshalEditionDefaults(editiondefaults.Defaults)
+}
+
+func unmarshalGoFeature(b []byte, parent EditionFeatures) EditionFeatures {
+	for len(b) > 0 {
+		num, _, n := protowire.ConsumeTag(b)
+		b = b[n:]
+		switch num {
+		case genid.GoFeatures_LegacyUnmarshalJsonEnum_field_number:
+			v, m := protowire.ConsumeVarint(b)
+			b = b[m:]
+			parent.GenerateLegacyUnmarshalJSON = protowire.DecodeBool(v)
+		default:
+			panic(fmt.Sprintf("unkown field number %d while unmarshalling GoFeatures", num))
+		}
+	}
+	return parent
+}
+
+func unmarshalFeatureSet(b []byte, parent EditionFeatures) EditionFeatures {
+	for len(b) > 0 {
+		num, typ, n := protowire.ConsumeTag(b)
+		b = b[n:]
+		switch typ {
+		case protowire.VarintType:
+			v, m := protowire.ConsumeVarint(b)
+			b = b[m:]
+			switch num {
+			case genid.FeatureSet_FieldPresence_field_number:
+				parent.IsFieldPresence = v == genid.FeatureSet_EXPLICIT_enum_value || v == genid.FeatureSet_LEGACY_REQUIRED_enum_value
+				parent.IsLegacyRequired = v == genid.FeatureSet_LEGACY_REQUIRED_enum_value
+			case genid.FeatureSet_EnumType_field_number:
+				parent.IsOpenEnum = v == genid.FeatureSet_OPEN_enum_value
+			case genid.FeatureSet_RepeatedFieldEncoding_field_number:
+				parent.IsPacked = v == genid.FeatureSet_PACKED_enum_value
+			case genid.FeatureSet_Utf8Validation_field_number:
+				parent.IsUTF8Validated = v == genid.FeatureSet_VERIFY_enum_value
+			case genid.FeatureSet_MessageEncoding_field_number:
+				parent.IsDelimitedEncoded = v == genid.FeatureSet_DELIMITED_enum_value
+			case genid.FeatureSet_JsonFormat_field_number:
+				parent.IsJSONCompliant = v == genid.FeatureSet_ALLOW_enum_value
+			default:
+				panic(fmt.Sprintf("unkown field number %d while unmarshalling FeatureSet", num))
+			}
+		case protowire.BytesType:
+			v, m := protowire.ConsumeBytes(b)
+			b = b[m:]
+			switch num {
+			case genid.GoFeatures_LegacyUnmarshalJsonEnum_field_number:
+				parent = unmarshalGoFeature(v, parent)
+			}
+		}
+	}
+
+	return parent
+}
+
+func featuresFromParentDesc(parentDesc protoreflect.Descriptor) EditionFeatures {
+	var parentFS EditionFeatures
+	switch p := parentDesc.(type) {
+	case *File:
+		parentFS = p.L1.EditionFeatures
+	case *Message:
+		parentFS = p.L1.EditionFeatures
+	default:
+		panic(fmt.Sprintf("unknown parent type %T", parentDesc))
+	}
+	return parentFS
+}
+
+func unmarshalEditionDefault(b []byte) {
+	var ed Edition
+	var fs EditionFeatures
+	for len(b) > 0 {
+		num, typ, n := protowire.ConsumeTag(b)
+		b = b[n:]
+		switch typ {
+		case protowire.VarintType:
+			v, m := protowire.ConsumeVarint(b)
+			b = b[m:]
+			switch num {
+			case genid.FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_number:
+				ed = Edition(v)
+			}
+		case protowire.BytesType:
+			v, m := protowire.ConsumeBytes(b)
+			b = b[m:]
+			switch num {
+			case genid.FeatureSetDefaults_FeatureSetEditionDefault_Features_field_number:
+				fs = unmarshalFeatureSet(v, fs)
+			}
+		}
+	}
+	defaultsCache[ed] = fs
+}
+
+func unmarshalEditionDefaults(b []byte) {
+	for len(b) > 0 {
+		num, _, n := protowire.ConsumeTag(b)
+		b = b[n:]
+		switch num {
+		case genid.FeatureSetDefaults_Defaults_field_number:
+			def, m := protowire.ConsumeBytes(b)
+			b = b[m:]
+			unmarshalEditionDefault(def)
+		case genid.FeatureSetDefaults_MinimumEdition_field_number,
+			genid.FeatureSetDefaults_MaximumEdition_field_number:
+			// We don't care about the minimum and maximum editions. If the
+			// edition we are looking for later on is not in the cache we know
+			// it is outside of the range between minimum and maximum edition.
+			_, m := protowire.ConsumeVarint(b)
+			b = b[m:]
+		default:
+			panic(fmt.Sprintf("unkown field number %d while unmarshalling EditionDefault", num))
+		}
+	}
+}
+
+func getFeaturesFor(ed Edition) EditionFeatures {
+	if def, ok := defaultsCache[ed]; ok {
+		return def
+	}
+	panic(fmt.Sprintf("unsupported edition: %v", ed))
+}
diff --git a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go
index 136f1b215..40272c893 100644
--- a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go
+++ b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go
@@ -12,6 +12,27 @@ import (
 
 const File_google_protobuf_descriptor_proto = "google/protobuf/descriptor.proto"
 
+// Full and short names for google.protobuf.Edition.
+const (
+	Edition_enum_fullname = "google.protobuf.Edition"
+	Edition_enum_name     = "Edition"
+)
+
+// Enum values for google.protobuf.Edition.
+const (
+	Edition_EDITION_UNKNOWN_enum_value         = 0
+	Edition_EDITION_PROTO2_enum_value          = 998
+	Edition_EDITION_PROTO3_enum_value          = 999
+	Edition_EDITION_2023_enum_value            = 1000
+	Edition_EDITION_2024_enum_value            = 1001
+	Edition_EDITION_1_TEST_ONLY_enum_value     = 1
+	Edition_EDITION_2_TEST_ONLY_enum_value     = 2
+	Edition_EDITION_99997_TEST_ONLY_enum_value = 99997
+	Edition_EDITION_99998_TEST_ONLY_enum_value = 99998
+	Edition_EDITION_99999_TEST_ONLY_enum_value = 99999
+	Edition_EDITION_MAX_enum_value             = 2147483647
+)
+
 // Names for google.protobuf.FileDescriptorSet.
 const (
 	FileDescriptorSet_message_name     protoreflect.Name     = "FileDescriptorSet"
@@ -81,7 +102,7 @@ const (
 	FileDescriptorProto_Options_field_number          protoreflect.FieldNumber = 8
 	FileDescriptorProto_SourceCodeInfo_field_number   protoreflect.FieldNumber = 9
 	FileDescriptorProto_Syntax_field_number           protoreflect.FieldNumber = 12
-	FileDescriptorProto_Edition_field_number          protoreflect.FieldNumber = 13
+	FileDescriptorProto_Edition_field_number          protoreflect.FieldNumber = 14
 )
 
 // Names for google.protobuf.DescriptorProto.
@@ -184,10 +205,12 @@ const (
 const (
 	ExtensionRangeOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option"
 	ExtensionRangeOptions_Declaration_field_name         protoreflect.Name = "declaration"
+	ExtensionRangeOptions_Features_field_name            protoreflect.Name = "features"
 	ExtensionRangeOptions_Verification_field_name        protoreflect.Name = "verification"
 
 	ExtensionRangeOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.uninterpreted_option"
 	ExtensionRangeOptions_Declaration_field_fullname         protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.declaration"
+	ExtensionRangeOptions_Features_field_fullname            protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.features"
 	ExtensionRangeOptions_Verification_field_fullname        protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.verification"
 )
 
@@ -195,6 +218,7 @@ const (
 const (
 	ExtensionRangeOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999
 	ExtensionRangeOptions_Declaration_field_number         protoreflect.FieldNumber = 2
+	ExtensionRangeOptions_Features_field_number            protoreflect.FieldNumber = 50
 	ExtensionRangeOptions_Verification_field_number        protoreflect.FieldNumber = 3
 )
 
@@ -204,6 +228,12 @@ const (
 	ExtensionRangeOptions_VerificationState_enum_name     = "VerificationState"
 )
 
+// Enum values for google.protobuf.ExtensionRangeOptions.VerificationState.
+const (
+	ExtensionRangeOptions_DECLARATION_enum_value = 0
+	ExtensionRangeOptions_UNVERIFIED_enum_value  = 1
+)
+
 // Names for google.protobuf.ExtensionRangeOptions.Declaration.
 const (
 	ExtensionRangeOptions_Declaration_message_name     protoreflect.Name     = "Declaration"
@@ -212,29 +242,26 @@ const (
 
 // Field names for google.protobuf.ExtensionRangeOptions.Declaration.
 const (
-	ExtensionRangeOptions_Declaration_Number_field_name     protoreflect.Name = "number"
-	ExtensionRangeOptions_Declaration_FullName_field_name   protoreflect.Name = "full_name"
-	ExtensionRangeOptions_Declaration_Type_field_name       protoreflect.Name = "type"
-	ExtensionRangeOptions_Declaration_IsRepeated_field_name protoreflect.Name = "is_repeated"
-	ExtensionRangeOptions_Declaration_Reserved_field_name   protoreflect.Name = "reserved"
-	ExtensionRangeOptions_Declaration_Repeated_field_name   protoreflect.Name = "repeated"
+	ExtensionRangeOptions_Declaration_Number_field_name   protoreflect.Name = "number"
+	ExtensionRangeOptions_Declaration_FullName_field_name protoreflect.Name = "full_name"
+	ExtensionRangeOptions_Declaration_Type_field_name     protoreflect.Name = "type"
+	ExtensionRangeOptions_Declaration_Reserved_field_name protoreflect.Name = "reserved"
+	ExtensionRangeOptions_Declaration_Repeated_field_name protoreflect.Name = "repeated"
 
-	ExtensionRangeOptions_Declaration_Number_field_fullname     protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.number"
-	ExtensionRangeOptions_Declaration_FullName_field_fullname   protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.full_name"
-	ExtensionRangeOptions_Declaration_Type_field_fullname       protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.type"
-	ExtensionRangeOptions_Declaration_IsRepeated_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.is_repeated"
-	ExtensionRangeOptions_Declaration_Reserved_field_fullname   protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.reserved"
-	ExtensionRangeOptions_Declaration_Repeated_field_fullname   protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.repeated"
+	ExtensionRangeOptions_Declaration_Number_field_fullname   protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.number"
+	ExtensionRangeOptions_Declaration_FullName_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.full_name"
+	ExtensionRangeOptions_Declaration_Type_field_fullname     protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.type"
+	ExtensionRangeOptions_Declaration_Reserved_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.reserved"
+	ExtensionRangeOptions_Declaration_Repeated_field_fullname protoreflect.FullName = "google.protobuf.ExtensionRangeOptions.Declaration.repeated"
 )
 
 // Field numbers for google.protobuf.ExtensionRangeOptions.Declaration.
 const (
-	ExtensionRangeOptions_Declaration_Number_field_number     protoreflect.FieldNumber = 1
-	ExtensionRangeOptions_Declaration_FullName_field_number   protoreflect.FieldNumber = 2
-	ExtensionRangeOptions_Declaration_Type_field_number       protoreflect.FieldNumber = 3
-	ExtensionRangeOptions_Declaration_IsRepeated_field_number protoreflect.FieldNumber = 4
-	ExtensionRangeOptions_Declaration_Reserved_field_number   protoreflect.FieldNumber = 5
-	ExtensionRangeOptions_Declaration_Repeated_field_number   protoreflect.FieldNumber = 6
+	ExtensionRangeOptions_Declaration_Number_field_number   protoreflect.FieldNumber = 1
+	ExtensionRangeOptions_Declaration_FullName_field_number protoreflect.FieldNumber = 2
+	ExtensionRangeOptions_Declaration_Type_field_number     protoreflect.FieldNumber = 3
+	ExtensionRangeOptions_Declaration_Reserved_field_number protoreflect.FieldNumber = 5
+	ExtensionRangeOptions_Declaration_Repeated_field_number protoreflect.FieldNumber = 6
 )
 
 // Names for google.protobuf.FieldDescriptorProto.
@@ -291,12 +318,41 @@ const (
 	FieldDescriptorProto_Type_enum_name     = "Type"
 )
 
+// Enum values for google.protobuf.FieldDescriptorProto.Type.
+const (
+	FieldDescriptorProto_TYPE_DOUBLE_enum_value   = 1
+	FieldDescriptorProto_TYPE_FLOAT_enum_value    = 2
+	FieldDescriptorProto_TYPE_INT64_enum_value    = 3
+	FieldDescriptorProto_TYPE_UINT64_enum_value   = 4
+	FieldDescriptorProto_TYPE_INT32_enum_value    = 5
+	FieldDescriptorProto_TYPE_FIXED64_enum_value  = 6
+	FieldDescriptorProto_TYPE_FIXED32_enum_value  = 7
+	FieldDescriptorProto_TYPE_BOOL_enum_value     = 8
+	FieldDescriptorProto_TYPE_STRING_enum_value   = 9
+	FieldDescriptorProto_TYPE_GROUP_enum_value    = 10
+	FieldDescriptorProto_TYPE_MESSAGE_enum_value  = 11
+	FieldDescriptorProto_TYPE_BYTES_enum_value    = 12
+	FieldDescriptorProto_TYPE_UINT32_enum_value   = 13
+	FieldDescriptorProto_TYPE_ENUM_enum_value     = 14
+	FieldDescriptorProto_TYPE_SFIXED32_enum_value = 15
+	FieldDescriptorProto_TYPE_SFIXED64_enum_value = 16
+	FieldDescriptorProto_TYPE_SINT32_enum_value   = 17
+	FieldDescriptorProto_TYPE_SINT64_enum_value   = 18
+)
+
 // Full and short names for google.protobuf.FieldDescriptorProto.Label.
 const (
 	FieldDescriptorProto_Label_enum_fullname = "google.protobuf.FieldDescriptorProto.Label"
 	FieldDescriptorProto_Label_enum_name     = "Label"
 )
 
+// Enum values for google.protobuf.FieldDescriptorProto.Label.
+const (
+	FieldDescriptorProto_LABEL_OPTIONAL_enum_value = 1
+	FieldDescriptorProto_LABEL_REPEATED_enum_value = 3
+	FieldDescriptorProto_LABEL_REQUIRED_enum_value = 2
+)
+
 // Names for google.protobuf.OneofDescriptorProto.
 const (
 	OneofDescriptorProto_message_name     protoreflect.Name     = "OneofDescriptorProto"
@@ -468,7 +524,6 @@ const (
 	FileOptions_CcGenericServices_field_name         protoreflect.Name = "cc_generic_services"
 	FileOptions_JavaGenericServices_field_name       protoreflect.Name = "java_generic_services"
 	FileOptions_PyGenericServices_field_name         protoreflect.Name = "py_generic_services"
-	FileOptions_PhpGenericServices_field_name        protoreflect.Name = "php_generic_services"
 	FileOptions_Deprecated_field_name                protoreflect.Name = "deprecated"
 	FileOptions_CcEnableArenas_field_name            protoreflect.Name = "cc_enable_arenas"
 	FileOptions_ObjcClassPrefix_field_name           protoreflect.Name = "objc_class_prefix"
@@ -478,6 +533,7 @@ const (
 	FileOptions_PhpNamespace_field_name              protoreflect.Name = "php_namespace"
 	FileOptions_PhpMetadataNamespace_field_name      protoreflect.Name = "php_metadata_namespace"
 	FileOptions_RubyPackage_field_name               protoreflect.Name = "ruby_package"
+	FileOptions_Features_field_name                  protoreflect.Name = "features"
 	FileOptions_UninterpretedOption_field_name       protoreflect.Name = "uninterpreted_option"
 
 	FileOptions_JavaPackage_field_fullname               protoreflect.FullName = "google.protobuf.FileOptions.java_package"
@@ -490,7 +546,6 @@ const (
 	FileOptions_CcGenericServices_field_fullname         protoreflect.FullName = "google.protobuf.FileOptions.cc_generic_services"
 	FileOptions_JavaGenericServices_field_fullname       protoreflect.FullName = "google.protobuf.FileOptions.java_generic_services"
 	FileOptions_PyGenericServices_field_fullname         protoreflect.FullName = "google.protobuf.FileOptions.py_generic_services"
-	FileOptions_PhpGenericServices_field_fullname        protoreflect.FullName = "google.protobuf.FileOptions.php_generic_services"
 	FileOptions_Deprecated_field_fullname                protoreflect.FullName = "google.protobuf.FileOptions.deprecated"
 	FileOptions_CcEnableArenas_field_fullname            protoreflect.FullName = "google.protobuf.FileOptions.cc_enable_arenas"
 	FileOptions_ObjcClassPrefix_field_fullname           protoreflect.FullName = "google.protobuf.FileOptions.objc_class_prefix"
@@ -500,6 +555,7 @@ const (
 	FileOptions_PhpNamespace_field_fullname              protoreflect.FullName = "google.protobuf.FileOptions.php_namespace"
 	FileOptions_PhpMetadataNamespace_field_fullname      protoreflect.FullName = "google.protobuf.FileOptions.php_metadata_namespace"
 	FileOptions_RubyPackage_field_fullname               protoreflect.FullName = "google.protobuf.FileOptions.ruby_package"
+	FileOptions_Features_field_fullname                  protoreflect.FullName = "google.protobuf.FileOptions.features"
 	FileOptions_UninterpretedOption_field_fullname       protoreflect.FullName = "google.protobuf.FileOptions.uninterpreted_option"
 )
 
@@ -515,7 +571,6 @@ const (
 	FileOptions_CcGenericServices_field_number         protoreflect.FieldNumber = 16
 	FileOptions_JavaGenericServices_field_number       protoreflect.FieldNumber = 17
 	FileOptions_PyGenericServices_field_number         protoreflect.FieldNumber = 18
-	FileOptions_PhpGenericServices_field_number        protoreflect.FieldNumber = 42
 	FileOptions_Deprecated_field_number                protoreflect.FieldNumber = 23
 	FileOptions_CcEnableArenas_field_number            protoreflect.FieldNumber = 31
 	FileOptions_ObjcClassPrefix_field_number           protoreflect.FieldNumber = 36
@@ -525,6 +580,7 @@ const (
 	FileOptions_PhpNamespace_field_number              protoreflect.FieldNumber = 41
 	FileOptions_PhpMetadataNamespace_field_number      protoreflect.FieldNumber = 44
 	FileOptions_RubyPackage_field_number               protoreflect.FieldNumber = 45
+	FileOptions_Features_field_number                  protoreflect.FieldNumber = 50
 	FileOptions_UninterpretedOption_field_number       protoreflect.FieldNumber = 999
 )
 
@@ -534,6 +590,13 @@ const (
 	FileOptions_OptimizeMode_enum_name     = "OptimizeMode"
 )
 
+// Enum values for google.protobuf.FileOptions.OptimizeMode.
+const (
+	FileOptions_SPEED_enum_value        = 1
+	FileOptions_CODE_SIZE_enum_value    = 2
+	FileOptions_LITE_RUNTIME_enum_value = 3
+)
+
 // Names for google.protobuf.MessageOptions.
 const (
 	MessageOptions_message_name     protoreflect.Name     = "MessageOptions"
@@ -547,6 +610,7 @@ const (
 	MessageOptions_Deprecated_field_name                         protoreflect.Name = "deprecated"
 	MessageOptions_MapEntry_field_name                           protoreflect.Name = "map_entry"
 	MessageOptions_DeprecatedLegacyJsonFieldConflicts_field_name protoreflect.Name = "deprecated_legacy_json_field_conflicts"
+	MessageOptions_Features_field_name                           protoreflect.Name = "features"
 	MessageOptions_UninterpretedOption_field_name                protoreflect.Name = "uninterpreted_option"
 
 	MessageOptions_MessageSetWireFormat_field_fullname               protoreflect.FullName = "google.protobuf.MessageOptions.message_set_wire_format"
@@ -554,6 +618,7 @@ const (
 	MessageOptions_Deprecated_field_fullname                         protoreflect.FullName = "google.protobuf.MessageOptions.deprecated"
 	MessageOptions_MapEntry_field_fullname                           protoreflect.FullName = "google.protobuf.MessageOptions.map_entry"
 	MessageOptions_DeprecatedLegacyJsonFieldConflicts_field_fullname protoreflect.FullName = "google.protobuf.MessageOptions.deprecated_legacy_json_field_conflicts"
+	MessageOptions_Features_field_fullname                           protoreflect.FullName = "google.protobuf.MessageOptions.features"
 	MessageOptions_UninterpretedOption_field_fullname                protoreflect.FullName = "google.protobuf.MessageOptions.uninterpreted_option"
 )
 
@@ -564,6 +629,7 @@ const (
 	MessageOptions_Deprecated_field_number                         protoreflect.FieldNumber = 3
 	MessageOptions_MapEntry_field_number                           protoreflect.FieldNumber = 7
 	MessageOptions_DeprecatedLegacyJsonFieldConflicts_field_number protoreflect.FieldNumber = 11
+	MessageOptions_Features_field_number                           protoreflect.FieldNumber = 12
 	MessageOptions_UninterpretedOption_field_number                protoreflect.FieldNumber = 999
 )
 
@@ -584,8 +650,9 @@ const (
 	FieldOptions_Weak_field_name                protoreflect.Name = "weak"
 	FieldOptions_DebugRedact_field_name         protoreflect.Name = "debug_redact"
 	FieldOptions_Retention_field_name           protoreflect.Name = "retention"
-	FieldOptions_Target_field_name              protoreflect.Name = "target"
 	FieldOptions_Targets_field_name             protoreflect.Name = "targets"
+	FieldOptions_EditionDefaults_field_name     protoreflect.Name = "edition_defaults"
+	FieldOptions_Features_field_name            protoreflect.Name = "features"
 	FieldOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option"
 
 	FieldOptions_Ctype_field_fullname               protoreflect.FullName = "google.protobuf.FieldOptions.ctype"
@@ -597,8 +664,9 @@ const (
 	FieldOptions_Weak_field_fullname                protoreflect.FullName = "google.protobuf.FieldOptions.weak"
 	FieldOptions_DebugRedact_field_fullname         protoreflect.FullName = "google.protobuf.FieldOptions.debug_redact"
 	FieldOptions_Retention_field_fullname           protoreflect.FullName = "google.protobuf.FieldOptions.retention"
-	FieldOptions_Target_field_fullname              protoreflect.FullName = "google.protobuf.FieldOptions.target"
 	FieldOptions_Targets_field_fullname             protoreflect.FullName = "google.protobuf.FieldOptions.targets"
+	FieldOptions_EditionDefaults_field_fullname     protoreflect.FullName = "google.protobuf.FieldOptions.edition_defaults"
+	FieldOptions_Features_field_fullname            protoreflect.FullName = "google.protobuf.FieldOptions.features"
 	FieldOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.uninterpreted_option"
 )
 
@@ -613,8 +681,9 @@ const (
 	FieldOptions_Weak_field_number                protoreflect.FieldNumber = 10
 	FieldOptions_DebugRedact_field_number         protoreflect.FieldNumber = 16
 	FieldOptions_Retention_field_number           protoreflect.FieldNumber = 17
-	FieldOptions_Target_field_number              protoreflect.FieldNumber = 18
 	FieldOptions_Targets_field_number             protoreflect.FieldNumber = 19
+	FieldOptions_EditionDefaults_field_number     protoreflect.FieldNumber = 20
+	FieldOptions_Features_field_number            protoreflect.FieldNumber = 21
 	FieldOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999
 )
 
@@ -624,24 +693,80 @@ const (
 	FieldOptions_CType_enum_name     = "CType"
 )
 
+// Enum values for google.protobuf.FieldOptions.CType.
+const (
+	FieldOptions_STRING_enum_value       = 0
+	FieldOptions_CORD_enum_value         = 1
+	FieldOptions_STRING_PIECE_enum_value = 2
+)
+
 // Full and short names for google.protobuf.FieldOptions.JSType.
 const (
 	FieldOptions_JSType_enum_fullname = "google.protobuf.FieldOptions.JSType"
 	FieldOptions_JSType_enum_name     = "JSType"
 )
 
+// Enum values for google.protobuf.FieldOptions.JSType.
+const (
+	FieldOptions_JS_NORMAL_enum_value = 0
+	FieldOptions_JS_STRING_enum_value = 1
+	FieldOptions_JS_NUMBER_enum_value = 2
+)
+
 // Full and short names for google.protobuf.FieldOptions.OptionRetention.
 const (
 	FieldOptions_OptionRetention_enum_fullname = "google.protobuf.FieldOptions.OptionRetention"
 	FieldOptions_OptionRetention_enum_name     = "OptionRetention"
 )
 
+// Enum values for google.protobuf.FieldOptions.OptionRetention.
+const (
+	FieldOptions_RETENTION_UNKNOWN_enum_value = 0
+	FieldOptions_RETENTION_RUNTIME_enum_value = 1
+	FieldOptions_RETENTION_SOURCE_enum_value  = 2
+)
+
 // Full and short names for google.protobuf.FieldOptions.OptionTargetType.
 const (
 	FieldOptions_OptionTargetType_enum_fullname = "google.protobuf.FieldOptions.OptionTargetType"
 	FieldOptions_OptionTargetType_enum_name     = "OptionTargetType"
 )
 
+// Enum values for google.protobuf.FieldOptions.OptionTargetType.
+const (
+	FieldOptions_TARGET_TYPE_UNKNOWN_enum_value         = 0
+	FieldOptions_TARGET_TYPE_FILE_enum_value            = 1
+	FieldOptions_TARGET_TYPE_EXTENSION_RANGE_enum_value = 2
+	FieldOptions_TARGET_TYPE_MESSAGE_enum_value         = 3
+	FieldOptions_TARGET_TYPE_FIELD_enum_value           = 4
+	FieldOptions_TARGET_TYPE_ONEOF_enum_value           = 5
+	FieldOptions_TARGET_TYPE_ENUM_enum_value            = 6
+	FieldOptions_TARGET_TYPE_ENUM_ENTRY_enum_value      = 7
+	FieldOptions_TARGET_TYPE_SERVICE_enum_value         = 8
+	FieldOptions_TARGET_TYPE_METHOD_enum_value          = 9
+)
+
+// Names for google.protobuf.FieldOptions.EditionDefault.
+const (
+	FieldOptions_EditionDefault_message_name     protoreflect.Name     = "EditionDefault"
+	FieldOptions_EditionDefault_message_fullname protoreflect.FullName = "google.protobuf.FieldOptions.EditionDefault"
+)
+
+// Field names for google.protobuf.FieldOptions.EditionDefault.
+const (
+	FieldOptions_EditionDefault_Edition_field_name protoreflect.Name = "edition"
+	FieldOptions_EditionDefault_Value_field_name   protoreflect.Name = "value"
+
+	FieldOptions_EditionDefault_Edition_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.EditionDefault.edition"
+	FieldOptions_EditionDefault_Value_field_fullname   protoreflect.FullName = "google.protobuf.FieldOptions.EditionDefault.value"
+)
+
+// Field numbers for google.protobuf.FieldOptions.EditionDefault.
+const (
+	FieldOptions_EditionDefault_Edition_field_number protoreflect.FieldNumber = 3
+	FieldOptions_EditionDefault_Value_field_number   protoreflect.FieldNumber = 2
+)
+
 // Names for google.protobuf.OneofOptions.
 const (
 	OneofOptions_message_name     protoreflect.Name     = "OneofOptions"
@@ -650,13 +775,16 @@ const (
 
 // Field names for google.protobuf.OneofOptions.
 const (
+	OneofOptions_Features_field_name            protoreflect.Name = "features"
 	OneofOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option"
 
+	OneofOptions_Features_field_fullname            protoreflect.FullName = "google.protobuf.OneofOptions.features"
 	OneofOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.OneofOptions.uninterpreted_option"
 )
 
 // Field numbers for google.protobuf.OneofOptions.
 const (
+	OneofOptions_Features_field_number            protoreflect.FieldNumber = 1
 	OneofOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999
 )
 
@@ -671,11 +799,13 @@ const (
 	EnumOptions_AllowAlias_field_name                         protoreflect.Name = "allow_alias"
 	EnumOptions_Deprecated_field_name                         protoreflect.Name = "deprecated"
 	EnumOptions_DeprecatedLegacyJsonFieldConflicts_field_name protoreflect.Name = "deprecated_legacy_json_field_conflicts"
+	EnumOptions_Features_field_name                           protoreflect.Name = "features"
 	EnumOptions_UninterpretedOption_field_name                protoreflect.Name = "uninterpreted_option"
 
 	EnumOptions_AllowAlias_field_fullname                         protoreflect.FullName = "google.protobuf.EnumOptions.allow_alias"
 	EnumOptions_Deprecated_field_fullname                         protoreflect.FullName = "google.protobuf.EnumOptions.deprecated"
 	EnumOptions_DeprecatedLegacyJsonFieldConflicts_field_fullname protoreflect.FullName = "google.protobuf.EnumOptions.deprecated_legacy_json_field_conflicts"
+	EnumOptions_Features_field_fullname                           protoreflect.FullName = "google.protobuf.EnumOptions.features"
 	EnumOptions_UninterpretedOption_field_fullname                protoreflect.FullName = "google.protobuf.EnumOptions.uninterpreted_option"
 )
 
@@ -684,6 +814,7 @@ const (
 	EnumOptions_AllowAlias_field_number                         protoreflect.FieldNumber = 2
 	EnumOptions_Deprecated_field_number                         protoreflect.FieldNumber = 3
 	EnumOptions_DeprecatedLegacyJsonFieldConflicts_field_number protoreflect.FieldNumber = 6
+	EnumOptions_Features_field_number                           protoreflect.FieldNumber = 7
 	EnumOptions_UninterpretedOption_field_number                protoreflect.FieldNumber = 999
 )
 
@@ -696,15 +827,21 @@ const (
 // Field names for google.protobuf.EnumValueOptions.
 const (
 	EnumValueOptions_Deprecated_field_name          protoreflect.Name = "deprecated"
+	EnumValueOptions_Features_field_name            protoreflect.Name = "features"
+	EnumValueOptions_DebugRedact_field_name         protoreflect.Name = "debug_redact"
 	EnumValueOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option"
 
 	EnumValueOptions_Deprecated_field_fullname          protoreflect.FullName = "google.protobuf.EnumValueOptions.deprecated"
+	EnumValueOptions_Features_field_fullname            protoreflect.FullName = "google.protobuf.EnumValueOptions.features"
+	EnumValueOptions_DebugRedact_field_fullname         protoreflect.FullName = "google.protobuf.EnumValueOptions.debug_redact"
 	EnumValueOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.uninterpreted_option"
 )
 
 // Field numbers for google.protobuf.EnumValueOptions.
 const (
 	EnumValueOptions_Deprecated_field_number          protoreflect.FieldNumber = 1
+	EnumValueOptions_Features_field_number            protoreflect.FieldNumber = 2
+	EnumValueOptions_DebugRedact_field_number         protoreflect.FieldNumber = 3
 	EnumValueOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999
 )
 
@@ -716,15 +853,18 @@ const (
 
 // Field names for google.protobuf.ServiceOptions.
 const (
+	ServiceOptions_Features_field_name            protoreflect.Name = "features"
 	ServiceOptions_Deprecated_field_name          protoreflect.Name = "deprecated"
 	ServiceOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option"
 
+	ServiceOptions_Features_field_fullname            protoreflect.FullName = "google.protobuf.ServiceOptions.features"
 	ServiceOptions_Deprecated_field_fullname          protoreflect.FullName = "google.protobuf.ServiceOptions.deprecated"
 	ServiceOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.ServiceOptions.uninterpreted_option"
 )
 
 // Field numbers for google.protobuf.ServiceOptions.
 const (
+	ServiceOptions_Features_field_number            protoreflect.FieldNumber = 34
 	ServiceOptions_Deprecated_field_number          protoreflect.FieldNumber = 33
 	ServiceOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999
 )
@@ -739,10 +879,12 @@ const (
 const (
 	MethodOptions_Deprecated_field_name          protoreflect.Name = "deprecated"
 	MethodOptions_IdempotencyLevel_field_name    protoreflect.Name = "idempotency_level"
+	MethodOptions_Features_field_name            protoreflect.Name = "features"
 	MethodOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option"
 
 	MethodOptions_Deprecated_field_fullname          protoreflect.FullName = "google.protobuf.MethodOptions.deprecated"
 	MethodOptions_IdempotencyLevel_field_fullname    protoreflect.FullName = "google.protobuf.MethodOptions.idempotency_level"
+	MethodOptions_Features_field_fullname            protoreflect.FullName = "google.protobuf.MethodOptions.features"
 	MethodOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.MethodOptions.uninterpreted_option"
 )
 
@@ -750,6 +892,7 @@ const (
 const (
 	MethodOptions_Deprecated_field_number          protoreflect.FieldNumber = 33
 	MethodOptions_IdempotencyLevel_field_number    protoreflect.FieldNumber = 34
+	MethodOptions_Features_field_number            protoreflect.FieldNumber = 35
 	MethodOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999
 )
 
@@ -759,6 +902,13 @@ const (
 	MethodOptions_IdempotencyLevel_enum_name     = "IdempotencyLevel"
 )
 
+// Enum values for google.protobuf.MethodOptions.IdempotencyLevel.
+const (
+	MethodOptions_IDEMPOTENCY_UNKNOWN_enum_value = 0
+	MethodOptions_NO_SIDE_EFFECTS_enum_value     = 1
+	MethodOptions_IDEMPOTENT_enum_value          = 2
+)
+
 // Names for google.protobuf.UninterpretedOption.
 const (
 	UninterpretedOption_message_name     protoreflect.Name     = "UninterpretedOption"
@@ -816,6 +966,163 @@ const (
 	UninterpretedOption_NamePart_IsExtension_field_number protoreflect.FieldNumber = 2
 )
 
+// Names for google.protobuf.FeatureSet.
+const (
+	FeatureSet_message_name     protoreflect.Name     = "FeatureSet"
+	FeatureSet_message_fullname protoreflect.FullName = "google.protobuf.FeatureSet"
+)
+
+// Field names for google.protobuf.FeatureSet.
+const (
+	FeatureSet_FieldPresence_field_name         protoreflect.Name = "field_presence"
+	FeatureSet_EnumType_field_name              protoreflect.Name = "enum_type"
+	FeatureSet_RepeatedFieldEncoding_field_name protoreflect.Name = "repeated_field_encoding"
+	FeatureSet_Utf8Validation_field_name        protoreflect.Name = "utf8_validation"
+	FeatureSet_MessageEncoding_field_name       protoreflect.Name = "message_encoding"
+	FeatureSet_JsonFormat_field_name            protoreflect.Name = "json_format"
+
+	FeatureSet_FieldPresence_field_fullname         protoreflect.FullName = "google.protobuf.FeatureSet.field_presence"
+	FeatureSet_EnumType_field_fullname              protoreflect.FullName = "google.protobuf.FeatureSet.enum_type"
+	FeatureSet_RepeatedFieldEncoding_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.repeated_field_encoding"
+	FeatureSet_Utf8Validation_field_fullname        protoreflect.FullName = "google.protobuf.FeatureSet.utf8_validation"
+	FeatureSet_MessageEncoding_field_fullname       protoreflect.FullName = "google.protobuf.FeatureSet.message_encoding"
+	FeatureSet_JsonFormat_field_fullname            protoreflect.FullName = "google.protobuf.FeatureSet.json_format"
+)
+
+// Field numbers for google.protobuf.FeatureSet.
+const (
+	FeatureSet_FieldPresence_field_number         protoreflect.FieldNumber = 1
+	FeatureSet_EnumType_field_number              protoreflect.FieldNumber = 2
+	FeatureSet_RepeatedFieldEncoding_field_number protoreflect.FieldNumber = 3
+	FeatureSet_Utf8Validation_field_number        protoreflect.FieldNumber = 4
+	FeatureSet_MessageEncoding_field_number       protoreflect.FieldNumber = 5
+	FeatureSet_JsonFormat_field_number            protoreflect.FieldNumber = 6
+)
+
+// Full and short names for google.protobuf.FeatureSet.FieldPresence.
+const (
+	FeatureSet_FieldPresence_enum_fullname = "google.protobuf.FeatureSet.FieldPresence"
+	FeatureSet_FieldPresence_enum_name     = "FieldPresence"
+)
+
+// Enum values for google.protobuf.FeatureSet.FieldPresence.
+const (
+	FeatureSet_FIELD_PRESENCE_UNKNOWN_enum_value = 0
+	FeatureSet_EXPLICIT_enum_value               = 1
+	FeatureSet_IMPLICIT_enum_value               = 2
+	FeatureSet_LEGACY_REQUIRED_enum_value        = 3
+)
+
+// Full and short names for google.protobuf.FeatureSet.EnumType.
+const (
+	FeatureSet_EnumType_enum_fullname = "google.protobuf.FeatureSet.EnumType"
+	FeatureSet_EnumType_enum_name     = "EnumType"
+)
+
+// Enum values for google.protobuf.FeatureSet.EnumType.
+const (
+	FeatureSet_ENUM_TYPE_UNKNOWN_enum_value = 0
+	FeatureSet_OPEN_enum_value              = 1
+	FeatureSet_CLOSED_enum_value            = 2
+)
+
+// Full and short names for google.protobuf.FeatureSet.RepeatedFieldEncoding.
+const (
+	FeatureSet_RepeatedFieldEncoding_enum_fullname = "google.protobuf.FeatureSet.RepeatedFieldEncoding"
+	FeatureSet_RepeatedFieldEncoding_enum_name     = "RepeatedFieldEncoding"
+)
+
+// Enum values for google.protobuf.FeatureSet.RepeatedFieldEncoding.
+const (
+	FeatureSet_REPEATED_FIELD_ENCODING_UNKNOWN_enum_value = 0
+	FeatureSet_PACKED_enum_value                          = 1
+	FeatureSet_EXPANDED_enum_value                        = 2
+)
+
+// Full and short names for google.protobuf.FeatureSet.Utf8Validation.
+const (
+	FeatureSet_Utf8Validation_enum_fullname = "google.protobuf.FeatureSet.Utf8Validation"
+	FeatureSet_Utf8Validation_enum_name     = "Utf8Validation"
+)
+
+// Enum values for google.protobuf.FeatureSet.Utf8Validation.
+const (
+	FeatureSet_UTF8_VALIDATION_UNKNOWN_enum_value = 0
+	FeatureSet_VERIFY_enum_value                  = 2
+	FeatureSet_NONE_enum_value                    = 3
+)
+
+// Full and short names for google.protobuf.FeatureSet.MessageEncoding.
+const (
+	FeatureSet_MessageEncoding_enum_fullname = "google.protobuf.FeatureSet.MessageEncoding"
+	FeatureSet_MessageEncoding_enum_name     = "MessageEncoding"
+)
+
+// Enum values for google.protobuf.FeatureSet.MessageEncoding.
+const (
+	FeatureSet_MESSAGE_ENCODING_UNKNOWN_enum_value = 0
+	FeatureSet_LENGTH_PREFIXED_enum_value          = 1
+	FeatureSet_DELIMITED_enum_value                = 2
+)
+
+// Full and short names for google.protobuf.FeatureSet.JsonFormat.
+const (
+	FeatureSet_JsonFormat_enum_fullname = "google.protobuf.FeatureSet.JsonFormat"
+	FeatureSet_JsonFormat_enum_name     = "JsonFormat"
+)
+
+// Enum values for google.protobuf.FeatureSet.JsonFormat.
+const (
+	FeatureSet_JSON_FORMAT_UNKNOWN_enum_value = 0
+	FeatureSet_ALLOW_enum_value               = 1
+	FeatureSet_LEGACY_BEST_EFFORT_enum_value  = 2
+)
+
+// Names for google.protobuf.FeatureSetDefaults.
+const (
+	FeatureSetDefaults_message_name     protoreflect.Name     = "FeatureSetDefaults"
+	FeatureSetDefaults_message_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults"
+)
+
+// Field names for google.protobuf.FeatureSetDefaults.
+const (
+	FeatureSetDefaults_Defaults_field_name       protoreflect.Name = "defaults"
+	FeatureSetDefaults_MinimumEdition_field_name protoreflect.Name = "minimum_edition"
+	FeatureSetDefaults_MaximumEdition_field_name protoreflect.Name = "maximum_edition"
+
+	FeatureSetDefaults_Defaults_field_fullname       protoreflect.FullName = "google.protobuf.FeatureSetDefaults.defaults"
+	FeatureSetDefaults_MinimumEdition_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.minimum_edition"
+	FeatureSetDefaults_MaximumEdition_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.maximum_edition"
+)
+
+// Field numbers for google.protobuf.FeatureSetDefaults.
+const (
+	FeatureSetDefaults_Defaults_field_number       protoreflect.FieldNumber = 1
+	FeatureSetDefaults_MinimumEdition_field_number protoreflect.FieldNumber = 4
+	FeatureSetDefaults_MaximumEdition_field_number protoreflect.FieldNumber = 5
+)
+
+// Names for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.
+const (
+	FeatureSetDefaults_FeatureSetEditionDefault_message_name     protoreflect.Name     = "FeatureSetEditionDefault"
+	FeatureSetDefaults_FeatureSetEditionDefault_message_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault"
+)
+
+// Field names for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.
+const (
+	FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_name  protoreflect.Name = "edition"
+	FeatureSetDefaults_FeatureSetEditionDefault_Features_field_name protoreflect.Name = "features"
+
+	FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_fullname  protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition"
+	FeatureSetDefaults_FeatureSetEditionDefault_Features_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.features"
+)
+
+// Field numbers for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.
+const (
+	FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_number  protoreflect.FieldNumber = 3
+	FeatureSetDefaults_FeatureSetEditionDefault_Features_field_number protoreflect.FieldNumber = 2
+)
+
 // Names for google.protobuf.SourceCodeInfo.
 const (
 	SourceCodeInfo_message_name     protoreflect.Name     = "SourceCodeInfo"
@@ -917,3 +1224,10 @@ const (
 	GeneratedCodeInfo_Annotation_Semantic_enum_fullname = "google.protobuf.GeneratedCodeInfo.Annotation.Semantic"
 	GeneratedCodeInfo_Annotation_Semantic_enum_name     = "Semantic"
 )
+
+// Enum values for google.protobuf.GeneratedCodeInfo.Annotation.Semantic.
+const (
+	GeneratedCodeInfo_Annotation_NONE_enum_value  = 0
+	GeneratedCodeInfo_Annotation_SET_enum_value   = 1
+	GeneratedCodeInfo_Annotation_ALIAS_enum_value = 2
+)
diff --git a/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go b/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go
new file mode 100644
index 000000000..fd9015e8e
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go
@@ -0,0 +1,31 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Code generated by generate-protos. DO NOT EDIT.
+
+package genid
+
+import (
+	protoreflect "google.golang.org/protobuf/reflect/protoreflect"
+)
+
+const File_reflect_protodesc_proto_go_features_proto = "reflect/protodesc/proto/go_features.proto"
+
+// Names for google.protobuf.GoFeatures.
+const (
+	GoFeatures_message_name     protoreflect.Name     = "GoFeatures"
+	GoFeatures_message_fullname protoreflect.FullName = "google.protobuf.GoFeatures"
+)
+
+// Field names for google.protobuf.GoFeatures.
+const (
+	GoFeatures_LegacyUnmarshalJsonEnum_field_name protoreflect.Name = "legacy_unmarshal_json_enum"
+
+	GoFeatures_LegacyUnmarshalJsonEnum_field_fullname protoreflect.FullName = "google.protobuf.GoFeatures.legacy_unmarshal_json_enum"
+)
+
+// Field numbers for google.protobuf.GoFeatures.
+const (
+	GoFeatures_LegacyUnmarshalJsonEnum_field_number protoreflect.FieldNumber = 1
+)
diff --git a/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go b/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go
index 1a38944b2..ad6f80c46 100644
--- a/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go
+++ b/vendor/google.golang.org/protobuf/internal/genid/struct_gen.go
@@ -18,6 +18,11 @@ const (
 	NullValue_enum_name     = "NullValue"
 )
 
+// Enum values for google.protobuf.NullValue.
+const (
+	NullValue_NULL_VALUE_enum_value = 0
+)
+
 // Names for google.protobuf.Struct.
 const (
 	Struct_message_name     protoreflect.Name     = "Struct"
diff --git a/vendor/google.golang.org/protobuf/internal/genid/type_gen.go b/vendor/google.golang.org/protobuf/internal/genid/type_gen.go
index e0f75fea0..49bc73e25 100644
--- a/vendor/google.golang.org/protobuf/internal/genid/type_gen.go
+++ b/vendor/google.golang.org/protobuf/internal/genid/type_gen.go
@@ -18,6 +18,13 @@ const (
 	Syntax_enum_name     = "Syntax"
 )
 
+// Enum values for google.protobuf.Syntax.
+const (
+	Syntax_SYNTAX_PROTO2_enum_value   = 0
+	Syntax_SYNTAX_PROTO3_enum_value   = 1
+	Syntax_SYNTAX_EDITIONS_enum_value = 2
+)
+
 // Names for google.protobuf.Type.
 const (
 	Type_message_name     protoreflect.Name     = "Type"
@@ -105,12 +112,43 @@ const (
 	Field_Kind_enum_name     = "Kind"
 )
 
+// Enum values for google.protobuf.Field.Kind.
+const (
+	Field_TYPE_UNKNOWN_enum_value  = 0
+	Field_TYPE_DOUBLE_enum_value   = 1
+	Field_TYPE_FLOAT_enum_value    = 2
+	Field_TYPE_INT64_enum_value    = 3
+	Field_TYPE_UINT64_enum_value   = 4
+	Field_TYPE_INT32_enum_value    = 5
+	Field_TYPE_FIXED64_enum_value  = 6
+	Field_TYPE_FIXED32_enum_value  = 7
+	Field_TYPE_BOOL_enum_value     = 8
+	Field_TYPE_STRING_enum_value   = 9
+	Field_TYPE_GROUP_enum_value    = 10
+	Field_TYPE_MESSAGE_enum_value  = 11
+	Field_TYPE_BYTES_enum_value    = 12
+	Field_TYPE_UINT32_enum_value   = 13
+	Field_TYPE_ENUM_enum_value     = 14
+	Field_TYPE_SFIXED32_enum_value = 15
+	Field_TYPE_SFIXED64_enum_value = 16
+	Field_TYPE_SINT32_enum_value   = 17
+	Field_TYPE_SINT64_enum_value   = 18
+)
+
 // Full and short names for google.protobuf.Field.Cardinality.
 const (
 	Field_Cardinality_enum_fullname = "google.protobuf.Field.Cardinality"
 	Field_Cardinality_enum_name     = "Cardinality"
 )
 
+// Enum values for google.protobuf.Field.Cardinality.
+const (
+	Field_CARDINALITY_UNKNOWN_enum_value  = 0
+	Field_CARDINALITY_OPTIONAL_enum_value = 1
+	Field_CARDINALITY_REQUIRED_enum_value = 2
+	Field_CARDINALITY_REPEATED_enum_value = 3
+)
+
 // Names for google.protobuf.Enum.
 const (
 	Enum_message_name     protoreflect.Name     = "Enum"
diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go
index e74cefdc5..2b8f122c2 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go
@@ -21,26 +21,18 @@ type extensionFieldInfo struct {
 	validation          validationInfo
 }
 
-var legacyExtensionFieldInfoCache sync.Map // map[protoreflect.ExtensionType]*extensionFieldInfo
-
 func getExtensionFieldInfo(xt protoreflect.ExtensionType) *extensionFieldInfo {
 	if xi, ok := xt.(*ExtensionInfo); ok {
 		xi.lazyInit()
 		return xi.info
 	}
-	return legacyLoadExtensionFieldInfo(xt)
-}
-
-// legacyLoadExtensionFieldInfo dynamically loads a *ExtensionInfo for xt.
-func legacyLoadExtensionFieldInfo(xt protoreflect.ExtensionType) *extensionFieldInfo {
-	if xi, ok := legacyExtensionFieldInfoCache.Load(xt); ok {
-		return xi.(*extensionFieldInfo)
-	}
-	e := makeExtensionFieldInfo(xt.TypeDescriptor())
-	if e, ok := legacyMessageTypeCache.LoadOrStore(xt, e); ok {
-		return e.(*extensionFieldInfo)
-	}
-	return e
+	// Ideally we'd cache the resulting *extensionFieldInfo so we don't have to
+	// recompute this metadata repeatedly. But without support for something like
+	// weak references, such a cache would pin temporary values (like dynamic
+	// extension types, constructed for the duration of a user request) to the
+	// heap forever, causing memory usage of the cache to grow unbounded.
+	// See discussion in https://github.com/golang/protobuf/issues/1521.
+	return makeExtensionFieldInfo(xt.TypeDescriptor())
 }
 
 func makeExtensionFieldInfo(xd protoreflect.ExtensionDescriptor) *extensionFieldInfo {
diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go b/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go
index 1a509b63e..f55dc01e3 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/codec_gen.go
@@ -162,11 +162,20 @@ func appendBoolSlice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptions
 func consumeBoolSlice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.BoolSlice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := 0
+		for _, v := range b {
+			if v < 0x80 {
+				count++
+			}
+		}
+		if count > 0 {
+			p.growBoolSlice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			var v uint64
 			var n int
@@ -732,11 +741,20 @@ func appendInt32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOption
 func consumeInt32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Int32Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := 0
+		for _, v := range b {
+			if v < 0x80 {
+				count++
+			}
+		}
+		if count > 0 {
+			p.growInt32Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			var v uint64
 			var n int
@@ -1138,11 +1156,20 @@ func appendSint32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio
 func consumeSint32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Int32Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := 0
+		for _, v := range b {
+			if v < 0x80 {
+				count++
+			}
+		}
+		if count > 0 {
+			p.growInt32Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			var v uint64
 			var n int
@@ -1544,11 +1571,20 @@ func appendUint32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio
 func consumeUint32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Uint32Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := 0
+		for _, v := range b {
+			if v < 0x80 {
+				count++
+			}
+		}
+		if count > 0 {
+			p.growUint32Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			var v uint64
 			var n int
@@ -1950,11 +1986,20 @@ func appendInt64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOption
 func consumeInt64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Int64Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := 0
+		for _, v := range b {
+			if v < 0x80 {
+				count++
+			}
+		}
+		if count > 0 {
+			p.growInt64Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			var v uint64
 			var n int
@@ -2356,11 +2401,20 @@ func appendSint64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio
 func consumeSint64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Int64Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := 0
+		for _, v := range b {
+			if v < 0x80 {
+				count++
+			}
+		}
+		if count > 0 {
+			p.growInt64Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			var v uint64
 			var n int
@@ -2762,11 +2816,20 @@ func appendUint64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio
 func consumeUint64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Uint64Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := 0
+		for _, v := range b {
+			if v < 0x80 {
+				count++
+			}
+		}
+		if count > 0 {
+			p.growUint64Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			var v uint64
 			var n int
@@ -3145,11 +3208,15 @@ func appendSfixed32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpt
 func consumeSfixed32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Int32Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := len(b) / protowire.SizeFixed32()
+		if count > 0 {
+			p.growInt32Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			v, n := protowire.ConsumeFixed32(b)
 			if n < 0 {
@@ -3461,11 +3528,15 @@ func appendFixed32Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpti
 func consumeFixed32Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Uint32Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := len(b) / protowire.SizeFixed32()
+		if count > 0 {
+			p.growUint32Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			v, n := protowire.ConsumeFixed32(b)
 			if n < 0 {
@@ -3777,11 +3848,15 @@ func appendFloatSlice(b []byte, p pointer, f *coderFieldInfo, opts marshalOption
 func consumeFloatSlice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Float32Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := len(b) / protowire.SizeFixed32()
+		if count > 0 {
+			p.growFloat32Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			v, n := protowire.ConsumeFixed32(b)
 			if n < 0 {
@@ -4093,11 +4168,15 @@ func appendSfixed64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpt
 func consumeSfixed64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Int64Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := len(b) / protowire.SizeFixed64()
+		if count > 0 {
+			p.growInt64Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			v, n := protowire.ConsumeFixed64(b)
 			if n < 0 {
@@ -4409,11 +4488,15 @@ func appendFixed64Slice(b []byte, p pointer, f *coderFieldInfo, opts marshalOpti
 func consumeFixed64Slice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Uint64Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := len(b) / protowire.SizeFixed64()
+		if count > 0 {
+			p.growUint64Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			v, n := protowire.ConsumeFixed64(b)
 			if n < 0 {
@@ -4725,11 +4808,15 @@ func appendDoubleSlice(b []byte, p pointer, f *coderFieldInfo, opts marshalOptio
 func consumeDoubleSlice(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) {
 	sp := p.Float64Slice()
 	if wtyp == protowire.BytesType {
-		s := *sp
 		b, n := protowire.ConsumeBytes(b)
 		if n < 0 {
 			return out, errDecode
 		}
+		count := len(b) / protowire.SizeFixed64()
+		if count > 0 {
+			p.growFloat64Slice(count)
+		}
+		s := *sp
 		for len(b) > 0 {
 			v, n := protowire.ConsumeFixed64(b)
 			if n < 0 {
diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go b/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go
index 576dcf3aa..13077751e 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go
@@ -197,7 +197,7 @@ func fieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) (*MessageInfo,
 		return getMessageInfo(ft), makeMessageFieldCoder(fd, ft)
 	case fd.Kind() == protoreflect.GroupKind:
 		return getMessageInfo(ft), makeGroupFieldCoder(fd, ft)
-	case fd.Syntax() == protoreflect.Proto3 && fd.ContainingOneof() == nil:
+	case !fd.HasPresence() && fd.ContainingOneof() == nil:
 		// Populated oneof fields always encode even if set to the zero value,
 		// which normally are not encoded in proto3.
 		switch fd.Kind() {
diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go
index 61c483fac..2ab2c6297 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go
@@ -206,13 +206,18 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name protoreflect.FullName
 
 	// Obtain a list of oneof wrapper types.
 	var oneofWrappers []reflect.Type
-	for _, method := range []string{"XXX_OneofFuncs", "XXX_OneofWrappers"} {
-		if fn, ok := t.MethodByName(method); ok {
-			for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) {
-				if vs, ok := v.Interface().([]interface{}); ok {
-					for _, v := range vs {
-						oneofWrappers = append(oneofWrappers, reflect.TypeOf(v))
-					}
+	methods := make([]reflect.Method, 0, 2)
+	if m, ok := t.MethodByName("XXX_OneofFuncs"); ok {
+		methods = append(methods, m)
+	}
+	if m, ok := t.MethodByName("XXX_OneofWrappers"); ok {
+		methods = append(methods, m)
+	}
+	for _, fn := range methods {
+		for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) {
+			if vs, ok := v.Interface().([]interface{}); ok {
+				for _, v := range vs {
+					oneofWrappers = append(oneofWrappers, reflect.TypeOf(v))
 				}
 			}
 		}
diff --git a/vendor/google.golang.org/protobuf/internal/impl/message.go b/vendor/google.golang.org/protobuf/internal/impl/message.go
index 4f5fb67a0..629bacdce 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/message.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/message.go
@@ -192,12 +192,17 @@ fieldLoop:
 
 	// Derive a mapping of oneof wrappers to fields.
 	oneofWrappers := mi.OneofWrappers
-	for _, method := range []string{"XXX_OneofFuncs", "XXX_OneofWrappers"} {
-		if fn, ok := reflect.PtrTo(t).MethodByName(method); ok {
-			for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) {
-				if vs, ok := v.Interface().([]interface{}); ok {
-					oneofWrappers = vs
-				}
+	methods := make([]reflect.Method, 0, 2)
+	if m, ok := reflect.PtrTo(t).MethodByName("XXX_OneofFuncs"); ok {
+		methods = append(methods, m)
+	}
+	if m, ok := reflect.PtrTo(t).MethodByName("XXX_OneofWrappers"); ok {
+		methods = append(methods, m)
+	}
+	for _, fn := range methods {
+		for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) {
+			if vs, ok := v.Interface().([]interface{}); ok {
+				oneofWrappers = vs
 			}
 		}
 	}
diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go
index 5e736c60e..986322b19 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go
@@ -538,6 +538,6 @@ func isZero(v reflect.Value) bool {
 		}
 		return true
 	default:
-		panic(&reflect.ValueError{"reflect.Value.IsZero", v.Kind()})
+		panic(&reflect.ValueError{Method: "reflect.Value.IsZero", Kind: v.Kind()})
 	}
 }
diff --git a/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go b/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go
index 4c491bdf4..517e94434 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go
@@ -159,6 +159,42 @@ func (p pointer) SetPointer(v pointer) {
 	p.v.Elem().Set(v.v)
 }
 
+func growSlice(p pointer, addCap int) {
+	// TODO: Once we only support Go 1.20 and newer, use reflect.Grow.
+	in := p.v.Elem()
+	out := reflect.MakeSlice(in.Type(), in.Len(), in.Len()+addCap)
+	reflect.Copy(out, in)
+	p.v.Elem().Set(out)
+}
+
+func (p pointer) growBoolSlice(addCap int) {
+	growSlice(p, addCap)
+}
+
+func (p pointer) growInt32Slice(addCap int) {
+	growSlice(p, addCap)
+}
+
+func (p pointer) growUint32Slice(addCap int) {
+	growSlice(p, addCap)
+}
+
+func (p pointer) growInt64Slice(addCap int) {
+	growSlice(p, addCap)
+}
+
+func (p pointer) growUint64Slice(addCap int) {
+	growSlice(p, addCap)
+}
+
+func (p pointer) growFloat64Slice(addCap int) {
+	growSlice(p, addCap)
+}
+
+func (p pointer) growFloat32Slice(addCap int) {
+	growSlice(p, addCap)
+}
+
 func (Export) MessageStateOf(p Pointer) *messageState     { panic("not supported") }
 func (ms *messageState) pointer() pointer                 { panic("not supported") }
 func (ms *messageState) messageInfo() *MessageInfo        { panic("not supported") }
diff --git a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go
index ee0e0573e..4b020e311 100644
--- a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go
+++ b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go
@@ -138,6 +138,46 @@ func (p pointer) SetPointer(v pointer) {
 	*(*unsafe.Pointer)(p.p) = (unsafe.Pointer)(v.p)
 }
 
+func (p pointer) growBoolSlice(addCap int) {
+	sp := p.BoolSlice()
+	s := make([]bool, 0, addCap+len(*sp))
+	s = s[:len(*sp)]
+	copy(s, *sp)
+	*sp = s
+}
+
+func (p pointer) growInt32Slice(addCap int) {
+	sp := p.Int32Slice()
+	s := make([]int32, 0, addCap+len(*sp))
+	s = s[:len(*sp)]
+	copy(s, *sp)
+	*sp = s
+}
+
+func (p pointer) growUint32Slice(addCap int) {
+	p.growInt32Slice(addCap)
+}
+
+func (p pointer) growFloat32Slice(addCap int) {
+	p.growInt32Slice(addCap)
+}
+
+func (p pointer) growInt64Slice(addCap int) {
+	sp := p.Int64Slice()
+	s := make([]int64, 0, addCap+len(*sp))
+	s = s[:len(*sp)]
+	copy(s, *sp)
+	*sp = s
+}
+
+func (p pointer) growUint64Slice(addCap int) {
+	p.growInt64Slice(addCap)
+}
+
+func (p pointer) growFloat64Slice(addCap int) {
+	p.growInt64Slice(addCap)
+}
+
 // Static check that MessageState does not exceed the size of a pointer.
 const _ = uint(unsafe.Sizeof(unsafe.Pointer(nil)) - unsafe.Sizeof(MessageState{}))
 
diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings.go b/vendor/google.golang.org/protobuf/internal/strs/strings.go
index 0b74e7658..a6e7df244 100644
--- a/vendor/google.golang.org/protobuf/internal/strs/strings.go
+++ b/vendor/google.golang.org/protobuf/internal/strs/strings.go
@@ -17,7 +17,7 @@ import (
 
 // EnforceUTF8 reports whether to enforce strict UTF-8 validation.
 func EnforceUTF8(fd protoreflect.FieldDescriptor) bool {
-	if flags.ProtoLegacy {
+	if flags.ProtoLegacy || fd.Syntax() == protoreflect.Editions {
 		if fd, ok := fd.(interface{ EnforceUTF8() bool }); ok {
 			return fd.EnforceUTF8()
 		}
diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go
similarity index 96%
rename from vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go
rename to vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go
index 61a84d341..a008acd09 100644
--- a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go
+++ b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go
@@ -2,8 +2,8 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:build !purego && !appengine
-// +build !purego,!appengine
+//go:build !purego && !appengine && !go1.21
+// +build !purego,!appengine,!go1.21
 
 package strs
 
diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go
new file mode 100644
index 000000000..60166f2ba
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go
@@ -0,0 +1,74 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:build !purego && !appengine && go1.21
+// +build !purego,!appengine,go1.21
+
+package strs
+
+import (
+	"unsafe"
+
+	"google.golang.org/protobuf/reflect/protoreflect"
+)
+
+// UnsafeString returns an unsafe string reference of b.
+// The caller must treat the input slice as immutable.
+//
+// WARNING: Use carefully. The returned result must not leak to the end user
+// unless the input slice is provably immutable.
+func UnsafeString(b []byte) string {
+	return unsafe.String(unsafe.SliceData(b), len(b))
+}
+
+// UnsafeBytes returns an unsafe bytes slice reference of s.
+// The caller must treat returned slice as immutable.
+//
+// WARNING: Use carefully. The returned result must not leak to the end user.
+func UnsafeBytes(s string) []byte {
+	return unsafe.Slice(unsafe.StringData(s), len(s))
+}
+
+// Builder builds a set of strings with shared lifetime.
+// This differs from strings.Builder, which is for building a single string.
+type Builder struct {
+	buf []byte
+}
+
+// AppendFullName is equivalent to protoreflect.FullName.Append,
+// but optimized for large batches where each name has a shared lifetime.
+func (sb *Builder) AppendFullName(prefix protoreflect.FullName, name protoreflect.Name) protoreflect.FullName {
+	n := len(prefix) + len(".") + len(name)
+	if len(prefix) == 0 {
+		n -= len(".")
+	}
+	sb.grow(n)
+	sb.buf = append(sb.buf, prefix...)
+	sb.buf = append(sb.buf, '.')
+	sb.buf = append(sb.buf, name...)
+	return protoreflect.FullName(sb.last(n))
+}
+
+// MakeString is equivalent to string(b), but optimized for large batches
+// with a shared lifetime.
+func (sb *Builder) MakeString(b []byte) string {
+	sb.grow(len(b))
+	sb.buf = append(sb.buf, b...)
+	return sb.last(len(b))
+}
+
+func (sb *Builder) grow(n int) {
+	if cap(sb.buf)-len(sb.buf) >= n {
+		return
+	}
+
+	// Unlike strings.Builder, we do not need to copy over the contents
+	// of the old buffer since our builder provides no API for
+	// retrieving previously created strings.
+	sb.buf = make([]byte, 0, 2*(cap(sb.buf)+n))
+}
+
+func (sb *Builder) last(n int) string {
+	return UnsafeString(sb.buf[len(sb.buf)-n:])
+}
diff --git a/vendor/google.golang.org/protobuf/internal/version/version.go b/vendor/google.golang.org/protobuf/internal/version/version.go
index 0999f29d5..a50fcfb49 100644
--- a/vendor/google.golang.org/protobuf/internal/version/version.go
+++ b/vendor/google.golang.org/protobuf/internal/version/version.go
@@ -51,7 +51,7 @@ import (
 //  10. Send out the CL for review and submit it.
 const (
 	Major      = 1
-	Minor      = 31
+	Minor      = 33
 	Patch      = 0
 	PreRelease = ""
 )
diff --git a/vendor/google.golang.org/protobuf/proto/decode.go b/vendor/google.golang.org/protobuf/proto/decode.go
index 48d47946b..e5b03b567 100644
--- a/vendor/google.golang.org/protobuf/proto/decode.go
+++ b/vendor/google.golang.org/protobuf/proto/decode.go
@@ -69,7 +69,7 @@ func (o UnmarshalOptions) Unmarshal(b []byte, m Message) error {
 // UnmarshalState parses a wire-format message and places the result in m.
 //
 // This method permits fine-grained control over the unmarshaler.
-// Most users should use Unmarshal instead.
+// Most users should use [Unmarshal] instead.
 func (o UnmarshalOptions) UnmarshalState(in protoiface.UnmarshalInput) (protoiface.UnmarshalOutput, error) {
 	if o.RecursionLimit == 0 {
 		o.RecursionLimit = protowire.DefaultRecursionLimit
diff --git a/vendor/google.golang.org/protobuf/proto/doc.go b/vendor/google.golang.org/protobuf/proto/doc.go
index ec71e717f..80ed16a0c 100644
--- a/vendor/google.golang.org/protobuf/proto/doc.go
+++ b/vendor/google.golang.org/protobuf/proto/doc.go
@@ -18,27 +18,27 @@
 // This package contains functions to convert to and from the wire format,
 // an efficient binary serialization of protocol buffers.
 //
-// • Size reports the size of a message in the wire format.
+//   - [Size] reports the size of a message in the wire format.
 //
-// • Marshal converts a message to the wire format.
-// The MarshalOptions type provides more control over wire marshaling.
+//   - [Marshal] converts a message to the wire format.
+//     The [MarshalOptions] type provides more control over wire marshaling.
 //
-// • Unmarshal converts a message from the wire format.
-// The UnmarshalOptions type provides more control over wire unmarshaling.
+//   - [Unmarshal] converts a message from the wire format.
+//     The [UnmarshalOptions] type provides more control over wire unmarshaling.
 //
 // # Basic message operations
 //
-// • Clone makes a deep copy of a message.
+//   - [Clone] makes a deep copy of a message.
 //
-// • Merge merges the content of a message into another.
+//   - [Merge] merges the content of a message into another.
 //
-// • Equal compares two messages. For more control over comparisons
-// and detailed reporting of differences, see package
-// "google.golang.org/protobuf/testing/protocmp".
+//   - [Equal] compares two messages. For more control over comparisons
+//     and detailed reporting of differences, see package
+//     [google.golang.org/protobuf/testing/protocmp].
 //
-// • Reset clears the content of a message.
+//   - [Reset] clears the content of a message.
 //
-// • CheckInitialized reports whether all required fields in a message are set.
+//   - [CheckInitialized] reports whether all required fields in a message are set.
 //
 // # Optional scalar constructors
 //
@@ -46,9 +46,9 @@
 // as pointers to a value. For example, an optional string field has the
 // Go type *string.
 //
-// • Bool, Int32, Int64, Uint32, Uint64, Float32, Float64, and String
-// take a value and return a pointer to a new instance of it,
-// to simplify construction of optional field values.
+//   - [Bool], [Int32], [Int64], [Uint32], [Uint64], [Float32], [Float64], and [String]
+//     take a value and return a pointer to a new instance of it,
+//     to simplify construction of optional field values.
 //
 // Generated enum types usually have an Enum method which performs the
 // same operation.
@@ -57,29 +57,29 @@
 //
 // # Extension accessors
 //
-// • HasExtension, GetExtension, SetExtension, and ClearExtension
-// access extension field values in a protocol buffer message.
+//   - [HasExtension], [GetExtension], [SetExtension], and [ClearExtension]
+//     access extension field values in a protocol buffer message.
 //
 // Extension fields are only supported in proto2.
 //
 // # Related packages
 //
-// • Package "google.golang.org/protobuf/encoding/protojson" converts messages to
-// and from JSON.
+//   - Package [google.golang.org/protobuf/encoding/protojson] converts messages to
+//     and from JSON.
 //
-// • Package "google.golang.org/protobuf/encoding/prototext" converts messages to
-// and from the text format.
+//   - Package [google.golang.org/protobuf/encoding/prototext] converts messages to
+//     and from the text format.
 //
-// • Package "google.golang.org/protobuf/reflect/protoreflect" provides a
-// reflection interface for protocol buffer data types.
+//   - Package [google.golang.org/protobuf/reflect/protoreflect] provides a
+//     reflection interface for protocol buffer data types.
 //
-// • Package "google.golang.org/protobuf/testing/protocmp" provides features
-// to compare protocol buffer messages with the "github.com/google/go-cmp/cmp"
-// package.
+//   - Package [google.golang.org/protobuf/testing/protocmp] provides features
+//     to compare protocol buffer messages with the [github.com/google/go-cmp/cmp]
+//     package.
 //
-// • Package "google.golang.org/protobuf/types/dynamicpb" provides a dynamic
-// message type, suitable for working with messages where the protocol buffer
-// type is only known at runtime.
+//   - Package [google.golang.org/protobuf/types/dynamicpb] provides a dynamic
+//     message type, suitable for working with messages where the protocol buffer
+//     type is only known at runtime.
 //
 // This module contains additional packages for more specialized use cases.
 // Consult the individual package documentation for details.
diff --git a/vendor/google.golang.org/protobuf/proto/encode.go b/vendor/google.golang.org/protobuf/proto/encode.go
index bf7f816d0..4fed202f9 100644
--- a/vendor/google.golang.org/protobuf/proto/encode.go
+++ b/vendor/google.golang.org/protobuf/proto/encode.go
@@ -129,7 +129,7 @@ func (o MarshalOptions) MarshalAppend(b []byte, m Message) ([]byte, error) {
 // MarshalState returns the wire-format encoding of a message.
 //
 // This method permits fine-grained control over the marshaler.
-// Most users should use Marshal instead.
+// Most users should use [Marshal] instead.
 func (o MarshalOptions) MarshalState(in protoiface.MarshalInput) (protoiface.MarshalOutput, error) {
 	return o.marshal(in.Buf, in.Message)
 }
diff --git a/vendor/google.golang.org/protobuf/proto/extension.go b/vendor/google.golang.org/protobuf/proto/extension.go
index 5f293cda8..17899a3a7 100644
--- a/vendor/google.golang.org/protobuf/proto/extension.go
+++ b/vendor/google.golang.org/protobuf/proto/extension.go
@@ -26,7 +26,7 @@ func HasExtension(m Message, xt protoreflect.ExtensionType) bool {
 }
 
 // ClearExtension clears an extension field such that subsequent
-// HasExtension calls return false.
+// [HasExtension] calls return false.
 // It panics if m is invalid or if xt does not extend m.
 func ClearExtension(m Message, xt protoreflect.ExtensionType) {
 	m.ProtoReflect().Clear(xt.TypeDescriptor())
diff --git a/vendor/google.golang.org/protobuf/proto/merge.go b/vendor/google.golang.org/protobuf/proto/merge.go
index d761ab331..3c6fe5780 100644
--- a/vendor/google.golang.org/protobuf/proto/merge.go
+++ b/vendor/google.golang.org/protobuf/proto/merge.go
@@ -21,7 +21,7 @@ import (
 // The unknown fields of src are appended to the unknown fields of dst.
 //
 // It is semantically equivalent to unmarshaling the encoded form of src
-// into dst with the UnmarshalOptions.Merge option specified.
+// into dst with the [UnmarshalOptions.Merge] option specified.
 func Merge(dst, src Message) {
 	// TODO: Should nil src be treated as semantically equivalent to a
 	// untyped, read-only, empty message? What about a nil dst?
diff --git a/vendor/google.golang.org/protobuf/proto/proto.go b/vendor/google.golang.org/protobuf/proto/proto.go
index 1f0d183b1..7543ee6b2 100644
--- a/vendor/google.golang.org/protobuf/proto/proto.go
+++ b/vendor/google.golang.org/protobuf/proto/proto.go
@@ -15,18 +15,20 @@ import (
 // protobuf module that accept a Message, except where otherwise specified.
 //
 // This is the v2 interface definition for protobuf messages.
-// The v1 interface definition is "github.com/golang/protobuf/proto".Message.
+// The v1 interface definition is [github.com/golang/protobuf/proto.Message].
 //
-// To convert a v1 message to a v2 message,
-// use "github.com/golang/protobuf/proto".MessageV2.
-// To convert a v2 message to a v1 message,
-// use "github.com/golang/protobuf/proto".MessageV1.
+//   - To convert a v1 message to a v2 message,
+//     use [google.golang.org/protobuf/protoadapt.MessageV2Of].
+//   - To convert a v2 message to a v1 message,
+//     use [google.golang.org/protobuf/protoadapt.MessageV1Of].
 type Message = protoreflect.ProtoMessage
 
-// Error matches all errors produced by packages in the protobuf module.
+// Error matches all errors produced by packages in the protobuf module
+// according to [errors.Is].
 //
-// That is, errors.Is(err, Error) reports whether an error is produced
-// by this module.
+// Example usage:
+//
+//	if errors.Is(err, proto.Error) { ... }
 var Error error
 
 func init() {
diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go
index e4dfb1205..baa0cc621 100644
--- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go
+++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go
@@ -3,11 +3,11 @@
 // license that can be found in the LICENSE file.
 
 // Package protodesc provides functionality for converting
-// FileDescriptorProto messages to/from protoreflect.FileDescriptor values.
+// FileDescriptorProto messages to/from [protoreflect.FileDescriptor] values.
 //
 // The google.protobuf.FileDescriptorProto is a protobuf message that describes
 // the type information for a .proto file in a form that is easily serializable.
-// The protoreflect.FileDescriptor is a more structured representation of
+// The [protoreflect.FileDescriptor] is a more structured representation of
 // the FileDescriptorProto message where references and remote dependencies
 // can be directly followed.
 package protodesc
@@ -24,11 +24,11 @@ import (
 	"google.golang.org/protobuf/types/descriptorpb"
 )
 
-// Resolver is the resolver used by NewFile to resolve dependencies.
+// Resolver is the resolver used by [NewFile] to resolve dependencies.
 // The enums and messages provided must belong to some parent file,
 // which is also registered.
 //
-// It is implemented by protoregistry.Files.
+// It is implemented by [protoregistry.Files].
 type Resolver interface {
 	FindFileByPath(string) (protoreflect.FileDescriptor, error)
 	FindDescriptorByName(protoreflect.FullName) (protoreflect.Descriptor, error)
@@ -61,19 +61,19 @@ type FileOptions struct {
 	AllowUnresolvable bool
 }
 
-// NewFile creates a new protoreflect.FileDescriptor from the provided
-// file descriptor message. See FileOptions.New for more information.
+// NewFile creates a new [protoreflect.FileDescriptor] from the provided
+// file descriptor message. See [FileOptions.New] for more information.
 func NewFile(fd *descriptorpb.FileDescriptorProto, r Resolver) (protoreflect.FileDescriptor, error) {
 	return FileOptions{}.New(fd, r)
 }
 
-// NewFiles creates a new protoregistry.Files from the provided
-// FileDescriptorSet message. See FileOptions.NewFiles for more information.
+// NewFiles creates a new [protoregistry.Files] from the provided
+// FileDescriptorSet message. See [FileOptions.NewFiles] for more information.
 func NewFiles(fd *descriptorpb.FileDescriptorSet) (*protoregistry.Files, error) {
 	return FileOptions{}.NewFiles(fd)
 }
 
-// New creates a new protoreflect.FileDescriptor from the provided
+// New creates a new [protoreflect.FileDescriptor] from the provided
 // file descriptor message. The file must represent a valid proto file according
 // to protobuf semantics. The returned descriptor is a deep copy of the input.
 //
@@ -93,9 +93,15 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot
 		f.L1.Syntax = protoreflect.Proto2
 	case "proto3":
 		f.L1.Syntax = protoreflect.Proto3
+	case "editions":
+		f.L1.Syntax = protoreflect.Editions
+		f.L1.Edition = fromEditionProto(fd.GetEdition())
 	default:
 		return nil, errors.New("invalid syntax: %q", fd.GetSyntax())
 	}
+	if f.L1.Syntax == protoreflect.Editions && (fd.GetEdition() < SupportedEditionsMinimum || fd.GetEdition() > SupportedEditionsMaximum) {
+		return nil, errors.New("use of edition %v not yet supported by the Go Protobuf runtime", fd.GetEdition())
+	}
 	f.L1.Path = fd.GetName()
 	if f.L1.Path == "" {
 		return nil, errors.New("file path must be populated")
@@ -108,6 +114,9 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot
 		opts = proto.Clone(opts).(*descriptorpb.FileOptions)
 		f.L2.Options = func() protoreflect.ProtoMessage { return opts }
 	}
+	if f.L1.Syntax == protoreflect.Editions {
+		initFileDescFromFeatureSet(f, fd.GetOptions().GetFeatures())
+	}
 
 	f.L2.Imports = make(filedesc.FileImports, len(fd.GetDependency()))
 	for _, i := range fd.GetPublicDependency() {
@@ -231,7 +240,7 @@ func (is importSet) importPublic(imps protoreflect.FileImports) {
 	}
 }
 
-// NewFiles creates a new protoregistry.Files from the provided
+// NewFiles creates a new [protoregistry.Files] from the provided
 // FileDescriptorSet message. The descriptor set must include only
 // valid files according to protobuf semantics. The returned descriptors
 // are a deep copy of the input.
diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go
index 37efda1af..b3278163c 100644
--- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go
+++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go
@@ -28,6 +28,7 @@ func (r descsByName) initEnumDeclarations(eds []*descriptorpb.EnumDescriptorProt
 			opts = proto.Clone(opts).(*descriptorpb.EnumOptions)
 			e.L2.Options = func() protoreflect.ProtoMessage { return opts }
 		}
+		e.L1.EditionFeatures = mergeEditionFeatures(parent, ed.GetOptions().GetFeatures())
 		for _, s := range ed.GetReservedName() {
 			e.L2.ReservedNames.List = append(e.L2.ReservedNames.List, protoreflect.Name(s))
 		}
@@ -68,6 +69,9 @@ func (r descsByName) initMessagesDeclarations(mds []*descriptorpb.DescriptorProt
 		if m.L0, err = r.makeBase(m, parent, md.GetName(), i, sb); err != nil {
 			return nil, err
 		}
+		if m.Base.L0.ParentFile.Syntax() == protoreflect.Editions {
+			m.L1.EditionFeatures = mergeEditionFeatures(parent, md.GetOptions().GetFeatures())
+		}
 		if opts := md.GetOptions(); opts != nil {
 			opts = proto.Clone(opts).(*descriptorpb.MessageOptions)
 			m.L2.Options = func() protoreflect.ProtoMessage { return opts }
@@ -114,6 +118,27 @@ func (r descsByName) initMessagesDeclarations(mds []*descriptorpb.DescriptorProt
 	return ms, nil
 }
 
+// canBePacked returns whether the field can use packed encoding:
+// https://protobuf.dev/programming-guides/encoding/#packed
+func canBePacked(fd *descriptorpb.FieldDescriptorProto) bool {
+	if fd.GetLabel() != descriptorpb.FieldDescriptorProto_LABEL_REPEATED {
+		return false // not a repeated field
+	}
+
+	switch protoreflect.Kind(fd.GetType()) {
+	case protoreflect.MessageKind, protoreflect.GroupKind:
+		return false // not a scalar type field
+
+	case protoreflect.StringKind, protoreflect.BytesKind:
+		// string and bytes can explicitly not be declared as packed,
+		// see https://protobuf.dev/programming-guides/encoding/#packed
+		return false
+
+	default:
+		return true
+	}
+}
+
 func (r descsByName) initFieldsFromDescriptorProto(fds []*descriptorpb.FieldDescriptorProto, parent protoreflect.Descriptor, sb *strs.Builder) (fs []filedesc.Field, err error) {
 	fs = make([]filedesc.Field, len(fds)) // allocate up-front to ensure stable pointers
 	for i, fd := range fds {
@@ -137,6 +162,34 @@ func (r descsByName) initFieldsFromDescriptorProto(fds []*descriptorpb.FieldDesc
 		if fd.JsonName != nil {
 			f.L1.StringName.InitJSON(fd.GetJsonName())
 		}
+
+		if f.Base.L0.ParentFile.Syntax() == protoreflect.Editions {
+			f.L1.EditionFeatures = mergeEditionFeatures(parent, fd.GetOptions().GetFeatures())
+
+			if f.L1.EditionFeatures.IsLegacyRequired {
+				f.L1.Cardinality = protoreflect.Required
+			}
+			// We reuse the existing field because the old option `[packed =
+			// true]` is mutually exclusive with the editions feature.
+			if canBePacked(fd) {
+				f.L1.HasPacked = true
+				f.L1.IsPacked = f.L1.EditionFeatures.IsPacked
+			}
+
+			// We pretend this option is always explicitly set because the only
+			// use of HasEnforceUTF8 is to determine whether to use EnforceUTF8
+			// or to return the appropriate default.
+			// When using editions we either parse the option or resolve the
+			// appropriate default here (instead of later when this option is
+			// requested from the descriptor).
+			// In proto2/proto3 syntax HasEnforceUTF8 might be false.
+			f.L1.HasEnforceUTF8 = true
+			f.L1.EnforceUTF8 = f.L1.EditionFeatures.IsUTF8Validated
+
+			if f.L1.Kind == protoreflect.MessageKind && f.L1.EditionFeatures.IsDelimitedEncoded {
+				f.L1.Kind = protoreflect.GroupKind
+			}
+		}
 	}
 	return fs, nil
 }
@@ -151,6 +204,9 @@ func (r descsByName) initOneofsFromDescriptorProto(ods []*descriptorpb.OneofDesc
 		if opts := od.GetOptions(); opts != nil {
 			opts = proto.Clone(opts).(*descriptorpb.OneofOptions)
 			o.L1.Options = func() protoreflect.ProtoMessage { return opts }
+			if parent.Syntax() == protoreflect.Editions {
+				o.L1.EditionFeatures = mergeEditionFeatures(parent, opts.GetFeatures())
+			}
 		}
 	}
 	return os, nil
diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go
index 27d7e3501..254ca5854 100644
--- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go
+++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go
@@ -276,8 +276,8 @@ func unmarshalDefault(s string, fd protoreflect.FieldDescriptor, allowUnresolvab
 	} else if err != nil {
 		return v, ev, err
 	}
-	if fd.Syntax() == protoreflect.Proto3 {
-		return v, ev, errors.New("cannot be specified under proto3 semantics")
+	if !fd.HasPresence() {
+		return v, ev, errors.New("cannot be specified with implicit field presence")
 	}
 	if fd.Kind() == protoreflect.MessageKind || fd.Kind() == protoreflect.GroupKind || fd.Cardinality() == protoreflect.Repeated {
 		return v, ev, errors.New("cannot be specified on composite types")
diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go
index 9af1d5648..e4dcaf876 100644
--- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go
+++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go
@@ -107,7 +107,7 @@ func validateMessageDeclarations(ms []filedesc.Message, mds []*descriptorpb.Desc
 		if isMessageSet && !flags.ProtoLegacy {
 			return errors.New("message %q is a MessageSet, which is a legacy proto1 feature that is no longer supported", m.FullName())
 		}
-		if isMessageSet && (m.Syntax() != protoreflect.Proto2 || m.Fields().Len() > 0 || m.ExtensionRanges().Len() == 0) {
+		if isMessageSet && (m.Syntax() == protoreflect.Proto3 || m.Fields().Len() > 0 || m.ExtensionRanges().Len() == 0) {
 			return errors.New("message %q is an invalid proto1 MessageSet", m.FullName())
 		}
 		if m.Syntax() == protoreflect.Proto3 {
@@ -314,8 +314,8 @@ func checkValidGroup(fd protoreflect.FieldDescriptor) error {
 	switch {
 	case fd.Kind() != protoreflect.GroupKind:
 		return nil
-	case fd.Syntax() != protoreflect.Proto2:
-		return errors.New("invalid under proto2 semantics")
+	case fd.Syntax() == protoreflect.Proto3:
+		return errors.New("invalid under proto3 semantics")
 	case md == nil || md.IsPlaceholder():
 		return errors.New("message must be resolvable")
 	case fd.FullName().Parent() != md.FullName().Parent():
diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go b/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go
new file mode 100644
index 000000000..2a6b29d17
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go
@@ -0,0 +1,148 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package protodesc
+
+import (
+	"fmt"
+	"os"
+	"sync"
+
+	"google.golang.org/protobuf/internal/editiondefaults"
+	"google.golang.org/protobuf/internal/filedesc"
+	"google.golang.org/protobuf/proto"
+	"google.golang.org/protobuf/reflect/protoreflect"
+	"google.golang.org/protobuf/types/descriptorpb"
+	gofeaturespb "google.golang.org/protobuf/types/gofeaturespb"
+)
+
+const (
+	SupportedEditionsMinimum = descriptorpb.Edition_EDITION_PROTO2
+	SupportedEditionsMaximum = descriptorpb.Edition_EDITION_2023
+)
+
+var defaults = &descriptorpb.FeatureSetDefaults{}
+var defaultsCacheMu sync.Mutex
+var defaultsCache = make(map[filedesc.Edition]*descriptorpb.FeatureSet)
+
+func init() {
+	err := proto.Unmarshal(editiondefaults.Defaults, defaults)
+	if err != nil {
+		fmt.Fprintf(os.Stderr, "unmarshal editions defaults: %v\n", err)
+		os.Exit(1)
+	}
+}
+
+func fromEditionProto(epb descriptorpb.Edition) filedesc.Edition {
+	return filedesc.Edition(epb)
+}
+
+func toEditionProto(ed filedesc.Edition) descriptorpb.Edition {
+	switch ed {
+	case filedesc.EditionUnknown:
+		return descriptorpb.Edition_EDITION_UNKNOWN
+	case filedesc.EditionProto2:
+		return descriptorpb.Edition_EDITION_PROTO2
+	case filedesc.EditionProto3:
+		return descriptorpb.Edition_EDITION_PROTO3
+	case filedesc.Edition2023:
+		return descriptorpb.Edition_EDITION_2023
+	default:
+		panic(fmt.Sprintf("unknown value for edition: %v", ed))
+	}
+}
+
+func getFeatureSetFor(ed filedesc.Edition) *descriptorpb.FeatureSet {
+	defaultsCacheMu.Lock()
+	defer defaultsCacheMu.Unlock()
+	if def, ok := defaultsCache[ed]; ok {
+		return def
+	}
+	edpb := toEditionProto(ed)
+	if defaults.GetMinimumEdition() > edpb || defaults.GetMaximumEdition() < edpb {
+		// This should never happen protodesc.(FileOptions).New would fail when
+		// initializing the file descriptor.
+		// This most likely means the embedded defaults were not updated.
+		fmt.Fprintf(os.Stderr, "internal error: unsupported edition %v (did you forget to update the embedded defaults (i.e. the bootstrap descriptor proto)?)\n", edpb)
+		os.Exit(1)
+	}
+	fs := defaults.GetDefaults()[0].GetFeatures()
+	// Using a linear search for now.
+	// Editions are guaranteed to be sorted and thus we could use a binary search.
+	// Given that there are only a handful of editions (with one more per year)
+	// there is not much reason to use a binary search.
+	for _, def := range defaults.GetDefaults() {
+		if def.GetEdition() <= edpb {
+			fs = def.GetFeatures()
+		} else {
+			break
+		}
+	}
+	defaultsCache[ed] = fs
+	return fs
+}
+
+// mergeEditionFeatures merges the parent and child feature sets. This function
+// should be used when initializing Go descriptors from descriptor protos which
+// is why the parent is a filedesc.EditionsFeatures (Go representation) while
+// the child is a descriptorproto.FeatureSet (protoc representation).
+// Any feature set by the child overwrites what is set by the parent.
+func mergeEditionFeatures(parentDesc protoreflect.Descriptor, child *descriptorpb.FeatureSet) filedesc.EditionFeatures {
+	var parentFS filedesc.EditionFeatures
+	switch p := parentDesc.(type) {
+	case *filedesc.File:
+		parentFS = p.L1.EditionFeatures
+	case *filedesc.Message:
+		parentFS = p.L1.EditionFeatures
+	default:
+		panic(fmt.Sprintf("unknown parent type %T", parentDesc))
+	}
+	if child == nil {
+		return parentFS
+	}
+	if fp := child.FieldPresence; fp != nil {
+		parentFS.IsFieldPresence = *fp == descriptorpb.FeatureSet_LEGACY_REQUIRED ||
+			*fp == descriptorpb.FeatureSet_EXPLICIT
+		parentFS.IsLegacyRequired = *fp == descriptorpb.FeatureSet_LEGACY_REQUIRED
+	}
+	if et := child.EnumType; et != nil {
+		parentFS.IsOpenEnum = *et == descriptorpb.FeatureSet_OPEN
+	}
+
+	if rfe := child.RepeatedFieldEncoding; rfe != nil {
+		parentFS.IsPacked = *rfe == descriptorpb.FeatureSet_PACKED
+	}
+
+	if utf8val := child.Utf8Validation; utf8val != nil {
+		parentFS.IsUTF8Validated = *utf8val == descriptorpb.FeatureSet_VERIFY
+	}
+
+	if me := child.MessageEncoding; me != nil {
+		parentFS.IsDelimitedEncoded = *me == descriptorpb.FeatureSet_DELIMITED
+	}
+
+	if jf := child.JsonFormat; jf != nil {
+		parentFS.IsJSONCompliant = *jf == descriptorpb.FeatureSet_ALLOW
+	}
+
+	if goFeatures, ok := proto.GetExtension(child, gofeaturespb.E_Go).(*gofeaturespb.GoFeatures); ok && goFeatures != nil {
+		if luje := goFeatures.LegacyUnmarshalJsonEnum; luje != nil {
+			parentFS.GenerateLegacyUnmarshalJSON = *luje
+		}
+	}
+
+	return parentFS
+}
+
+// initFileDescFromFeatureSet initializes editions related fields in fd based
+// on fs. If fs is nil it is assumed to be an empty featureset and all fields
+// will be initialized with the appropriate default. fd.L1.Edition must be set
+// before calling this function.
+func initFileDescFromFeatureSet(fd *filedesc.File, fs *descriptorpb.FeatureSet) {
+	dfs := getFeatureSetFor(fd.L1.Edition)
+	// initialize the featureset with the defaults
+	fd.L1.EditionFeatures = mergeEditionFeatures(fd, dfs)
+	// overwrite any options explicitly specified
+	fd.L1.EditionFeatures = mergeEditionFeatures(fd, fs)
+}
diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go
index a7c5ceffc..9d6e05420 100644
--- a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go
+++ b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go
@@ -16,7 +16,7 @@ import (
 	"google.golang.org/protobuf/types/descriptorpb"
 )
 
-// ToFileDescriptorProto copies a protoreflect.FileDescriptor into a
+// ToFileDescriptorProto copies a [protoreflect.FileDescriptor] into a
 // google.protobuf.FileDescriptorProto message.
 func ToFileDescriptorProto(file protoreflect.FileDescriptor) *descriptorpb.FileDescriptorProto {
 	p := &descriptorpb.FileDescriptorProto{
@@ -70,13 +70,13 @@ func ToFileDescriptorProto(file protoreflect.FileDescriptor) *descriptorpb.FileD
 	for i, exts := 0, file.Extensions(); i < exts.Len(); i++ {
 		p.Extension = append(p.Extension, ToFieldDescriptorProto(exts.Get(i)))
 	}
-	if syntax := file.Syntax(); syntax != protoreflect.Proto2 {
+	if syntax := file.Syntax(); syntax != protoreflect.Proto2 && syntax.IsValid() {
 		p.Syntax = proto.String(file.Syntax().String())
 	}
 	return p
 }
 
-// ToDescriptorProto copies a protoreflect.MessageDescriptor into a
+// ToDescriptorProto copies a [protoreflect.MessageDescriptor] into a
 // google.protobuf.DescriptorProto message.
 func ToDescriptorProto(message protoreflect.MessageDescriptor) *descriptorpb.DescriptorProto {
 	p := &descriptorpb.DescriptorProto{
@@ -119,7 +119,7 @@ func ToDescriptorProto(message protoreflect.MessageDescriptor) *descriptorpb.Des
 	return p
 }
 
-// ToFieldDescriptorProto copies a protoreflect.FieldDescriptor into a
+// ToFieldDescriptorProto copies a [protoreflect.FieldDescriptor] into a
 // google.protobuf.FieldDescriptorProto message.
 func ToFieldDescriptorProto(field protoreflect.FieldDescriptor) *descriptorpb.FieldDescriptorProto {
 	p := &descriptorpb.FieldDescriptorProto{
@@ -168,7 +168,7 @@ func ToFieldDescriptorProto(field protoreflect.FieldDescriptor) *descriptorpb.Fi
 	return p
 }
 
-// ToOneofDescriptorProto copies a protoreflect.OneofDescriptor into a
+// ToOneofDescriptorProto copies a [protoreflect.OneofDescriptor] into a
 // google.protobuf.OneofDescriptorProto message.
 func ToOneofDescriptorProto(oneof protoreflect.OneofDescriptor) *descriptorpb.OneofDescriptorProto {
 	return &descriptorpb.OneofDescriptorProto{
@@ -177,7 +177,7 @@ func ToOneofDescriptorProto(oneof protoreflect.OneofDescriptor) *descriptorpb.On
 	}
 }
 
-// ToEnumDescriptorProto copies a protoreflect.EnumDescriptor into a
+// ToEnumDescriptorProto copies a [protoreflect.EnumDescriptor] into a
 // google.protobuf.EnumDescriptorProto message.
 func ToEnumDescriptorProto(enum protoreflect.EnumDescriptor) *descriptorpb.EnumDescriptorProto {
 	p := &descriptorpb.EnumDescriptorProto{
@@ -200,7 +200,7 @@ func ToEnumDescriptorProto(enum protoreflect.EnumDescriptor) *descriptorpb.EnumD
 	return p
 }
 
-// ToEnumValueDescriptorProto copies a protoreflect.EnumValueDescriptor into a
+// ToEnumValueDescriptorProto copies a [protoreflect.EnumValueDescriptor] into a
 // google.protobuf.EnumValueDescriptorProto message.
 func ToEnumValueDescriptorProto(value protoreflect.EnumValueDescriptor) *descriptorpb.EnumValueDescriptorProto {
 	return &descriptorpb.EnumValueDescriptorProto{
@@ -210,7 +210,7 @@ func ToEnumValueDescriptorProto(value protoreflect.EnumValueDescriptor) *descrip
 	}
 }
 
-// ToServiceDescriptorProto copies a protoreflect.ServiceDescriptor into a
+// ToServiceDescriptorProto copies a [protoreflect.ServiceDescriptor] into a
 // google.protobuf.ServiceDescriptorProto message.
 func ToServiceDescriptorProto(service protoreflect.ServiceDescriptor) *descriptorpb.ServiceDescriptorProto {
 	p := &descriptorpb.ServiceDescriptorProto{
@@ -223,7 +223,7 @@ func ToServiceDescriptorProto(service protoreflect.ServiceDescriptor) *descripto
 	return p
 }
 
-// ToMethodDescriptorProto copies a protoreflect.MethodDescriptor into a
+// ToMethodDescriptorProto copies a [protoreflect.MethodDescriptor] into a
 // google.protobuf.MethodDescriptorProto message.
 func ToMethodDescriptorProto(method protoreflect.MethodDescriptor) *descriptorpb.MethodDescriptorProto {
 	p := &descriptorpb.MethodDescriptorProto{
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go
index 55aa14922..00b01fbd8 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go
@@ -10,46 +10,46 @@
 //
 // # Protocol Buffer Descriptors
 //
-// Protobuf descriptors (e.g., EnumDescriptor or MessageDescriptor)
+// Protobuf descriptors (e.g., [EnumDescriptor] or [MessageDescriptor])
 // are immutable objects that represent protobuf type information.
 // They are wrappers around the messages declared in descriptor.proto.
 // Protobuf descriptors alone lack any information regarding Go types.
 //
-// Enums and messages generated by this module implement Enum and ProtoMessage,
+// Enums and messages generated by this module implement [Enum] and [ProtoMessage],
 // where the Descriptor and ProtoReflect.Descriptor accessors respectively
 // return the protobuf descriptor for the values.
 //
 // The protobuf descriptor interfaces are not meant to be implemented by
 // user code since they might need to be extended in the future to support
 // additions to the protobuf language.
-// The "google.golang.org/protobuf/reflect/protodesc" package converts between
+// The [google.golang.org/protobuf/reflect/protodesc] package converts between
 // google.protobuf.DescriptorProto messages and protobuf descriptors.
 //
 // # Go Type Descriptors
 //
-// A type descriptor (e.g., EnumType or MessageType) is a constructor for
+// A type descriptor (e.g., [EnumType] or [MessageType]) is a constructor for
 // a concrete Go type that represents the associated protobuf descriptor.
 // There is commonly a one-to-one relationship between protobuf descriptors and
 // Go type descriptors, but it can potentially be a one-to-many relationship.
 //
-// Enums and messages generated by this module implement Enum and ProtoMessage,
+// Enums and messages generated by this module implement [Enum] and [ProtoMessage],
 // where the Type and ProtoReflect.Type accessors respectively
 // return the protobuf descriptor for the values.
 //
-// The "google.golang.org/protobuf/types/dynamicpb" package can be used to
+// The [google.golang.org/protobuf/types/dynamicpb] package can be used to
 // create Go type descriptors from protobuf descriptors.
 //
 // # Value Interfaces
 //
-// The Enum and Message interfaces provide a reflective view over an
+// The [Enum] and [Message] interfaces provide a reflective view over an
 // enum or message instance. For enums, it provides the ability to retrieve
 // the enum value number for any concrete enum type. For messages, it provides
 // the ability to access or manipulate fields of the message.
 //
-// To convert a proto.Message to a protoreflect.Message, use the
+// To convert a [google.golang.org/protobuf/proto.Message] to a [protoreflect.Message], use the
 // former's ProtoReflect method. Since the ProtoReflect method is new to the
 // v2 message interface, it may not be present on older message implementations.
-// The "github.com/golang/protobuf/proto".MessageReflect function can be used
+// The [github.com/golang/protobuf/proto.MessageReflect] function can be used
 // to obtain a reflective view on older messages.
 //
 // # Relationships
@@ -71,12 +71,12 @@
 //	      │                                 │
 //	      └────────────────── Type() ───────┘
 //
-// • An EnumType describes a concrete Go enum type.
+// • An [EnumType] describes a concrete Go enum type.
 // It has an EnumDescriptor and can construct an Enum instance.
 //
-// • An EnumDescriptor describes an abstract protobuf enum type.
+// • An [EnumDescriptor] describes an abstract protobuf enum type.
 //
-// • An Enum is a concrete enum instance. Generated enums implement Enum.
+// • An [Enum] is a concrete enum instance. Generated enums implement Enum.
 //
 //	  ┌──────────────── New() ─────────────────�
 //	  │                                        │
@@ -90,24 +90,26 @@
 //	       │                                    │
 //	       └─────────────────── Type() ─────────┘
 //
-// • A MessageType describes a concrete Go message type.
-// It has a MessageDescriptor and can construct a Message instance.
-// Just as how Go's reflect.Type is a reflective description of a Go type,
-// a MessageType is a reflective description of a Go type for a protobuf message.
+// • A [MessageType] describes a concrete Go message type.
+// It has a [MessageDescriptor] and can construct a [Message] instance.
+// Just as how Go's [reflect.Type] is a reflective description of a Go type,
+// a [MessageType] is a reflective description of a Go type for a protobuf message.
 //
-// • A MessageDescriptor describes an abstract protobuf message type.
-// It has no understanding of Go types. In order to construct a MessageType
-// from just a MessageDescriptor, you can consider looking up the message type
-// in the global registry using protoregistry.GlobalTypes.FindMessageByName
-// or constructing a dynamic MessageType using dynamicpb.NewMessageType.
+// • A [MessageDescriptor] describes an abstract protobuf message type.
+// It has no understanding of Go types. In order to construct a [MessageType]
+// from just a [MessageDescriptor], you can consider looking up the message type
+// in the global registry using the FindMessageByName method on
+// [google.golang.org/protobuf/reflect/protoregistry.GlobalTypes]
+// or constructing a dynamic [MessageType] using
+// [google.golang.org/protobuf/types/dynamicpb.NewMessageType].
 //
-// • A Message is a reflective view over a concrete message instance.
-// Generated messages implement ProtoMessage, which can convert to a Message.
-// Just as how Go's reflect.Value is a reflective view over a Go value,
-// a Message is a reflective view over a concrete protobuf message instance.
-// Using Go reflection as an analogy, the ProtoReflect method is similar to
-// calling reflect.ValueOf, and the Message.Interface method is similar to
-// calling reflect.Value.Interface.
+// • A [Message] is a reflective view over a concrete message instance.
+// Generated messages implement [ProtoMessage], which can convert to a [Message].
+// Just as how Go's [reflect.Value] is a reflective view over a Go value,
+// a [Message] is a reflective view over a concrete protobuf message instance.
+// Using Go reflection as an analogy, the [ProtoMessage.ProtoReflect] method is similar to
+// calling [reflect.ValueOf], and the [Message.Interface] method is similar to
+// calling [reflect.Value.Interface].
 //
 //	      ┌── TypeDescriptor() ──�    ┌───── Descriptor() ─────�
 //	      │                      V    │                        V
@@ -119,15 +121,15 @@
 //	                                 │                          │
 //	                                 └────── implements ────────┘
 //
-// • An ExtensionType describes a concrete Go implementation of an extension.
-// It has an ExtensionTypeDescriptor and can convert to/from
-// abstract Values and Go values.
+// • An [ExtensionType] describes a concrete Go implementation of an extension.
+// It has an [ExtensionTypeDescriptor] and can convert to/from
+// an abstract [Value] and a Go value.
 //
-// • An ExtensionTypeDescriptor is an ExtensionDescriptor
-// which also has an ExtensionType.
+// • An [ExtensionTypeDescriptor] is an [ExtensionDescriptor]
+// which also has an [ExtensionType].
 //
-// • An ExtensionDescriptor describes an abstract protobuf extension field and
-// may not always be an ExtensionTypeDescriptor.
+// • An [ExtensionDescriptor] describes an abstract protobuf extension field and
+// may not always be an [ExtensionTypeDescriptor].
 package protoreflect
 
 import (
@@ -142,7 +144,7 @@ type doNotImplement pragma.DoNotImplement
 
 // ProtoMessage is the top-level interface that all proto messages implement.
 // This is declared in the protoreflect package to avoid a cyclic dependency;
-// use the proto.Message type instead, which aliases this type.
+// use the [google.golang.org/protobuf/proto.Message] type instead, which aliases this type.
 type ProtoMessage interface{ ProtoReflect() Message }
 
 // Syntax is the language version of the proto file.
@@ -151,8 +153,9 @@ type Syntax syntax
 type syntax int8 // keep exact type opaque as the int type may change
 
 const (
-	Proto2 Syntax = 2
-	Proto3 Syntax = 3
+	Proto2   Syntax = 2
+	Proto3   Syntax = 3
+	Editions Syntax = 4
 )
 
 // IsValid reports whether the syntax is valid.
@@ -172,6 +175,8 @@ func (s Syntax) String() string {
 		return "proto2"
 	case Proto3:
 		return "proto3"
+	case Editions:
+		return "editions"
 	default:
 		return fmt.Sprintf("<unknown:%d>", s)
 	}
@@ -436,7 +441,7 @@ type Names interface {
 // FullName is a qualified name that uniquely identifies a proto declaration.
 // A qualified name is the concatenation of the proto package along with the
 // fully-declared name (i.e., name of parent preceding the name of the child),
-// with a '.' delimiter placed between each Name.
+// with a '.' delimiter placed between each [Name].
 //
 // This should not have any leading or trailing dots.
 type FullName string // e.g., "google.protobuf.Field.Kind"
@@ -480,7 +485,7 @@ func isLetterDigit(c byte) bool {
 }
 
 // Name returns the short name, which is the last identifier segment.
-// A single segment FullName is the Name itself.
+// A single segment FullName is the [Name] itself.
 func (n FullName) Name() Name {
 	if i := strings.LastIndexByte(string(n), '.'); i >= 0 {
 		return Name(n[i+1:])
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go
index 717b106f3..7dcc2ff09 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go
@@ -35,7 +35,7 @@ func (p *SourcePath) appendFileDescriptorProto(b []byte) []byte {
 		b = p.appendSingularField(b, "source_code_info", (*SourcePath).appendSourceCodeInfo)
 	case 12:
 		b = p.appendSingularField(b, "syntax", nil)
-	case 13:
+	case 14:
 		b = p.appendSingularField(b, "edition", nil)
 	}
 	return b
@@ -160,8 +160,6 @@ func (p *SourcePath) appendFileOptions(b []byte) []byte {
 		b = p.appendSingularField(b, "java_generic_services", nil)
 	case 18:
 		b = p.appendSingularField(b, "py_generic_services", nil)
-	case 42:
-		b = p.appendSingularField(b, "php_generic_services", nil)
 	case 23:
 		b = p.appendSingularField(b, "deprecated", nil)
 	case 31:
@@ -180,6 +178,8 @@ func (p *SourcePath) appendFileOptions(b []byte) []byte {
 		b = p.appendSingularField(b, "php_metadata_namespace", nil)
 	case 45:
 		b = p.appendSingularField(b, "ruby_package", nil)
+	case 50:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 999:
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	}
@@ -240,6 +240,8 @@ func (p *SourcePath) appendMessageOptions(b []byte) []byte {
 		b = p.appendSingularField(b, "map_entry", nil)
 	case 11:
 		b = p.appendSingularField(b, "deprecated_legacy_json_field_conflicts", nil)
+	case 12:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 999:
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	}
@@ -285,6 +287,8 @@ func (p *SourcePath) appendEnumOptions(b []byte) []byte {
 		b = p.appendSingularField(b, "deprecated", nil)
 	case 6:
 		b = p.appendSingularField(b, "deprecated_legacy_json_field_conflicts", nil)
+	case 7:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 999:
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	}
@@ -330,6 +334,8 @@ func (p *SourcePath) appendServiceOptions(b []byte) []byte {
 		return b
 	}
 	switch (*p)[0] {
+	case 34:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 33:
 		b = p.appendSingularField(b, "deprecated", nil)
 	case 999:
@@ -361,16 +367,39 @@ func (p *SourcePath) appendFieldOptions(b []byte) []byte {
 		b = p.appendSingularField(b, "debug_redact", nil)
 	case 17:
 		b = p.appendSingularField(b, "retention", nil)
-	case 18:
-		b = p.appendSingularField(b, "target", nil)
 	case 19:
 		b = p.appendRepeatedField(b, "targets", nil)
+	case 20:
+		b = p.appendRepeatedField(b, "edition_defaults", (*SourcePath).appendFieldOptions_EditionDefault)
+	case 21:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 999:
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	}
 	return b
 }
 
+func (p *SourcePath) appendFeatureSet(b []byte) []byte {
+	if len(*p) == 0 {
+		return b
+	}
+	switch (*p)[0] {
+	case 1:
+		b = p.appendSingularField(b, "field_presence", nil)
+	case 2:
+		b = p.appendSingularField(b, "enum_type", nil)
+	case 3:
+		b = p.appendSingularField(b, "repeated_field_encoding", nil)
+	case 4:
+		b = p.appendSingularField(b, "utf8_validation", nil)
+	case 5:
+		b = p.appendSingularField(b, "message_encoding", nil)
+	case 6:
+		b = p.appendSingularField(b, "json_format", nil)
+	}
+	return b
+}
+
 func (p *SourcePath) appendUninterpretedOption(b []byte) []byte {
 	if len(*p) == 0 {
 		return b
@@ -422,6 +451,8 @@ func (p *SourcePath) appendExtensionRangeOptions(b []byte) []byte {
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	case 2:
 		b = p.appendRepeatedField(b, "declaration", (*SourcePath).appendExtensionRangeOptions_Declaration)
+	case 50:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 3:
 		b = p.appendSingularField(b, "verification", nil)
 	}
@@ -433,6 +464,8 @@ func (p *SourcePath) appendOneofOptions(b []byte) []byte {
 		return b
 	}
 	switch (*p)[0] {
+	case 1:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 999:
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	}
@@ -446,6 +479,10 @@ func (p *SourcePath) appendEnumValueOptions(b []byte) []byte {
 	switch (*p)[0] {
 	case 1:
 		b = p.appendSingularField(b, "deprecated", nil)
+	case 2:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
+	case 3:
+		b = p.appendSingularField(b, "debug_redact", nil)
 	case 999:
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	}
@@ -461,12 +498,27 @@ func (p *SourcePath) appendMethodOptions(b []byte) []byte {
 		b = p.appendSingularField(b, "deprecated", nil)
 	case 34:
 		b = p.appendSingularField(b, "idempotency_level", nil)
+	case 35:
+		b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet)
 	case 999:
 		b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption)
 	}
 	return b
 }
 
+func (p *SourcePath) appendFieldOptions_EditionDefault(b []byte) []byte {
+	if len(*p) == 0 {
+		return b
+	}
+	switch (*p)[0] {
+	case 3:
+		b = p.appendSingularField(b, "edition", nil)
+	case 2:
+		b = p.appendSingularField(b, "value", nil)
+	}
+	return b
+}
+
 func (p *SourcePath) appendUninterpretedOption_NamePart(b []byte) []byte {
 	if len(*p) == 0 {
 		return b
@@ -491,8 +543,6 @@ func (p *SourcePath) appendExtensionRangeOptions_Declaration(b []byte) []byte {
 		b = p.appendSingularField(b, "full_name", nil)
 	case 3:
 		b = p.appendSingularField(b, "type", nil)
-	case 4:
-		b = p.appendSingularField(b, "is_repeated", nil)
 	case 5:
 		b = p.appendSingularField(b, "reserved", nil)
 	case 6:
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go
index 3867470d3..60ff62b4c 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go
@@ -12,7 +12,7 @@ package protoreflect
 // exactly identical. However, it is possible for the same semantically
 // identical proto type to be represented by multiple type descriptors.
 //
-// For example, suppose we have t1 and t2 which are both MessageDescriptors.
+// For example, suppose we have t1 and t2 which are both an [MessageDescriptor].
 // If t1 == t2, then the types are definitely equal and all accessors return
 // the same information. However, if t1 != t2, then it is still possible that
 // they still represent the same proto type (e.g., t1.FullName == t2.FullName).
@@ -115,7 +115,7 @@ type Descriptor interface {
 // corresponds with the google.protobuf.FileDescriptorProto message.
 //
 // Top-level declarations:
-// EnumDescriptor, MessageDescriptor, FieldDescriptor, and/or ServiceDescriptor.
+// [EnumDescriptor], [MessageDescriptor], [FieldDescriptor], and/or [ServiceDescriptor].
 type FileDescriptor interface {
 	Descriptor // Descriptor.FullName is identical to Package
 
@@ -180,8 +180,8 @@ type FileImport struct {
 // corresponds with the google.protobuf.DescriptorProto message.
 //
 // Nested declarations:
-// FieldDescriptor, OneofDescriptor, FieldDescriptor, EnumDescriptor,
-// and/or MessageDescriptor.
+// [FieldDescriptor], [OneofDescriptor], [FieldDescriptor], [EnumDescriptor],
+// and/or [MessageDescriptor].
 type MessageDescriptor interface {
 	Descriptor
 
@@ -214,7 +214,7 @@ type MessageDescriptor interface {
 	ExtensionRanges() FieldRanges
 	// ExtensionRangeOptions returns the ith extension range options.
 	//
-	// To avoid a dependency cycle, this method returns a proto.Message value,
+	// To avoid a dependency cycle, this method returns a proto.Message] value,
 	// which always contains a google.protobuf.ExtensionRangeOptions message.
 	// This method returns a typed nil-pointer if no options are present.
 	// The caller must import the descriptorpb package to use this.
@@ -231,9 +231,9 @@ type MessageDescriptor interface {
 }
 type isMessageDescriptor interface{ ProtoType(MessageDescriptor) }
 
-// MessageType encapsulates a MessageDescriptor with a concrete Go implementation.
+// MessageType encapsulates a [MessageDescriptor] with a concrete Go implementation.
 // It is recommended that implementations of this interface also implement the
-// MessageFieldTypes interface.
+// [MessageFieldTypes] interface.
 type MessageType interface {
 	// New returns a newly allocated empty message.
 	// It may return nil for synthetic messages representing a map entry.
@@ -249,19 +249,19 @@ type MessageType interface {
 	Descriptor() MessageDescriptor
 }
 
-// MessageFieldTypes extends a MessageType by providing type information
+// MessageFieldTypes extends a [MessageType] by providing type information
 // regarding enums and messages referenced by the message fields.
 type MessageFieldTypes interface {
 	MessageType
 
-	// Enum returns the EnumType for the ith field in Descriptor.Fields.
+	// Enum returns the EnumType for the ith field in MessageDescriptor.Fields.
 	// It returns nil if the ith field is not an enum kind.
 	// It panics if out of bounds.
 	//
 	// Invariant: mt.Enum(i).Descriptor() == mt.Descriptor().Fields(i).Enum()
 	Enum(i int) EnumType
 
-	// Message returns the MessageType for the ith field in Descriptor.Fields.
+	// Message returns the MessageType for the ith field in MessageDescriptor.Fields.
 	// It returns nil if the ith field is not a message or group kind.
 	// It panics if out of bounds.
 	//
@@ -286,8 +286,8 @@ type MessageDescriptors interface {
 // corresponds with the google.protobuf.FieldDescriptorProto message.
 //
 // It is used for both normal fields defined within the parent message
-// (e.g., MessageDescriptor.Fields) and fields that extend some remote message
-// (e.g., FileDescriptor.Extensions or MessageDescriptor.Extensions).
+// (e.g., [MessageDescriptor.Fields]) and fields that extend some remote message
+// (e.g., [FileDescriptor.Extensions] or [MessageDescriptor.Extensions]).
 type FieldDescriptor interface {
 	Descriptor
 
@@ -344,7 +344,7 @@ type FieldDescriptor interface {
 	// IsMap reports whether this field represents a map,
 	// where the value type for the associated field is a Map.
 	// It is equivalent to checking whether Cardinality is Repeated,
-	// that the Kind is MessageKind, and that Message.IsMapEntry reports true.
+	// that the Kind is MessageKind, and that MessageDescriptor.IsMapEntry reports true.
 	IsMap() bool
 
 	// MapKey returns the field descriptor for the key in the map entry.
@@ -419,7 +419,7 @@ type OneofDescriptor interface {
 
 	// IsSynthetic reports whether this is a synthetic oneof created to support
 	// proto3 optional semantics. If true, Fields contains exactly one field
-	// with HasOptionalKeyword specified.
+	// with FieldDescriptor.HasOptionalKeyword specified.
 	IsSynthetic() bool
 
 	// Fields is a list of fields belonging to this oneof.
@@ -442,10 +442,10 @@ type OneofDescriptors interface {
 	doNotImplement
 }
 
-// ExtensionDescriptor is an alias of FieldDescriptor for documentation.
+// ExtensionDescriptor is an alias of [FieldDescriptor] for documentation.
 type ExtensionDescriptor = FieldDescriptor
 
-// ExtensionTypeDescriptor is an ExtensionDescriptor with an associated ExtensionType.
+// ExtensionTypeDescriptor is an [ExtensionDescriptor] with an associated [ExtensionType].
 type ExtensionTypeDescriptor interface {
 	ExtensionDescriptor
 
@@ -470,12 +470,12 @@ type ExtensionDescriptors interface {
 	doNotImplement
 }
 
-// ExtensionType encapsulates an ExtensionDescriptor with a concrete
+// ExtensionType encapsulates an [ExtensionDescriptor] with a concrete
 // Go implementation. The nested field descriptor must be for a extension field.
 //
 // While a normal field is a member of the parent message that it is declared
-// within (see Descriptor.Parent), an extension field is a member of some other
-// target message (see ExtensionDescriptor.Extendee) and may have no
+// within (see [Descriptor.Parent]), an extension field is a member of some other
+// target message (see [FieldDescriptor.ContainingMessage]) and may have no
 // relationship with the parent. However, the full name of an extension field is
 // relative to the parent that it is declared within.
 //
@@ -532,7 +532,7 @@ type ExtensionType interface {
 // corresponds with the google.protobuf.EnumDescriptorProto message.
 //
 // Nested declarations:
-// EnumValueDescriptor.
+// [EnumValueDescriptor].
 type EnumDescriptor interface {
 	Descriptor
 
@@ -548,7 +548,7 @@ type EnumDescriptor interface {
 }
 type isEnumDescriptor interface{ ProtoType(EnumDescriptor) }
 
-// EnumType encapsulates an EnumDescriptor with a concrete Go implementation.
+// EnumType encapsulates an [EnumDescriptor] with a concrete Go implementation.
 type EnumType interface {
 	// New returns an instance of this enum type with its value set to n.
 	New(n EnumNumber) Enum
@@ -610,7 +610,7 @@ type EnumValueDescriptors interface {
 // ServiceDescriptor describes a service and
 // corresponds with the google.protobuf.ServiceDescriptorProto message.
 //
-// Nested declarations: MethodDescriptor.
+// Nested declarations: [MethodDescriptor].
 type ServiceDescriptor interface {
 	Descriptor
 
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go
index 37601b781..a7b0d06ff 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value.go
@@ -27,16 +27,16 @@ type Enum interface {
 // Message is a reflective interface for a concrete message value,
 // encapsulating both type and value information for the message.
 //
-// Accessor/mutators for individual fields are keyed by FieldDescriptor.
+// Accessor/mutators for individual fields are keyed by [FieldDescriptor].
 // For non-extension fields, the descriptor must exactly match the
 // field known by the parent message.
-// For extension fields, the descriptor must implement ExtensionTypeDescriptor,
-// extend the parent message (i.e., have the same message FullName), and
+// For extension fields, the descriptor must implement [ExtensionTypeDescriptor],
+// extend the parent message (i.e., have the same message [FullName]), and
 // be within the parent's extension range.
 //
-// Each field Value can be a scalar or a composite type (Message, List, or Map).
-// See Value for the Go types associated with a FieldDescriptor.
-// Providing a Value that is invalid or of an incorrect type panics.
+// Each field [Value] can be a scalar or a composite type ([Message], [List], or [Map]).
+// See [Value] for the Go types associated with a [FieldDescriptor].
+// Providing a [Value] that is invalid or of an incorrect type panics.
 type Message interface {
 	// Descriptor returns message descriptor, which contains only the protobuf
 	// type information for the message.
@@ -152,7 +152,7 @@ type Message interface {
 	// This method may return nil.
 	//
 	// The returned methods type is identical to
-	// "google.golang.org/protobuf/runtime/protoiface".Methods.
+	// google.golang.org/protobuf/runtime/protoiface.Methods.
 	// Consult the protoiface package documentation for details.
 	ProtoMethods() *methods
 }
@@ -175,8 +175,8 @@ func (b RawFields) IsValid() bool {
 }
 
 // List is a zero-indexed, ordered list.
-// The element Value type is determined by FieldDescriptor.Kind.
-// Providing a Value that is invalid or of an incorrect type panics.
+// The element [Value] type is determined by [FieldDescriptor.Kind].
+// Providing a [Value] that is invalid or of an incorrect type panics.
 type List interface {
 	// Len reports the number of entries in the List.
 	// Get, Set, and Truncate panic with out of bound indexes.
@@ -226,9 +226,9 @@ type List interface {
 }
 
 // Map is an unordered, associative map.
-// The entry MapKey type is determined by FieldDescriptor.MapKey.Kind.
-// The entry Value type is determined by FieldDescriptor.MapValue.Kind.
-// Providing a MapKey or Value that is invalid or of an incorrect type panics.
+// The entry [MapKey] type is determined by [FieldDescriptor.MapKey].Kind.
+// The entry [Value] type is determined by [FieldDescriptor.MapValue].Kind.
+// Providing a [MapKey] or [Value] that is invalid or of an incorrect type panics.
 type Map interface {
 	// Len reports the number of elements in the map.
 	Len() int
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go
index 591652541..654599d44 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_equal.go
@@ -24,19 +24,19 @@ import (
 //     Unlike the == operator, a NaN is equal to another NaN.
 //
 //   - Enums are equal if they contain the same number.
-//     Since Value does not contain an enum descriptor,
+//     Since [Value] does not contain an enum descriptor,
 //     enum values do not consider the type of the enum.
 //
 //   - Other scalar values are equal if they contain the same value.
 //
-//   - Message values are equal if they belong to the same message descriptor,
+//   - [Message] values are equal if they belong to the same message descriptor,
 //     have the same set of populated known and extension field values,
 //     and the same set of unknown fields values.
 //
-//   - Lists are equal if they are the same length and
+//   - [List] values are equal if they are the same length and
 //     each corresponding element is equal.
 //
-//   - Maps are equal if they have the same set of keys and
+//   - [Map] values are equal if they have the same set of keys and
 //     the corresponding value for each key is equal.
 func (v1 Value) Equal(v2 Value) bool {
 	return equalValue(v1, v2)
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go
index 08e5ef73f..160309731 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go
@@ -11,7 +11,7 @@ import (
 
 // Value is a union where only one Go type may be set at a time.
 // The Value is used to represent all possible values a field may take.
-// The following shows which Go type is used to represent each proto Kind:
+// The following shows which Go type is used to represent each proto [Kind]:
 //
 //	╔������������╤�������������������������������������╗
 //	║ Go type    │ Protobuf kind                       ║
@@ -31,22 +31,22 @@ import (
 //
 // Multiple protobuf Kinds may be represented by a single Go type if the type
 // can losslessly represent the information for the proto kind. For example,
-// Int64Kind, Sint64Kind, and Sfixed64Kind are all represented by int64,
+// [Int64Kind], [Sint64Kind], and [Sfixed64Kind] are all represented by int64,
 // but use different integer encoding methods.
 //
-// The List or Map types are used if the field cardinality is repeated.
-// A field is a List if FieldDescriptor.IsList reports true.
-// A field is a Map if FieldDescriptor.IsMap reports true.
+// The [List] or [Map] types are used if the field cardinality is repeated.
+// A field is a [List] if [FieldDescriptor.IsList] reports true.
+// A field is a [Map] if [FieldDescriptor.IsMap] reports true.
 //
 // Converting to/from a Value and a concrete Go value panics on type mismatch.
-// For example, ValueOf("hello").Int() panics because this attempts to
+// For example, [ValueOf]("hello").Int() panics because this attempts to
 // retrieve an int64 from a string.
 //
-// List, Map, and Message Values are called "composite" values.
+// [List], [Map], and [Message] Values are called "composite" values.
 //
 // A composite Value may alias (reference) memory at some location,
 // such that changes to the Value updates the that location.
-// A composite value acquired with a Mutable method, such as Message.Mutable,
+// A composite value acquired with a Mutable method, such as [Message.Mutable],
 // always references the source object.
 //
 // For example:
@@ -65,7 +65,7 @@ import (
 //	// appending to the List here may or may not modify the message.
 //	list.Append(protoreflect.ValueOfInt32(0))
 //
-// Some operations, such as Message.Get, may return an "empty, read-only"
+// Some operations, such as [Message.Get], may return an "empty, read-only"
 // composite Value. Modifying an empty, read-only value panics.
 type Value value
 
@@ -306,7 +306,7 @@ func (v Value) Float() float64 {
 	}
 }
 
-// String returns v as a string. Since this method implements fmt.Stringer,
+// String returns v as a string. Since this method implements [fmt.Stringer],
 // this returns the formatted string value for any non-string type.
 func (v Value) String() string {
 	switch v.typ {
@@ -327,7 +327,7 @@ func (v Value) Bytes() []byte {
 	}
 }
 
-// Enum returns v as a EnumNumber and panics if the type is not a EnumNumber.
+// Enum returns v as a [EnumNumber] and panics if the type is not a [EnumNumber].
 func (v Value) Enum() EnumNumber {
 	switch v.typ {
 	case enumType:
@@ -337,7 +337,7 @@ func (v Value) Enum() EnumNumber {
 	}
 }
 
-// Message returns v as a Message and panics if the type is not a Message.
+// Message returns v as a [Message] and panics if the type is not a [Message].
 func (v Value) Message() Message {
 	switch vi := v.getIface().(type) {
 	case Message:
@@ -347,7 +347,7 @@ func (v Value) Message() Message {
 	}
 }
 
-// List returns v as a List and panics if the type is not a List.
+// List returns v as a [List] and panics if the type is not a [List].
 func (v Value) List() List {
 	switch vi := v.getIface().(type) {
 	case List:
@@ -357,7 +357,7 @@ func (v Value) List() List {
 	}
 }
 
-// Map returns v as a Map and panics if the type is not a Map.
+// Map returns v as a [Map] and panics if the type is not a [Map].
 func (v Value) Map() Map {
 	switch vi := v.getIface().(type) {
 	case Map:
@@ -367,7 +367,7 @@ func (v Value) Map() Map {
 	}
 }
 
-// MapKey returns v as a MapKey and panics for invalid MapKey types.
+// MapKey returns v as a [MapKey] and panics for invalid [MapKey] types.
 func (v Value) MapKey() MapKey {
 	switch v.typ {
 	case boolType, int32Type, int64Type, uint32Type, uint64Type, stringType:
@@ -378,8 +378,8 @@ func (v Value) MapKey() MapKey {
 }
 
 // MapKey is used to index maps, where the Go type of the MapKey must match
-// the specified key Kind (see MessageDescriptor.IsMapEntry).
-// The following shows what Go type is used to represent each proto Kind:
+// the specified key [Kind] (see [MessageDescriptor.IsMapEntry]).
+// The following shows what Go type is used to represent each proto [Kind]:
 //
 //	╔���������╤�������������������������������������╗
 //	║ Go type │ Protobuf kind                       ║
@@ -392,13 +392,13 @@ func (v Value) MapKey() MapKey {
 //	║ string  │ StringKind                          ║
 //	╚���������╧��������������������������������������
 //
-// A MapKey is constructed and accessed through a Value:
+// A MapKey is constructed and accessed through a [Value]:
 //
 //	k := ValueOf("hash").MapKey() // convert string to MapKey
 //	s := k.String()               // convert MapKey to string
 //
-// The MapKey is a strict subset of valid types used in Value;
-// converting a Value to a MapKey with an invalid type panics.
+// The MapKey is a strict subset of valid types used in [Value];
+// converting a [Value] to a MapKey with an invalid type panics.
 type MapKey value
 
 // IsValid reports whether k is populated with a value.
@@ -426,13 +426,13 @@ func (k MapKey) Uint() uint64 {
 	return Value(k).Uint()
 }
 
-// String returns k as a string. Since this method implements fmt.Stringer,
+// String returns k as a string. Since this method implements [fmt.Stringer],
 // this returns the formatted string value for any non-string type.
 func (k MapKey) String() string {
 	return Value(k).String()
 }
 
-// Value returns k as a Value.
+// Value returns k as a [Value].
 func (k MapKey) Value() Value {
 	return Value(k)
 }
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go
similarity index 97%
rename from vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go
rename to vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go
index 702ddf22a..b1fdbe3e8 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go
@@ -2,8 +2,8 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:build !purego && !appengine
-// +build !purego,!appengine
+//go:build !purego && !appengine && !go1.21
+// +build !purego,!appengine,!go1.21
 
 package protoreflect
 
diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go
new file mode 100644
index 000000000..435470111
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go
@@ -0,0 +1,87 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:build !purego && !appengine && go1.21
+// +build !purego,!appengine,go1.21
+
+package protoreflect
+
+import (
+	"unsafe"
+
+	"google.golang.org/protobuf/internal/pragma"
+)
+
+type (
+	ifaceHeader struct {
+		_    [0]interface{} // if interfaces have greater alignment than unsafe.Pointer, this will enforce it.
+		Type unsafe.Pointer
+		Data unsafe.Pointer
+	}
+)
+
+var (
+	nilType     = typeOf(nil)
+	boolType    = typeOf(*new(bool))
+	int32Type   = typeOf(*new(int32))
+	int64Type   = typeOf(*new(int64))
+	uint32Type  = typeOf(*new(uint32))
+	uint64Type  = typeOf(*new(uint64))
+	float32Type = typeOf(*new(float32))
+	float64Type = typeOf(*new(float64))
+	stringType  = typeOf(*new(string))
+	bytesType   = typeOf(*new([]byte))
+	enumType    = typeOf(*new(EnumNumber))
+)
+
+// typeOf returns a pointer to the Go type information.
+// The pointer is comparable and equal if and only if the types are identical.
+func typeOf(t interface{}) unsafe.Pointer {
+	return (*ifaceHeader)(unsafe.Pointer(&t)).Type
+}
+
+// value is a union where only one type can be represented at a time.
+// The struct is 24B large on 64-bit systems and requires the minimum storage
+// necessary to represent each possible type.
+//
+// The Go GC needs to be able to scan variables containing pointers.
+// As such, pointers and non-pointers cannot be intermixed.
+type value struct {
+	pragma.DoNotCompare // 0B
+
+	// typ stores the type of the value as a pointer to the Go type.
+	typ unsafe.Pointer // 8B
+
+	// ptr stores the data pointer for a String, Bytes, or interface value.
+	ptr unsafe.Pointer // 8B
+
+	// num stores a Bool, Int32, Int64, Uint32, Uint64, Float32, Float64, or
+	// Enum value as a raw uint64.
+	//
+	// It is also used to store the length of a String or Bytes value;
+	// the capacity is ignored.
+	num uint64 // 8B
+}
+
+func valueOfString(v string) Value {
+	return Value{typ: stringType, ptr: unsafe.Pointer(unsafe.StringData(v)), num: uint64(len(v))}
+}
+func valueOfBytes(v []byte) Value {
+	return Value{typ: bytesType, ptr: unsafe.Pointer(unsafe.SliceData(v)), num: uint64(len(v))}
+}
+func valueOfIface(v interface{}) Value {
+	p := (*ifaceHeader)(unsafe.Pointer(&v))
+	return Value{typ: p.Type, ptr: p.Data}
+}
+
+func (v Value) getString() string {
+	return unsafe.String((*byte)(v.ptr), v.num)
+}
+func (v Value) getBytes() []byte {
+	return unsafe.Slice((*byte)(v.ptr), v.num)
+}
+func (v Value) getIface() (x interface{}) {
+	*(*ifaceHeader)(unsafe.Pointer(&x)) = ifaceHeader{Type: v.typ, Data: v.ptr}
+	return x
+}
diff --git a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go
index aeb559774..6267dc52a 100644
--- a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go
+++ b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go
@@ -5,12 +5,12 @@
 // Package protoregistry provides data structures to register and lookup
 // protobuf descriptor types.
 //
-// The Files registry contains file descriptors and provides the ability
+// The [Files] registry contains file descriptors and provides the ability
 // to iterate over the files or lookup a specific descriptor within the files.
-// Files only contains protobuf descriptors and has no understanding of Go
+// [Files] only contains protobuf descriptors and has no understanding of Go
 // type information that may be associated with each descriptor.
 //
-// The Types registry contains descriptor types for which there is a known
+// The [Types] registry contains descriptor types for which there is a known
 // Go type associated with that descriptor. It provides the ability to iterate
 // over the registered types or lookup a type by name.
 package protoregistry
@@ -218,7 +218,7 @@ func (r *Files) checkGenProtoConflict(path string) {
 
 // FindDescriptorByName looks up a descriptor by the full name.
 //
-// This returns (nil, NotFound) if not found.
+// This returns (nil, [NotFound]) if not found.
 func (r *Files) FindDescriptorByName(name protoreflect.FullName) (protoreflect.Descriptor, error) {
 	if r == nil {
 		return nil, NotFound
@@ -310,7 +310,7 @@ func (s *nameSuffix) Pop() (name protoreflect.Name) {
 
 // FindFileByPath looks up a file by the path.
 //
-// This returns (nil, NotFound) if not found.
+// This returns (nil, [NotFound]) if not found.
 // This returns an error if multiple files have the same path.
 func (r *Files) FindFileByPath(path string) (protoreflect.FileDescriptor, error) {
 	if r == nil {
@@ -431,7 +431,7 @@ func rangeTopLevelDescriptors(fd protoreflect.FileDescriptor, f func(protoreflec
 // A compliant implementation must deterministically return the same type
 // if no error is encountered.
 //
-// The Types type implements this interface.
+// The [Types] type implements this interface.
 type MessageTypeResolver interface {
 	// FindMessageByName looks up a message by its full name.
 	// E.g., "google.protobuf.Any"
@@ -451,7 +451,7 @@ type MessageTypeResolver interface {
 // A compliant implementation must deterministically return the same type
 // if no error is encountered.
 //
-// The Types type implements this interface.
+// The [Types] type implements this interface.
 type ExtensionTypeResolver interface {
 	// FindExtensionByName looks up a extension field by the field's full name.
 	// Note that this is the full name of the field as determined by
@@ -590,7 +590,7 @@ func (r *Types) register(kind string, desc protoreflect.Descriptor, typ interfac
 // FindEnumByName looks up an enum by its full name.
 // E.g., "google.protobuf.Field.Kind".
 //
-// This returns (nil, NotFound) if not found.
+// This returns (nil, [NotFound]) if not found.
 func (r *Types) FindEnumByName(enum protoreflect.FullName) (protoreflect.EnumType, error) {
 	if r == nil {
 		return nil, NotFound
@@ -611,7 +611,7 @@ func (r *Types) FindEnumByName(enum protoreflect.FullName) (protoreflect.EnumTyp
 // FindMessageByName looks up a message by its full name,
 // e.g. "google.protobuf.Any".
 //
-// This returns (nil, NotFound) if not found.
+// This returns (nil, [NotFound]) if not found.
 func (r *Types) FindMessageByName(message protoreflect.FullName) (protoreflect.MessageType, error) {
 	if r == nil {
 		return nil, NotFound
@@ -632,7 +632,7 @@ func (r *Types) FindMessageByName(message protoreflect.FullName) (protoreflect.M
 // FindMessageByURL looks up a message by a URL identifier.
 // See documentation on google.protobuf.Any.type_url for the URL format.
 //
-// This returns (nil, NotFound) if not found.
+// This returns (nil, [NotFound]) if not found.
 func (r *Types) FindMessageByURL(url string) (protoreflect.MessageType, error) {
 	// This function is similar to FindMessageByName but
 	// truncates anything before and including '/' in the URL.
@@ -662,7 +662,7 @@ func (r *Types) FindMessageByURL(url string) (protoreflect.MessageType, error) {
 // where the extension is declared and is unrelated to the full name of the
 // message being extended.
 //
-// This returns (nil, NotFound) if not found.
+// This returns (nil, [NotFound]) if not found.
 func (r *Types) FindExtensionByName(field protoreflect.FullName) (protoreflect.ExtensionType, error) {
 	if r == nil {
 		return nil, NotFound
@@ -703,7 +703,7 @@ func (r *Types) FindExtensionByName(field protoreflect.FullName) (protoreflect.E
 // FindExtensionByNumber looks up a extension field by the field number
 // within some parent message, identified by full name.
 //
-// This returns (nil, NotFound) if not found.
+// This returns (nil, [NotFound]) if not found.
 func (r *Types) FindExtensionByNumber(message protoreflect.FullName, field protoreflect.FieldNumber) (protoreflect.ExtensionType, error) {
 	if r == nil {
 		return nil, NotFound
diff --git a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go
index 04c00f737..78624cf60 100644
--- a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go
+++ b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go
@@ -48,6 +48,103 @@ import (
 	sync "sync"
 )
 
+// The full set of known editions.
+type Edition int32
+
+const (
+	// A placeholder for an unknown edition value.
+	Edition_EDITION_UNKNOWN Edition = 0
+	// Legacy syntax "editions".  These pre-date editions, but behave much like
+	// distinct editions.  These can't be used to specify the edition of proto
+	// files, but feature definitions must supply proto2/proto3 defaults for
+	// backwards compatibility.
+	Edition_EDITION_PROTO2 Edition = 998
+	Edition_EDITION_PROTO3 Edition = 999
+	// Editions that have been released.  The specific values are arbitrary and
+	// should not be depended on, but they will always be time-ordered for easy
+	// comparison.
+	Edition_EDITION_2023 Edition = 1000
+	Edition_EDITION_2024 Edition = 1001
+	// Placeholder editions for testing feature resolution.  These should not be
+	// used or relyed on outside of tests.
+	Edition_EDITION_1_TEST_ONLY     Edition = 1
+	Edition_EDITION_2_TEST_ONLY     Edition = 2
+	Edition_EDITION_99997_TEST_ONLY Edition = 99997
+	Edition_EDITION_99998_TEST_ONLY Edition = 99998
+	Edition_EDITION_99999_TEST_ONLY Edition = 99999
+	// Placeholder for specifying unbounded edition support.  This should only
+	// ever be used by plugins that can expect to never require any changes to
+	// support a new edition.
+	Edition_EDITION_MAX Edition = 2147483647
+)
+
+// Enum value maps for Edition.
+var (
+	Edition_name = map[int32]string{
+		0:          "EDITION_UNKNOWN",
+		998:        "EDITION_PROTO2",
+		999:        "EDITION_PROTO3",
+		1000:       "EDITION_2023",
+		1001:       "EDITION_2024",
+		1:          "EDITION_1_TEST_ONLY",
+		2:          "EDITION_2_TEST_ONLY",
+		99997:      "EDITION_99997_TEST_ONLY",
+		99998:      "EDITION_99998_TEST_ONLY",
+		99999:      "EDITION_99999_TEST_ONLY",
+		2147483647: "EDITION_MAX",
+	}
+	Edition_value = map[string]int32{
+		"EDITION_UNKNOWN":         0,
+		"EDITION_PROTO2":          998,
+		"EDITION_PROTO3":          999,
+		"EDITION_2023":            1000,
+		"EDITION_2024":            1001,
+		"EDITION_1_TEST_ONLY":     1,
+		"EDITION_2_TEST_ONLY":     2,
+		"EDITION_99997_TEST_ONLY": 99997,
+		"EDITION_99998_TEST_ONLY": 99998,
+		"EDITION_99999_TEST_ONLY": 99999,
+		"EDITION_MAX":             2147483647,
+	}
+)
+
+func (x Edition) Enum() *Edition {
+	p := new(Edition)
+	*p = x
+	return p
+}
+
+func (x Edition) String() string {
+	return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x))
+}
+
+func (Edition) Descriptor() protoreflect.EnumDescriptor {
+	return file_google_protobuf_descriptor_proto_enumTypes[0].Descriptor()
+}
+
+func (Edition) Type() protoreflect.EnumType {
+	return &file_google_protobuf_descriptor_proto_enumTypes[0]
+}
+
+func (x Edition) Number() protoreflect.EnumNumber {
+	return protoreflect.EnumNumber(x)
+}
+
+// Deprecated: Do not use.
+func (x *Edition) UnmarshalJSON(b []byte) error {
+	num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b)
+	if err != nil {
+		return err
+	}
+	*x = Edition(num)
+	return nil
+}
+
+// Deprecated: Use Edition.Descriptor instead.
+func (Edition) EnumDescriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{0}
+}
+
 // The verification state of the extension range.
 type ExtensionRangeOptions_VerificationState int32
 
@@ -80,11 +177,11 @@ func (x ExtensionRangeOptions_VerificationState) String() string {
 }
 
 func (ExtensionRangeOptions_VerificationState) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[0].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[1].Descriptor()
 }
 
 func (ExtensionRangeOptions_VerificationState) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[0]
+	return &file_google_protobuf_descriptor_proto_enumTypes[1]
 }
 
 func (x ExtensionRangeOptions_VerificationState) Number() protoreflect.EnumNumber {
@@ -125,9 +222,10 @@ const (
 	FieldDescriptorProto_TYPE_BOOL    FieldDescriptorProto_Type = 8
 	FieldDescriptorProto_TYPE_STRING  FieldDescriptorProto_Type = 9
 	// Tag-delimited aggregate.
-	// Group type is deprecated and not supported in proto3. However, Proto3
+	// Group type is deprecated and not supported after google.protobuf. However, Proto3
 	// implementations should still be able to parse the group wire format and
-	// treat group fields as unknown fields.
+	// treat group fields as unknown fields.  In Editions, the group wire format
+	// can be enabled via the `message_encoding` feature.
 	FieldDescriptorProto_TYPE_GROUP   FieldDescriptorProto_Type = 10
 	FieldDescriptorProto_TYPE_MESSAGE FieldDescriptorProto_Type = 11 // Length-delimited aggregate.
 	// New in version 2.
@@ -195,11 +293,11 @@ func (x FieldDescriptorProto_Type) String() string {
 }
 
 func (FieldDescriptorProto_Type) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[1].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[2].Descriptor()
 }
 
 func (FieldDescriptorProto_Type) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[1]
+	return &file_google_protobuf_descriptor_proto_enumTypes[2]
 }
 
 func (x FieldDescriptorProto_Type) Number() protoreflect.EnumNumber {
@@ -226,21 +324,24 @@ type FieldDescriptorProto_Label int32
 const (
 	// 0 is reserved for errors
 	FieldDescriptorProto_LABEL_OPTIONAL FieldDescriptorProto_Label = 1
-	FieldDescriptorProto_LABEL_REQUIRED FieldDescriptorProto_Label = 2
 	FieldDescriptorProto_LABEL_REPEATED FieldDescriptorProto_Label = 3
+	// The required label is only allowed in google.protobuf.  In proto3 and Editions
+	// it's explicitly prohibited.  In Editions, the `field_presence` feature
+	// can be used to get this behavior.
+	FieldDescriptorProto_LABEL_REQUIRED FieldDescriptorProto_Label = 2
 )
 
 // Enum value maps for FieldDescriptorProto_Label.
 var (
 	FieldDescriptorProto_Label_name = map[int32]string{
 		1: "LABEL_OPTIONAL",
-		2: "LABEL_REQUIRED",
 		3: "LABEL_REPEATED",
+		2: "LABEL_REQUIRED",
 	}
 	FieldDescriptorProto_Label_value = map[string]int32{
 		"LABEL_OPTIONAL": 1,
-		"LABEL_REQUIRED": 2,
 		"LABEL_REPEATED": 3,
+		"LABEL_REQUIRED": 2,
 	}
 )
 
@@ -255,11 +356,11 @@ func (x FieldDescriptorProto_Label) String() string {
 }
 
 func (FieldDescriptorProto_Label) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[2].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[3].Descriptor()
 }
 
 func (FieldDescriptorProto_Label) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[2]
+	return &file_google_protobuf_descriptor_proto_enumTypes[3]
 }
 
 func (x FieldDescriptorProto_Label) Number() protoreflect.EnumNumber {
@@ -316,11 +417,11 @@ func (x FileOptions_OptimizeMode) String() string {
 }
 
 func (FileOptions_OptimizeMode) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[3].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[4].Descriptor()
 }
 
 func (FileOptions_OptimizeMode) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[3]
+	return &file_google_protobuf_descriptor_proto_enumTypes[4]
 }
 
 func (x FileOptions_OptimizeMode) Number() protoreflect.EnumNumber {
@@ -382,11 +483,11 @@ func (x FieldOptions_CType) String() string {
 }
 
 func (FieldOptions_CType) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[4].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[5].Descriptor()
 }
 
 func (FieldOptions_CType) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[4]
+	return &file_google_protobuf_descriptor_proto_enumTypes[5]
 }
 
 func (x FieldOptions_CType) Number() protoreflect.EnumNumber {
@@ -444,11 +545,11 @@ func (x FieldOptions_JSType) String() string {
 }
 
 func (FieldOptions_JSType) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[5].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[6].Descriptor()
 }
 
 func (FieldOptions_JSType) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[5]
+	return &file_google_protobuf_descriptor_proto_enumTypes[6]
 }
 
 func (x FieldOptions_JSType) Number() protoreflect.EnumNumber {
@@ -506,11 +607,11 @@ func (x FieldOptions_OptionRetention) String() string {
 }
 
 func (FieldOptions_OptionRetention) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[6].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[7].Descriptor()
 }
 
 func (FieldOptions_OptionRetention) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[6]
+	return &file_google_protobuf_descriptor_proto_enumTypes[7]
 }
 
 func (x FieldOptions_OptionRetention) Number() protoreflect.EnumNumber {
@@ -590,11 +691,11 @@ func (x FieldOptions_OptionTargetType) String() string {
 }
 
 func (FieldOptions_OptionTargetType) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[7].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[8].Descriptor()
 }
 
 func (FieldOptions_OptionTargetType) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[7]
+	return &file_google_protobuf_descriptor_proto_enumTypes[8]
 }
 
 func (x FieldOptions_OptionTargetType) Number() protoreflect.EnumNumber {
@@ -652,11 +753,11 @@ func (x MethodOptions_IdempotencyLevel) String() string {
 }
 
 func (MethodOptions_IdempotencyLevel) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[8].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[9].Descriptor()
 }
 
 func (MethodOptions_IdempotencyLevel) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[8]
+	return &file_google_protobuf_descriptor_proto_enumTypes[9]
 }
 
 func (x MethodOptions_IdempotencyLevel) Number() protoreflect.EnumNumber {
@@ -678,6 +779,363 @@ func (MethodOptions_IdempotencyLevel) EnumDescriptor() ([]byte, []int) {
 	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{17, 0}
 }
 
+type FeatureSet_FieldPresence int32
+
+const (
+	FeatureSet_FIELD_PRESENCE_UNKNOWN FeatureSet_FieldPresence = 0
+	FeatureSet_EXPLICIT               FeatureSet_FieldPresence = 1
+	FeatureSet_IMPLICIT               FeatureSet_FieldPresence = 2
+	FeatureSet_LEGACY_REQUIRED        FeatureSet_FieldPresence = 3
+)
+
+// Enum value maps for FeatureSet_FieldPresence.
+var (
+	FeatureSet_FieldPresence_name = map[int32]string{
+		0: "FIELD_PRESENCE_UNKNOWN",
+		1: "EXPLICIT",
+		2: "IMPLICIT",
+		3: "LEGACY_REQUIRED",
+	}
+	FeatureSet_FieldPresence_value = map[string]int32{
+		"FIELD_PRESENCE_UNKNOWN": 0,
+		"EXPLICIT":               1,
+		"IMPLICIT":               2,
+		"LEGACY_REQUIRED":        3,
+	}
+)
+
+func (x FeatureSet_FieldPresence) Enum() *FeatureSet_FieldPresence {
+	p := new(FeatureSet_FieldPresence)
+	*p = x
+	return p
+}
+
+func (x FeatureSet_FieldPresence) String() string {
+	return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x))
+}
+
+func (FeatureSet_FieldPresence) Descriptor() protoreflect.EnumDescriptor {
+	return file_google_protobuf_descriptor_proto_enumTypes[10].Descriptor()
+}
+
+func (FeatureSet_FieldPresence) Type() protoreflect.EnumType {
+	return &file_google_protobuf_descriptor_proto_enumTypes[10]
+}
+
+func (x FeatureSet_FieldPresence) Number() protoreflect.EnumNumber {
+	return protoreflect.EnumNumber(x)
+}
+
+// Deprecated: Do not use.
+func (x *FeatureSet_FieldPresence) UnmarshalJSON(b []byte) error {
+	num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b)
+	if err != nil {
+		return err
+	}
+	*x = FeatureSet_FieldPresence(num)
+	return nil
+}
+
+// Deprecated: Use FeatureSet_FieldPresence.Descriptor instead.
+func (FeatureSet_FieldPresence) EnumDescriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 0}
+}
+
+type FeatureSet_EnumType int32
+
+const (
+	FeatureSet_ENUM_TYPE_UNKNOWN FeatureSet_EnumType = 0
+	FeatureSet_OPEN              FeatureSet_EnumType = 1
+	FeatureSet_CLOSED            FeatureSet_EnumType = 2
+)
+
+// Enum value maps for FeatureSet_EnumType.
+var (
+	FeatureSet_EnumType_name = map[int32]string{
+		0: "ENUM_TYPE_UNKNOWN",
+		1: "OPEN",
+		2: "CLOSED",
+	}
+	FeatureSet_EnumType_value = map[string]int32{
+		"ENUM_TYPE_UNKNOWN": 0,
+		"OPEN":              1,
+		"CLOSED":            2,
+	}
+)
+
+func (x FeatureSet_EnumType) Enum() *FeatureSet_EnumType {
+	p := new(FeatureSet_EnumType)
+	*p = x
+	return p
+}
+
+func (x FeatureSet_EnumType) String() string {
+	return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x))
+}
+
+func (FeatureSet_EnumType) Descriptor() protoreflect.EnumDescriptor {
+	return file_google_protobuf_descriptor_proto_enumTypes[11].Descriptor()
+}
+
+func (FeatureSet_EnumType) Type() protoreflect.EnumType {
+	return &file_google_protobuf_descriptor_proto_enumTypes[11]
+}
+
+func (x FeatureSet_EnumType) Number() protoreflect.EnumNumber {
+	return protoreflect.EnumNumber(x)
+}
+
+// Deprecated: Do not use.
+func (x *FeatureSet_EnumType) UnmarshalJSON(b []byte) error {
+	num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b)
+	if err != nil {
+		return err
+	}
+	*x = FeatureSet_EnumType(num)
+	return nil
+}
+
+// Deprecated: Use FeatureSet_EnumType.Descriptor instead.
+func (FeatureSet_EnumType) EnumDescriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 1}
+}
+
+type FeatureSet_RepeatedFieldEncoding int32
+
+const (
+	FeatureSet_REPEATED_FIELD_ENCODING_UNKNOWN FeatureSet_RepeatedFieldEncoding = 0
+	FeatureSet_PACKED                          FeatureSet_RepeatedFieldEncoding = 1
+	FeatureSet_EXPANDED                        FeatureSet_RepeatedFieldEncoding = 2
+)
+
+// Enum value maps for FeatureSet_RepeatedFieldEncoding.
+var (
+	FeatureSet_RepeatedFieldEncoding_name = map[int32]string{
+		0: "REPEATED_FIELD_ENCODING_UNKNOWN",
+		1: "PACKED",
+		2: "EXPANDED",
+	}
+	FeatureSet_RepeatedFieldEncoding_value = map[string]int32{
+		"REPEATED_FIELD_ENCODING_UNKNOWN": 0,
+		"PACKED":                          1,
+		"EXPANDED":                        2,
+	}
+)
+
+func (x FeatureSet_RepeatedFieldEncoding) Enum() *FeatureSet_RepeatedFieldEncoding {
+	p := new(FeatureSet_RepeatedFieldEncoding)
+	*p = x
+	return p
+}
+
+func (x FeatureSet_RepeatedFieldEncoding) String() string {
+	return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x))
+}
+
+func (FeatureSet_RepeatedFieldEncoding) Descriptor() protoreflect.EnumDescriptor {
+	return file_google_protobuf_descriptor_proto_enumTypes[12].Descriptor()
+}
+
+func (FeatureSet_RepeatedFieldEncoding) Type() protoreflect.EnumType {
+	return &file_google_protobuf_descriptor_proto_enumTypes[12]
+}
+
+func (x FeatureSet_RepeatedFieldEncoding) Number() protoreflect.EnumNumber {
+	return protoreflect.EnumNumber(x)
+}
+
+// Deprecated: Do not use.
+func (x *FeatureSet_RepeatedFieldEncoding) UnmarshalJSON(b []byte) error {
+	num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b)
+	if err != nil {
+		return err
+	}
+	*x = FeatureSet_RepeatedFieldEncoding(num)
+	return nil
+}
+
+// Deprecated: Use FeatureSet_RepeatedFieldEncoding.Descriptor instead.
+func (FeatureSet_RepeatedFieldEncoding) EnumDescriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 2}
+}
+
+type FeatureSet_Utf8Validation int32
+
+const (
+	FeatureSet_UTF8_VALIDATION_UNKNOWN FeatureSet_Utf8Validation = 0
+	FeatureSet_VERIFY                  FeatureSet_Utf8Validation = 2
+	FeatureSet_NONE                    FeatureSet_Utf8Validation = 3
+)
+
+// Enum value maps for FeatureSet_Utf8Validation.
+var (
+	FeatureSet_Utf8Validation_name = map[int32]string{
+		0: "UTF8_VALIDATION_UNKNOWN",
+		2: "VERIFY",
+		3: "NONE",
+	}
+	FeatureSet_Utf8Validation_value = map[string]int32{
+		"UTF8_VALIDATION_UNKNOWN": 0,
+		"VERIFY":                  2,
+		"NONE":                    3,
+	}
+)
+
+func (x FeatureSet_Utf8Validation) Enum() *FeatureSet_Utf8Validation {
+	p := new(FeatureSet_Utf8Validation)
+	*p = x
+	return p
+}
+
+func (x FeatureSet_Utf8Validation) String() string {
+	return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x))
+}
+
+func (FeatureSet_Utf8Validation) Descriptor() protoreflect.EnumDescriptor {
+	return file_google_protobuf_descriptor_proto_enumTypes[13].Descriptor()
+}
+
+func (FeatureSet_Utf8Validation) Type() protoreflect.EnumType {
+	return &file_google_protobuf_descriptor_proto_enumTypes[13]
+}
+
+func (x FeatureSet_Utf8Validation) Number() protoreflect.EnumNumber {
+	return protoreflect.EnumNumber(x)
+}
+
+// Deprecated: Do not use.
+func (x *FeatureSet_Utf8Validation) UnmarshalJSON(b []byte) error {
+	num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b)
+	if err != nil {
+		return err
+	}
+	*x = FeatureSet_Utf8Validation(num)
+	return nil
+}
+
+// Deprecated: Use FeatureSet_Utf8Validation.Descriptor instead.
+func (FeatureSet_Utf8Validation) EnumDescriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 3}
+}
+
+type FeatureSet_MessageEncoding int32
+
+const (
+	FeatureSet_MESSAGE_ENCODING_UNKNOWN FeatureSet_MessageEncoding = 0
+	FeatureSet_LENGTH_PREFIXED          FeatureSet_MessageEncoding = 1
+	FeatureSet_DELIMITED                FeatureSet_MessageEncoding = 2
+)
+
+// Enum value maps for FeatureSet_MessageEncoding.
+var (
+	FeatureSet_MessageEncoding_name = map[int32]string{
+		0: "MESSAGE_ENCODING_UNKNOWN",
+		1: "LENGTH_PREFIXED",
+		2: "DELIMITED",
+	}
+	FeatureSet_MessageEncoding_value = map[string]int32{
+		"MESSAGE_ENCODING_UNKNOWN": 0,
+		"LENGTH_PREFIXED":          1,
+		"DELIMITED":                2,
+	}
+)
+
+func (x FeatureSet_MessageEncoding) Enum() *FeatureSet_MessageEncoding {
+	p := new(FeatureSet_MessageEncoding)
+	*p = x
+	return p
+}
+
+func (x FeatureSet_MessageEncoding) String() string {
+	return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x))
+}
+
+func (FeatureSet_MessageEncoding) Descriptor() protoreflect.EnumDescriptor {
+	return file_google_protobuf_descriptor_proto_enumTypes[14].Descriptor()
+}
+
+func (FeatureSet_MessageEncoding) Type() protoreflect.EnumType {
+	return &file_google_protobuf_descriptor_proto_enumTypes[14]
+}
+
+func (x FeatureSet_MessageEncoding) Number() protoreflect.EnumNumber {
+	return protoreflect.EnumNumber(x)
+}
+
+// Deprecated: Do not use.
+func (x *FeatureSet_MessageEncoding) UnmarshalJSON(b []byte) error {
+	num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b)
+	if err != nil {
+		return err
+	}
+	*x = FeatureSet_MessageEncoding(num)
+	return nil
+}
+
+// Deprecated: Use FeatureSet_MessageEncoding.Descriptor instead.
+func (FeatureSet_MessageEncoding) EnumDescriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 4}
+}
+
+type FeatureSet_JsonFormat int32
+
+const (
+	FeatureSet_JSON_FORMAT_UNKNOWN FeatureSet_JsonFormat = 0
+	FeatureSet_ALLOW               FeatureSet_JsonFormat = 1
+	FeatureSet_LEGACY_BEST_EFFORT  FeatureSet_JsonFormat = 2
+)
+
+// Enum value maps for FeatureSet_JsonFormat.
+var (
+	FeatureSet_JsonFormat_name = map[int32]string{
+		0: "JSON_FORMAT_UNKNOWN",
+		1: "ALLOW",
+		2: "LEGACY_BEST_EFFORT",
+	}
+	FeatureSet_JsonFormat_value = map[string]int32{
+		"JSON_FORMAT_UNKNOWN": 0,
+		"ALLOW":               1,
+		"LEGACY_BEST_EFFORT":  2,
+	}
+)
+
+func (x FeatureSet_JsonFormat) Enum() *FeatureSet_JsonFormat {
+	p := new(FeatureSet_JsonFormat)
+	*p = x
+	return p
+}
+
+func (x FeatureSet_JsonFormat) String() string {
+	return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x))
+}
+
+func (FeatureSet_JsonFormat) Descriptor() protoreflect.EnumDescriptor {
+	return file_google_protobuf_descriptor_proto_enumTypes[15].Descriptor()
+}
+
+func (FeatureSet_JsonFormat) Type() protoreflect.EnumType {
+	return &file_google_protobuf_descriptor_proto_enumTypes[15]
+}
+
+func (x FeatureSet_JsonFormat) Number() protoreflect.EnumNumber {
+	return protoreflect.EnumNumber(x)
+}
+
+// Deprecated: Do not use.
+func (x *FeatureSet_JsonFormat) UnmarshalJSON(b []byte) error {
+	num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b)
+	if err != nil {
+		return err
+	}
+	*x = FeatureSet_JsonFormat(num)
+	return nil
+}
+
+// Deprecated: Use FeatureSet_JsonFormat.Descriptor instead.
+func (FeatureSet_JsonFormat) EnumDescriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 5}
+}
+
 // Represents the identified object's effect on the element in the original
 // .proto file.
 type GeneratedCodeInfo_Annotation_Semantic int32
@@ -716,11 +1174,11 @@ func (x GeneratedCodeInfo_Annotation_Semantic) String() string {
 }
 
 func (GeneratedCodeInfo_Annotation_Semantic) Descriptor() protoreflect.EnumDescriptor {
-	return file_google_protobuf_descriptor_proto_enumTypes[9].Descriptor()
+	return file_google_protobuf_descriptor_proto_enumTypes[16].Descriptor()
 }
 
 func (GeneratedCodeInfo_Annotation_Semantic) Type() protoreflect.EnumType {
-	return &file_google_protobuf_descriptor_proto_enumTypes[9]
+	return &file_google_protobuf_descriptor_proto_enumTypes[16]
 }
 
 func (x GeneratedCodeInfo_Annotation_Semantic) Number() protoreflect.EnumNumber {
@@ -739,7 +1197,7 @@ func (x *GeneratedCodeInfo_Annotation_Semantic) UnmarshalJSON(b []byte) error {
 
 // Deprecated: Use GeneratedCodeInfo_Annotation_Semantic.Descriptor instead.
 func (GeneratedCodeInfo_Annotation_Semantic) EnumDescriptor() ([]byte, []int) {
-	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20, 0, 0}
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{22, 0, 0}
 }
 
 // The protocol compiler can output a FileDescriptorSet containing the .proto
@@ -822,8 +1280,8 @@ type FileDescriptorProto struct {
 	//
 	// If `edition` is present, this value must be "editions".
 	Syntax *string `protobuf:"bytes,12,opt,name=syntax" json:"syntax,omitempty"`
-	// The edition of the proto file, which is an opaque string.
-	Edition *string `protobuf:"bytes,13,opt,name=edition" json:"edition,omitempty"`
+	// The edition of the proto file.
+	Edition *Edition `protobuf:"varint,14,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"`
 }
 
 func (x *FileDescriptorProto) Reset() {
@@ -942,11 +1400,11 @@ func (x *FileDescriptorProto) GetSyntax() string {
 	return ""
 }
 
-func (x *FileDescriptorProto) GetEdition() string {
+func (x *FileDescriptorProto) GetEdition() Edition {
 	if x != nil && x.Edition != nil {
 		return *x.Edition
 	}
-	return ""
+	return Edition_EDITION_UNKNOWN
 }
 
 // Describes a message type.
@@ -1079,13 +1537,14 @@ type ExtensionRangeOptions struct {
 
 	// The parser stores options it doesn't recognize here. See above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
-	// go/protobuf-stripping-extension-declarations
-	// Like Metadata, but we use a repeated field to hold all extension
-	// declarations. This should avoid the size increases of transforming a large
-	// extension range into small ranges in generated binaries.
+	// For external users: DO NOT USE. We are in the process of open sourcing
+	// extension declaration and executing internal cleanups before it can be
+	// used externally.
 	Declaration []*ExtensionRangeOptions_Declaration `protobuf:"bytes,2,rep,name=declaration" json:"declaration,omitempty"`
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,50,opt,name=features" json:"features,omitempty"`
 	// The verification state of the range.
-	// TODO(b/278783756): flip the default to DECLARATION once all empty ranges
+	// TODO: flip the default to DECLARATION once all empty ranges
 	// are marked as UNVERIFIED.
 	Verification *ExtensionRangeOptions_VerificationState `protobuf:"varint,3,opt,name=verification,enum=google.protobuf.ExtensionRangeOptions_VerificationState,def=1" json:"verification,omitempty"`
 }
@@ -1141,6 +1600,13 @@ func (x *ExtensionRangeOptions) GetDeclaration() []*ExtensionRangeOptions_Declar
 	return nil
 }
 
+func (x *ExtensionRangeOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 func (x *ExtensionRangeOptions) GetVerification() ExtensionRangeOptions_VerificationState {
 	if x != nil && x.Verification != nil {
 		return *x.Verification
@@ -1186,12 +1652,12 @@ type FieldDescriptorProto struct {
 	// If true, this is a proto3 "optional". When a proto3 field is optional, it
 	// tracks presence regardless of field type.
 	//
-	// When proto3_optional is true, this field must be belong to a oneof to
-	// signal to old proto3 clients that presence is tracked for this field. This
-	// oneof is known as a "synthetic" oneof, and this field must be its sole
-	// member (each proto3 optional field gets its own synthetic oneof). Synthetic
-	// oneofs exist in the descriptor only, and do not generate any API. Synthetic
-	// oneofs must be ordered after all "real" oneofs.
+	// When proto3_optional is true, this field must belong to a oneof to signal
+	// to old proto3 clients that presence is tracked for this field. This oneof
+	// is known as a "synthetic" oneof, and this field must be its sole member
+	// (each proto3 optional field gets its own synthetic oneof). Synthetic oneofs
+	// exist in the descriptor only, and do not generate any API. Synthetic oneofs
+	// must be ordered after all "real" oneofs.
 	//
 	// For message fields, proto3_optional doesn't create any semantic change,
 	// since non-repeated message fields always track presence. However it still
@@ -1738,7 +2204,6 @@ type FileOptions struct {
 	CcGenericServices   *bool `protobuf:"varint,16,opt,name=cc_generic_services,json=ccGenericServices,def=0" json:"cc_generic_services,omitempty"`
 	JavaGenericServices *bool `protobuf:"varint,17,opt,name=java_generic_services,json=javaGenericServices,def=0" json:"java_generic_services,omitempty"`
 	PyGenericServices   *bool `protobuf:"varint,18,opt,name=py_generic_services,json=pyGenericServices,def=0" json:"py_generic_services,omitempty"`
-	PhpGenericServices  *bool `protobuf:"varint,42,opt,name=php_generic_services,json=phpGenericServices,def=0" json:"php_generic_services,omitempty"`
 	// Is this file deprecated?
 	// Depending on the target platform, this can emit Deprecated annotations
 	// for everything in the file, or it will be completely ignored; in the very
@@ -1772,6 +2237,8 @@ type FileOptions struct {
 	// is empty. When this option is not set, the package name will be used for
 	// determining the ruby package.
 	RubyPackage *string `protobuf:"bytes,45,opt,name=ruby_package,json=rubyPackage" json:"ruby_package,omitempty"`
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,50,opt,name=features" json:"features,omitempty"`
 	// The parser stores options it doesn't recognize here.
 	// See the documentation for the "Options" section above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
@@ -1785,7 +2252,6 @@ const (
 	Default_FileOptions_CcGenericServices   = bool(false)
 	Default_FileOptions_JavaGenericServices = bool(false)
 	Default_FileOptions_PyGenericServices   = bool(false)
-	Default_FileOptions_PhpGenericServices  = bool(false)
 	Default_FileOptions_Deprecated          = bool(false)
 	Default_FileOptions_CcEnableArenas      = bool(true)
 )
@@ -1893,13 +2359,6 @@ func (x *FileOptions) GetPyGenericServices() bool {
 	return Default_FileOptions_PyGenericServices
 }
 
-func (x *FileOptions) GetPhpGenericServices() bool {
-	if x != nil && x.PhpGenericServices != nil {
-		return *x.PhpGenericServices
-	}
-	return Default_FileOptions_PhpGenericServices
-}
-
 func (x *FileOptions) GetDeprecated() bool {
 	if x != nil && x.Deprecated != nil {
 		return *x.Deprecated
@@ -1963,6 +2422,13 @@ func (x *FileOptions) GetRubyPackage() string {
 	return ""
 }
 
+func (x *FileOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 func (x *FileOptions) GetUninterpretedOption() []*UninterpretedOption {
 	if x != nil {
 		return x.UninterpretedOption
@@ -2006,10 +2472,6 @@ type MessageOptions struct {
 	// for the message, or it will be completely ignored; in the very least,
 	// this is a formalization for deprecating messages.
 	Deprecated *bool `protobuf:"varint,3,opt,name=deprecated,def=0" json:"deprecated,omitempty"`
-	// NOTE: Do not set the option in .proto files. Always use the maps syntax
-	// instead. The option should only be implicitly set by the proto compiler
-	// parser.
-	//
 	// Whether the message is an automatically generated map entry type for the
 	// maps field.
 	//
@@ -2030,6 +2492,10 @@ type MessageOptions struct {
 	// use a native map in the target language to hold the keys and values.
 	// The reflection APIs in such implementations still need to work as
 	// if the field is a repeated message field.
+	//
+	// NOTE: Do not set the option in .proto files. Always use the maps syntax
+	// instead. The option should only be implicitly set by the proto compiler
+	// parser.
 	MapEntry *bool `protobuf:"varint,7,opt,name=map_entry,json=mapEntry" json:"map_entry,omitempty"`
 	// Enable the legacy handling of JSON field name conflicts.  This lowercases
 	// and strips underscored from the fields before comparison in proto3 only.
@@ -2039,11 +2505,13 @@ type MessageOptions struct {
 	// This should only be used as a temporary measure against broken builds due
 	// to the change in behavior for JSON field name conflicts.
 	//
-	// TODO(b/261750190) This is legacy behavior we plan to remove once downstream
+	// TODO This is legacy behavior we plan to remove once downstream
 	// teams have had time to migrate.
 	//
 	// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto.
 	DeprecatedLegacyJsonFieldConflicts *bool `protobuf:"varint,11,opt,name=deprecated_legacy_json_field_conflicts,json=deprecatedLegacyJsonFieldConflicts" json:"deprecated_legacy_json_field_conflicts,omitempty"`
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,12,opt,name=features" json:"features,omitempty"`
 	// The parser stores options it doesn't recognize here. See above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
 }
@@ -2123,6 +2591,13 @@ func (x *MessageOptions) GetDeprecatedLegacyJsonFieldConflicts() bool {
 	return false
 }
 
+func (x *MessageOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 func (x *MessageOptions) GetUninterpretedOption() []*UninterpretedOption {
 	if x != nil {
 		return x.UninterpretedOption
@@ -2147,7 +2622,9 @@ type FieldOptions struct {
 	// a more efficient representation on the wire. Rather than repeatedly
 	// writing the tag and type for each element, the entire array is encoded as
 	// a single length-delimited blob. In proto3, only explicit setting it to
-	// false will avoid using packed encoding.
+	// false will avoid using packed encoding.  This option is prohibited in
+	// Editions, but the `repeated_field_encoding` feature can be used to control
+	// the behavior.
 	Packed *bool `protobuf:"varint,2,opt,name=packed" json:"packed,omitempty"`
 	// The jstype option determines the JavaScript type used for values of the
 	// field.  The option is permitted only for 64 bit integral and fixed types
@@ -2178,19 +2655,11 @@ type FieldOptions struct {
 	// call from multiple threads concurrently, while non-const methods continue
 	// to require exclusive access.
 	//
-	// Note that implementations may choose not to check required fields within
-	// a lazy sub-message.  That is, calling IsInitialized() on the outer message
-	// may return true even if the inner message has missing required fields.
-	// This is necessary because otherwise the inner message would have to be
-	// parsed in order to perform the check, defeating the purpose of lazy
-	// parsing.  An implementation which chooses not to check required fields
-	// must be consistent about it.  That is, for any particular sub-message, the
-	// implementation must either *always* check its required fields, or *never*
-	// check its required fields, regardless of whether or not the message has
-	// been parsed.
-	//
-	// As of May 2022, lazy verifies the contents of the byte stream during
-	// parsing.  An invalid byte stream will cause the overall parsing to fail.
+	// Note that lazy message fields are still eagerly verified to check
+	// ill-formed wireformat or missing required fields. Calling IsInitialized()
+	// on the outer message would fail if the inner message has missing required
+	// fields. Failed verification would result in parsing failure (except when
+	// uninitialized messages are acceptable).
 	Lazy *bool `protobuf:"varint,5,opt,name=lazy,def=0" json:"lazy,omitempty"`
 	// unverified_lazy does no correctness checks on the byte stream. This should
 	// only be used where lazy with verification is prohibitive for performance
@@ -2205,11 +2674,12 @@ type FieldOptions struct {
 	Weak *bool `protobuf:"varint,10,opt,name=weak,def=0" json:"weak,omitempty"`
 	// Indicate that the field value should not be printed out when using debug
 	// formats, e.g. when the field contains sensitive credentials.
-	DebugRedact *bool                         `protobuf:"varint,16,opt,name=debug_redact,json=debugRedact,def=0" json:"debug_redact,omitempty"`
-	Retention   *FieldOptions_OptionRetention `protobuf:"varint,17,opt,name=retention,enum=google.protobuf.FieldOptions_OptionRetention" json:"retention,omitempty"`
-	// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto.
-	Target  *FieldOptions_OptionTargetType  `protobuf:"varint,18,opt,name=target,enum=google.protobuf.FieldOptions_OptionTargetType" json:"target,omitempty"`
-	Targets []FieldOptions_OptionTargetType `protobuf:"varint,19,rep,name=targets,enum=google.protobuf.FieldOptions_OptionTargetType" json:"targets,omitempty"`
+	DebugRedact     *bool                           `protobuf:"varint,16,opt,name=debug_redact,json=debugRedact,def=0" json:"debug_redact,omitempty"`
+	Retention       *FieldOptions_OptionRetention   `protobuf:"varint,17,opt,name=retention,enum=google.protobuf.FieldOptions_OptionRetention" json:"retention,omitempty"`
+	Targets         []FieldOptions_OptionTargetType `protobuf:"varint,19,rep,name=targets,enum=google.protobuf.FieldOptions_OptionTargetType" json:"targets,omitempty"`
+	EditionDefaults []*FieldOptions_EditionDefault  `protobuf:"bytes,20,rep,name=edition_defaults,json=editionDefaults" json:"edition_defaults,omitempty"`
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,21,opt,name=features" json:"features,omitempty"`
 	// The parser stores options it doesn't recognize here. See above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
 }
@@ -2320,17 +2790,23 @@ func (x *FieldOptions) GetRetention() FieldOptions_OptionRetention {
 	return FieldOptions_RETENTION_UNKNOWN
 }
 
-// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto.
-func (x *FieldOptions) GetTarget() FieldOptions_OptionTargetType {
-	if x != nil && x.Target != nil {
-		return *x.Target
+func (x *FieldOptions) GetTargets() []FieldOptions_OptionTargetType {
+	if x != nil {
+		return x.Targets
 	}
-	return FieldOptions_TARGET_TYPE_UNKNOWN
+	return nil
 }
 
-func (x *FieldOptions) GetTargets() []FieldOptions_OptionTargetType {
+func (x *FieldOptions) GetEditionDefaults() []*FieldOptions_EditionDefault {
 	if x != nil {
-		return x.Targets
+		return x.EditionDefaults
+	}
+	return nil
+}
+
+func (x *FieldOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
 	}
 	return nil
 }
@@ -2348,6 +2824,8 @@ type OneofOptions struct {
 	unknownFields   protoimpl.UnknownFields
 	extensionFields protoimpl.ExtensionFields
 
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,1,opt,name=features" json:"features,omitempty"`
 	// The parser stores options it doesn't recognize here. See above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
 }
@@ -2384,6 +2862,13 @@ func (*OneofOptions) Descriptor() ([]byte, []int) {
 	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{13}
 }
 
+func (x *OneofOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 func (x *OneofOptions) GetUninterpretedOption() []*UninterpretedOption {
 	if x != nil {
 		return x.UninterpretedOption
@@ -2409,11 +2894,13 @@ type EnumOptions struct {
 	// and strips underscored from the fields before comparison in proto3 only.
 	// The new behavior takes `json_name` into account and applies to proto2 as
 	// well.
-	// TODO(b/261750190) Remove this legacy behavior once downstream teams have
+	// TODO Remove this legacy behavior once downstream teams have
 	// had time to migrate.
 	//
 	// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto.
 	DeprecatedLegacyJsonFieldConflicts *bool `protobuf:"varint,6,opt,name=deprecated_legacy_json_field_conflicts,json=deprecatedLegacyJsonFieldConflicts" json:"deprecated_legacy_json_field_conflicts,omitempty"`
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,7,opt,name=features" json:"features,omitempty"`
 	// The parser stores options it doesn't recognize here. See above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
 }
@@ -2477,6 +2964,13 @@ func (x *EnumOptions) GetDeprecatedLegacyJsonFieldConflicts() bool {
 	return false
 }
 
+func (x *EnumOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 func (x *EnumOptions) GetUninterpretedOption() []*UninterpretedOption {
 	if x != nil {
 		return x.UninterpretedOption
@@ -2495,13 +2989,20 @@ type EnumValueOptions struct {
 	// for the enum value, or it will be completely ignored; in the very least,
 	// this is a formalization for deprecating enum values.
 	Deprecated *bool `protobuf:"varint,1,opt,name=deprecated,def=0" json:"deprecated,omitempty"`
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,2,opt,name=features" json:"features,omitempty"`
+	// Indicate that fields annotated with this enum value should not be printed
+	// out when using debug formats, e.g. when the field contains sensitive
+	// credentials.
+	DebugRedact *bool `protobuf:"varint,3,opt,name=debug_redact,json=debugRedact,def=0" json:"debug_redact,omitempty"`
 	// The parser stores options it doesn't recognize here. See above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
 }
 
 // Default values for EnumValueOptions fields.
 const (
-	Default_EnumValueOptions_Deprecated = bool(false)
+	Default_EnumValueOptions_Deprecated  = bool(false)
+	Default_EnumValueOptions_DebugRedact = bool(false)
 )
 
 func (x *EnumValueOptions) Reset() {
@@ -2543,6 +3044,20 @@ func (x *EnumValueOptions) GetDeprecated() bool {
 	return Default_EnumValueOptions_Deprecated
 }
 
+func (x *EnumValueOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
+func (x *EnumValueOptions) GetDebugRedact() bool {
+	if x != nil && x.DebugRedact != nil {
+		return *x.DebugRedact
+	}
+	return Default_EnumValueOptions_DebugRedact
+}
+
 func (x *EnumValueOptions) GetUninterpretedOption() []*UninterpretedOption {
 	if x != nil {
 		return x.UninterpretedOption
@@ -2556,6 +3071,8 @@ type ServiceOptions struct {
 	unknownFields   protoimpl.UnknownFields
 	extensionFields protoimpl.ExtensionFields
 
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,34,opt,name=features" json:"features,omitempty"`
 	// Is this service deprecated?
 	// Depending on the target platform, this can emit Deprecated annotations
 	// for the service, or it will be completely ignored; in the very least,
@@ -2602,6 +3119,13 @@ func (*ServiceOptions) Descriptor() ([]byte, []int) {
 	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{16}
 }
 
+func (x *ServiceOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 func (x *ServiceOptions) GetDeprecated() bool {
 	if x != nil && x.Deprecated != nil {
 		return *x.Deprecated
@@ -2628,6 +3152,8 @@ type MethodOptions struct {
 	// this is a formalization for deprecating methods.
 	Deprecated       *bool                           `protobuf:"varint,33,opt,name=deprecated,def=0" json:"deprecated,omitempty"`
 	IdempotencyLevel *MethodOptions_IdempotencyLevel `protobuf:"varint,34,opt,name=idempotency_level,json=idempotencyLevel,enum=google.protobuf.MethodOptions_IdempotencyLevel,def=0" json:"idempotency_level,omitempty"`
+	// Any features defined in the specific edition.
+	Features *FeatureSet `protobuf:"bytes,35,opt,name=features" json:"features,omitempty"`
 	// The parser stores options it doesn't recognize here. See above.
 	UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"`
 }
@@ -2684,6 +3210,13 @@ func (x *MethodOptions) GetIdempotencyLevel() MethodOptions_IdempotencyLevel {
 	return Default_MethodOptions_IdempotencyLevel
 }
 
+func (x *MethodOptions) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 func (x *MethodOptions) GetUninterpretedOption() []*UninterpretedOption {
 	if x != nil {
 		return x.UninterpretedOption
@@ -2770,28 +3303,193 @@ func (x *UninterpretedOption) GetNegativeIntValue() int64 {
 	if x != nil && x.NegativeIntValue != nil {
 		return *x.NegativeIntValue
 	}
-	return 0
+	return 0
+}
+
+func (x *UninterpretedOption) GetDoubleValue() float64 {
+	if x != nil && x.DoubleValue != nil {
+		return *x.DoubleValue
+	}
+	return 0
+}
+
+func (x *UninterpretedOption) GetStringValue() []byte {
+	if x != nil {
+		return x.StringValue
+	}
+	return nil
+}
+
+func (x *UninterpretedOption) GetAggregateValue() string {
+	if x != nil && x.AggregateValue != nil {
+		return *x.AggregateValue
+	}
+	return ""
+}
+
+// TODO Enums in C++ gencode (and potentially other languages) are
+// not well scoped.  This means that each of the feature enums below can clash
+// with each other.  The short names we've chosen maximize call-site
+// readability, but leave us very open to this scenario.  A future feature will
+// be designed and implemented to handle this, hopefully before we ever hit a
+// conflict here.
+type FeatureSet struct {
+	state           protoimpl.MessageState
+	sizeCache       protoimpl.SizeCache
+	unknownFields   protoimpl.UnknownFields
+	extensionFields protoimpl.ExtensionFields
+
+	FieldPresence         *FeatureSet_FieldPresence         `protobuf:"varint,1,opt,name=field_presence,json=fieldPresence,enum=google.protobuf.FeatureSet_FieldPresence" json:"field_presence,omitempty"`
+	EnumType              *FeatureSet_EnumType              `protobuf:"varint,2,opt,name=enum_type,json=enumType,enum=google.protobuf.FeatureSet_EnumType" json:"enum_type,omitempty"`
+	RepeatedFieldEncoding *FeatureSet_RepeatedFieldEncoding `protobuf:"varint,3,opt,name=repeated_field_encoding,json=repeatedFieldEncoding,enum=google.protobuf.FeatureSet_RepeatedFieldEncoding" json:"repeated_field_encoding,omitempty"`
+	Utf8Validation        *FeatureSet_Utf8Validation        `protobuf:"varint,4,opt,name=utf8_validation,json=utf8Validation,enum=google.protobuf.FeatureSet_Utf8Validation" json:"utf8_validation,omitempty"`
+	MessageEncoding       *FeatureSet_MessageEncoding       `protobuf:"varint,5,opt,name=message_encoding,json=messageEncoding,enum=google.protobuf.FeatureSet_MessageEncoding" json:"message_encoding,omitempty"`
+	JsonFormat            *FeatureSet_JsonFormat            `protobuf:"varint,6,opt,name=json_format,json=jsonFormat,enum=google.protobuf.FeatureSet_JsonFormat" json:"json_format,omitempty"`
+}
+
+func (x *FeatureSet) Reset() {
+	*x = FeatureSet{}
+	if protoimpl.UnsafeEnabled {
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[19]
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		ms.StoreMessageInfo(mi)
+	}
+}
+
+func (x *FeatureSet) String() string {
+	return protoimpl.X.MessageStringOf(x)
+}
+
+func (*FeatureSet) ProtoMessage() {}
+
+func (x *FeatureSet) ProtoReflect() protoreflect.Message {
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[19]
+	if protoimpl.UnsafeEnabled && x != nil {
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		if ms.LoadMessageInfo() == nil {
+			ms.StoreMessageInfo(mi)
+		}
+		return ms
+	}
+	return mi.MessageOf(x)
+}
+
+// Deprecated: Use FeatureSet.ProtoReflect.Descriptor instead.
+func (*FeatureSet) Descriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19}
+}
+
+func (x *FeatureSet) GetFieldPresence() FeatureSet_FieldPresence {
+	if x != nil && x.FieldPresence != nil {
+		return *x.FieldPresence
+	}
+	return FeatureSet_FIELD_PRESENCE_UNKNOWN
+}
+
+func (x *FeatureSet) GetEnumType() FeatureSet_EnumType {
+	if x != nil && x.EnumType != nil {
+		return *x.EnumType
+	}
+	return FeatureSet_ENUM_TYPE_UNKNOWN
+}
+
+func (x *FeatureSet) GetRepeatedFieldEncoding() FeatureSet_RepeatedFieldEncoding {
+	if x != nil && x.RepeatedFieldEncoding != nil {
+		return *x.RepeatedFieldEncoding
+	}
+	return FeatureSet_REPEATED_FIELD_ENCODING_UNKNOWN
+}
+
+func (x *FeatureSet) GetUtf8Validation() FeatureSet_Utf8Validation {
+	if x != nil && x.Utf8Validation != nil {
+		return *x.Utf8Validation
+	}
+	return FeatureSet_UTF8_VALIDATION_UNKNOWN
+}
+
+func (x *FeatureSet) GetMessageEncoding() FeatureSet_MessageEncoding {
+	if x != nil && x.MessageEncoding != nil {
+		return *x.MessageEncoding
+	}
+	return FeatureSet_MESSAGE_ENCODING_UNKNOWN
+}
+
+func (x *FeatureSet) GetJsonFormat() FeatureSet_JsonFormat {
+	if x != nil && x.JsonFormat != nil {
+		return *x.JsonFormat
+	}
+	return FeatureSet_JSON_FORMAT_UNKNOWN
+}
+
+// A compiled specification for the defaults of a set of features.  These
+// messages are generated from FeatureSet extensions and can be used to seed
+// feature resolution. The resolution with this object becomes a simple search
+// for the closest matching edition, followed by proto merges.
+type FeatureSetDefaults struct {
+	state         protoimpl.MessageState
+	sizeCache     protoimpl.SizeCache
+	unknownFields protoimpl.UnknownFields
+
+	Defaults []*FeatureSetDefaults_FeatureSetEditionDefault `protobuf:"bytes,1,rep,name=defaults" json:"defaults,omitempty"`
+	// The minimum supported edition (inclusive) when this was constructed.
+	// Editions before this will not have defaults.
+	MinimumEdition *Edition `protobuf:"varint,4,opt,name=minimum_edition,json=minimumEdition,enum=google.protobuf.Edition" json:"minimum_edition,omitempty"`
+	// The maximum known edition (inclusive) when this was constructed. Editions
+	// after this will not have reliable defaults.
+	MaximumEdition *Edition `protobuf:"varint,5,opt,name=maximum_edition,json=maximumEdition,enum=google.protobuf.Edition" json:"maximum_edition,omitempty"`
+}
+
+func (x *FeatureSetDefaults) Reset() {
+	*x = FeatureSetDefaults{}
+	if protoimpl.UnsafeEnabled {
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[20]
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		ms.StoreMessageInfo(mi)
+	}
+}
+
+func (x *FeatureSetDefaults) String() string {
+	return protoimpl.X.MessageStringOf(x)
+}
+
+func (*FeatureSetDefaults) ProtoMessage() {}
+
+func (x *FeatureSetDefaults) ProtoReflect() protoreflect.Message {
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[20]
+	if protoimpl.UnsafeEnabled && x != nil {
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		if ms.LoadMessageInfo() == nil {
+			ms.StoreMessageInfo(mi)
+		}
+		return ms
+	}
+	return mi.MessageOf(x)
 }
 
-func (x *UninterpretedOption) GetDoubleValue() float64 {
-	if x != nil && x.DoubleValue != nil {
-		return *x.DoubleValue
-	}
-	return 0
+// Deprecated: Use FeatureSetDefaults.ProtoReflect.Descriptor instead.
+func (*FeatureSetDefaults) Descriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20}
 }
 
-func (x *UninterpretedOption) GetStringValue() []byte {
+func (x *FeatureSetDefaults) GetDefaults() []*FeatureSetDefaults_FeatureSetEditionDefault {
 	if x != nil {
-		return x.StringValue
+		return x.Defaults
 	}
 	return nil
 }
 
-func (x *UninterpretedOption) GetAggregateValue() string {
-	if x != nil && x.AggregateValue != nil {
-		return *x.AggregateValue
+func (x *FeatureSetDefaults) GetMinimumEdition() Edition {
+	if x != nil && x.MinimumEdition != nil {
+		return *x.MinimumEdition
 	}
-	return ""
+	return Edition_EDITION_UNKNOWN
+}
+
+func (x *FeatureSetDefaults) GetMaximumEdition() Edition {
+	if x != nil && x.MaximumEdition != nil {
+		return *x.MaximumEdition
+	}
+	return Edition_EDITION_UNKNOWN
 }
 
 // Encapsulates information about the original source file from which a
@@ -2855,7 +3553,7 @@ type SourceCodeInfo struct {
 func (x *SourceCodeInfo) Reset() {
 	*x = SourceCodeInfo{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[19]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[21]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -2868,7 +3566,7 @@ func (x *SourceCodeInfo) String() string {
 func (*SourceCodeInfo) ProtoMessage() {}
 
 func (x *SourceCodeInfo) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[19]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[21]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -2881,7 +3579,7 @@ func (x *SourceCodeInfo) ProtoReflect() protoreflect.Message {
 
 // Deprecated: Use SourceCodeInfo.ProtoReflect.Descriptor instead.
 func (*SourceCodeInfo) Descriptor() ([]byte, []int) {
-	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19}
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{21}
 }
 
 func (x *SourceCodeInfo) GetLocation() []*SourceCodeInfo_Location {
@@ -2907,7 +3605,7 @@ type GeneratedCodeInfo struct {
 func (x *GeneratedCodeInfo) Reset() {
 	*x = GeneratedCodeInfo{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[20]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[22]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -2920,7 +3618,7 @@ func (x *GeneratedCodeInfo) String() string {
 func (*GeneratedCodeInfo) ProtoMessage() {}
 
 func (x *GeneratedCodeInfo) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[20]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[22]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -2933,7 +3631,7 @@ func (x *GeneratedCodeInfo) ProtoReflect() protoreflect.Message {
 
 // Deprecated: Use GeneratedCodeInfo.ProtoReflect.Descriptor instead.
 func (*GeneratedCodeInfo) Descriptor() ([]byte, []int) {
-	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20}
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{22}
 }
 
 func (x *GeneratedCodeInfo) GetAnnotation() []*GeneratedCodeInfo_Annotation {
@@ -2956,7 +3654,7 @@ type DescriptorProto_ExtensionRange struct {
 func (x *DescriptorProto_ExtensionRange) Reset() {
 	*x = DescriptorProto_ExtensionRange{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[21]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[23]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -2969,7 +3667,7 @@ func (x *DescriptorProto_ExtensionRange) String() string {
 func (*DescriptorProto_ExtensionRange) ProtoMessage() {}
 
 func (x *DescriptorProto_ExtensionRange) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[21]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[23]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -3021,7 +3719,7 @@ type DescriptorProto_ReservedRange struct {
 func (x *DescriptorProto_ReservedRange) Reset() {
 	*x = DescriptorProto_ReservedRange{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[22]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[24]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -3034,7 +3732,7 @@ func (x *DescriptorProto_ReservedRange) String() string {
 func (*DescriptorProto_ReservedRange) ProtoMessage() {}
 
 func (x *DescriptorProto_ReservedRange) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[22]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[24]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -3078,10 +3776,6 @@ type ExtensionRangeOptions_Declaration struct {
 	// Metadata.type, Declaration.type must have a leading dot for messages
 	// and enums.
 	Type *string `protobuf:"bytes,3,opt,name=type" json:"type,omitempty"`
-	// Deprecated. Please use "repeated".
-	//
-	// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto.
-	IsRepeated *bool `protobuf:"varint,4,opt,name=is_repeated,json=isRepeated" json:"is_repeated,omitempty"`
 	// If true, indicates that the number is reserved in the extension range,
 	// and any extension field with the number will fail to compile. Set this
 	// when a declared extension field is deleted.
@@ -3094,7 +3788,7 @@ type ExtensionRangeOptions_Declaration struct {
 func (x *ExtensionRangeOptions_Declaration) Reset() {
 	*x = ExtensionRangeOptions_Declaration{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[23]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[25]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -3107,7 +3801,7 @@ func (x *ExtensionRangeOptions_Declaration) String() string {
 func (*ExtensionRangeOptions_Declaration) ProtoMessage() {}
 
 func (x *ExtensionRangeOptions_Declaration) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[23]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[25]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -3144,14 +3838,6 @@ func (x *ExtensionRangeOptions_Declaration) GetType() string {
 	return ""
 }
 
-// Deprecated: Marked as deprecated in google/protobuf/descriptor.proto.
-func (x *ExtensionRangeOptions_Declaration) GetIsRepeated() bool {
-	if x != nil && x.IsRepeated != nil {
-		return *x.IsRepeated
-	}
-	return false
-}
-
 func (x *ExtensionRangeOptions_Declaration) GetReserved() bool {
 	if x != nil && x.Reserved != nil {
 		return *x.Reserved
@@ -3184,7 +3870,7 @@ type EnumDescriptorProto_EnumReservedRange struct {
 func (x *EnumDescriptorProto_EnumReservedRange) Reset() {
 	*x = EnumDescriptorProto_EnumReservedRange{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[24]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[26]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -3197,7 +3883,7 @@ func (x *EnumDescriptorProto_EnumReservedRange) String() string {
 func (*EnumDescriptorProto_EnumReservedRange) ProtoMessage() {}
 
 func (x *EnumDescriptorProto_EnumReservedRange) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[24]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[26]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -3227,6 +3913,61 @@ func (x *EnumDescriptorProto_EnumReservedRange) GetEnd() int32 {
 	return 0
 }
 
+type FieldOptions_EditionDefault struct {
+	state         protoimpl.MessageState
+	sizeCache     protoimpl.SizeCache
+	unknownFields protoimpl.UnknownFields
+
+	Edition *Edition `protobuf:"varint,3,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"`
+	Value   *string  `protobuf:"bytes,2,opt,name=value" json:"value,omitempty"` // Textproto value.
+}
+
+func (x *FieldOptions_EditionDefault) Reset() {
+	*x = FieldOptions_EditionDefault{}
+	if protoimpl.UnsafeEnabled {
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[27]
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		ms.StoreMessageInfo(mi)
+	}
+}
+
+func (x *FieldOptions_EditionDefault) String() string {
+	return protoimpl.X.MessageStringOf(x)
+}
+
+func (*FieldOptions_EditionDefault) ProtoMessage() {}
+
+func (x *FieldOptions_EditionDefault) ProtoReflect() protoreflect.Message {
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[27]
+	if protoimpl.UnsafeEnabled && x != nil {
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		if ms.LoadMessageInfo() == nil {
+			ms.StoreMessageInfo(mi)
+		}
+		return ms
+	}
+	return mi.MessageOf(x)
+}
+
+// Deprecated: Use FieldOptions_EditionDefault.ProtoReflect.Descriptor instead.
+func (*FieldOptions_EditionDefault) Descriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{12, 0}
+}
+
+func (x *FieldOptions_EditionDefault) GetEdition() Edition {
+	if x != nil && x.Edition != nil {
+		return *x.Edition
+	}
+	return Edition_EDITION_UNKNOWN
+}
+
+func (x *FieldOptions_EditionDefault) GetValue() string {
+	if x != nil && x.Value != nil {
+		return *x.Value
+	}
+	return ""
+}
+
 // The name of the uninterpreted option.  Each string represents a segment in
 // a dot-separated name.  is_extension is true iff a segment represents an
 // extension (denoted with parentheses in options specs in .proto files).
@@ -3244,7 +3985,7 @@ type UninterpretedOption_NamePart struct {
 func (x *UninterpretedOption_NamePart) Reset() {
 	*x = UninterpretedOption_NamePart{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[25]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[28]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -3257,7 +3998,7 @@ func (x *UninterpretedOption_NamePart) String() string {
 func (*UninterpretedOption_NamePart) ProtoMessage() {}
 
 func (x *UninterpretedOption_NamePart) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[25]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[28]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -3287,6 +4028,65 @@ func (x *UninterpretedOption_NamePart) GetIsExtension() bool {
 	return false
 }
 
+// A map from every known edition with a unique set of defaults to its
+// defaults. Not all editions may be contained here.  For a given edition,
+// the defaults at the closest matching edition ordered at or before it should
+// be used.  This field must be in strict ascending order by edition.
+type FeatureSetDefaults_FeatureSetEditionDefault struct {
+	state         protoimpl.MessageState
+	sizeCache     protoimpl.SizeCache
+	unknownFields protoimpl.UnknownFields
+
+	Edition  *Edition    `protobuf:"varint,3,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"`
+	Features *FeatureSet `protobuf:"bytes,2,opt,name=features" json:"features,omitempty"`
+}
+
+func (x *FeatureSetDefaults_FeatureSetEditionDefault) Reset() {
+	*x = FeatureSetDefaults_FeatureSetEditionDefault{}
+	if protoimpl.UnsafeEnabled {
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[29]
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		ms.StoreMessageInfo(mi)
+	}
+}
+
+func (x *FeatureSetDefaults_FeatureSetEditionDefault) String() string {
+	return protoimpl.X.MessageStringOf(x)
+}
+
+func (*FeatureSetDefaults_FeatureSetEditionDefault) ProtoMessage() {}
+
+func (x *FeatureSetDefaults_FeatureSetEditionDefault) ProtoReflect() protoreflect.Message {
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[29]
+	if protoimpl.UnsafeEnabled && x != nil {
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		if ms.LoadMessageInfo() == nil {
+			ms.StoreMessageInfo(mi)
+		}
+		return ms
+	}
+	return mi.MessageOf(x)
+}
+
+// Deprecated: Use FeatureSetDefaults_FeatureSetEditionDefault.ProtoReflect.Descriptor instead.
+func (*FeatureSetDefaults_FeatureSetEditionDefault) Descriptor() ([]byte, []int) {
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20, 0}
+}
+
+func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetEdition() Edition {
+	if x != nil && x.Edition != nil {
+		return *x.Edition
+	}
+	return Edition_EDITION_UNKNOWN
+}
+
+func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetFeatures() *FeatureSet {
+	if x != nil {
+		return x.Features
+	}
+	return nil
+}
+
 type SourceCodeInfo_Location struct {
 	state         protoimpl.MessageState
 	sizeCache     protoimpl.SizeCache
@@ -3296,7 +4096,7 @@ type SourceCodeInfo_Location struct {
 	// location.
 	//
 	// Each element is a field number or an index.  They form a path from
-	// the root FileDescriptorProto to the place where the definition occurs.
+	// the root FileDescriptorProto to the place where the definition appears.
 	// For example, this path:
 	//
 	//	[ 4, 3, 2, 7, 1 ]
@@ -3388,7 +4188,7 @@ type SourceCodeInfo_Location struct {
 func (x *SourceCodeInfo_Location) Reset() {
 	*x = SourceCodeInfo_Location{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[26]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[30]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -3401,7 +4201,7 @@ func (x *SourceCodeInfo_Location) String() string {
 func (*SourceCodeInfo_Location) ProtoMessage() {}
 
 func (x *SourceCodeInfo_Location) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[26]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[30]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -3414,7 +4214,7 @@ func (x *SourceCodeInfo_Location) ProtoReflect() protoreflect.Message {
 
 // Deprecated: Use SourceCodeInfo_Location.ProtoReflect.Descriptor instead.
 func (*SourceCodeInfo_Location) Descriptor() ([]byte, []int) {
-	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 0}
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{21, 0}
 }
 
 func (x *SourceCodeInfo_Location) GetPath() []int32 {
@@ -3475,7 +4275,7 @@ type GeneratedCodeInfo_Annotation struct {
 func (x *GeneratedCodeInfo_Annotation) Reset() {
 	*x = GeneratedCodeInfo_Annotation{}
 	if protoimpl.UnsafeEnabled {
-		mi := &file_google_protobuf_descriptor_proto_msgTypes[27]
+		mi := &file_google_protobuf_descriptor_proto_msgTypes[31]
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		ms.StoreMessageInfo(mi)
 	}
@@ -3488,7 +4288,7 @@ func (x *GeneratedCodeInfo_Annotation) String() string {
 func (*GeneratedCodeInfo_Annotation) ProtoMessage() {}
 
 func (x *GeneratedCodeInfo_Annotation) ProtoReflect() protoreflect.Message {
-	mi := &file_google_protobuf_descriptor_proto_msgTypes[27]
+	mi := &file_google_protobuf_descriptor_proto_msgTypes[31]
 	if protoimpl.UnsafeEnabled && x != nil {
 		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
 		if ms.LoadMessageInfo() == nil {
@@ -3501,7 +4301,7 @@ func (x *GeneratedCodeInfo_Annotation) ProtoReflect() protoreflect.Message {
 
 // Deprecated: Use GeneratedCodeInfo_Annotation.ProtoReflect.Descriptor instead.
 func (*GeneratedCodeInfo_Annotation) Descriptor() ([]byte, []int) {
-	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{20, 0}
+	return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{22, 0}
 }
 
 func (x *GeneratedCodeInfo_Annotation) GetPath() []int32 {
@@ -3550,7 +4350,7 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{
 	0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
 	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73,
 	0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x04, 0x66, 0x69,
-	0x6c, 0x65, 0x22, 0xfe, 0x04, 0x0a, 0x13, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72,
+	0x6c, 0x65, 0x22, 0x98, 0x05, 0x0a, 0x13, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72,
 	0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61,
 	0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x18,
 	0x0a, 0x07, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52,
@@ -3588,250 +4388,250 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{
 	0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66,
 	0x6f, 0x52, 0x0e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66,
 	0x6f, 0x12, 0x16, 0x0a, 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x18, 0x0c, 0x20, 0x01, 0x28,
-	0x09, 0x52, 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x12, 0x18, 0x0a, 0x07, 0x65, 0x64, 0x69,
-	0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74,
-	0x69, 0x6f, 0x6e, 0x22, 0xb9, 0x06, 0x0a, 0x0f, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-	0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18,
-	0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x05, 0x66,
-	0x69, 0x65, 0x6c, 0x64, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f,
-	0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65,
-	0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74,
-	0x6f, 0x52, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x12, 0x43, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65,
-	0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f,
-	0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69,
-	0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f,
-	0x74, 0x6f, 0x52, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a,
-	0x0b, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x03,
-	0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74,
-	0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50,
-	0x72, 0x6f, 0x74, 0x6f, 0x52, 0x0a, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x54, 0x79, 0x70, 0x65,
-	0x12, 0x41, 0x0a, 0x09, 0x65, 0x6e, 0x75, 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20,
-	0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
-	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69,
-	0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54,
-	0x79, 0x70, 0x65, 0x12, 0x58, 0x0a, 0x0f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e,
-	0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67,
+	0x09, 0x52, 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69,
+	0x74, 0x69, 0x6f, 0x6e, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f,
+	0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69,
+	0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xb9, 0x06,
+	0x0a, 0x0f, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74,
+	0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52,
+	0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x02,
+	0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
+	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63,
+	0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05, 0x66, 0x69, 0x65,
+	0x6c, 0x64, 0x12, 0x43, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18,
+	0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
+	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73,
+	0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x09, 0x65, 0x78,
+	0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x0b, 0x6e, 0x65, 0x73, 0x74, 0x65,
+	0x64, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67,
 	0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44,
-	0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45,
-	0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0e, 0x65,
-	0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x44, 0x0a,
-	0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x64, 0x65, 0x63, 0x6c, 0x18, 0x08, 0x20, 0x03, 0x28,
-	0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
-	0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70,
-	0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x09, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x44,
-	0x65, 0x63, 0x6c, 0x12, 0x39, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07,
-	0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
-	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70,
-	0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55,
-	0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65,
-	0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
+	0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x0a,
+	0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x54, 0x79, 0x70, 0x65, 0x12, 0x41, 0x0a, 0x09, 0x65, 0x6e,
+	0x75, 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e,
+	0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e,
+	0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72,
+	0x6f, 0x74, 0x6f, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70, 0x65, 0x12, 0x58, 0x0a,
+	0x0f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65,
+	0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
 	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70,
-	0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65,
+	0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69,
+	0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69,
+	0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x44, 0x0a, 0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66,
+	0x5f, 0x64, 0x65, 0x63, 0x6c, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f,
+	0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e,
+	0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f,
+	0x74, 0x6f, 0x52, 0x09, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x63, 0x6c, 0x12, 0x39, 0x0a,
+	0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f,
+	0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66,
+	0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52,
+	0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65,
+	0x72, 0x76, 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b,
+	0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
+	0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f,
+	0x74, 0x6f, 0x2e, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65,
+	0x52, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12,
+	0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65,
+	0x18, 0x0a, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64,
+	0x4e, 0x61, 0x6d, 0x65, 0x1a, 0x7a, 0x0a, 0x0e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f,
+	0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18,
+	0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03,
+	0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x12, 0x40,
+	0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32,
+	0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75,
+	0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65,
+	0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
+	0x1a, 0x37, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67,
+	0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05,
+	0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02,
+	0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0xcc, 0x04, 0x0a, 0x15, 0x45, 0x78,
+	0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69,
+	0x6f, 0x6e, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72,
+	0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03,
+	0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74,
+	0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74,
+	0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65,
+	0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x59, 0x0a,
+	0x0b, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x03,
+	0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74,
+	0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61,
+	0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x44, 0x65, 0x63, 0x6c, 0x61,
+	0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0x88, 0x01, 0x02, 0x52, 0x0b, 0x64, 0x65, 0x63,
+	0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74,
+	0x75, 0x72, 0x65, 0x73, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f,
+	0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61,
+	0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65,
+	0x73, 0x12, 0x6d, 0x0a, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f,
+	0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65,
+	0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73,
+	0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e,
+	0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74,
+	0x65, 0x3a, 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x42, 0x03, 0x88,
+	0x01, 0x02, 0x52, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
+	0x1a, 0x94, 0x01, 0x0a, 0x0b, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e,
+	0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05,
+	0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x66, 0x75, 0x6c, 0x6c,
+	0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x66, 0x75, 0x6c,
+	0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20,
+	0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x73,
+	0x65, 0x72, 0x76, 0x65, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x73,
+	0x65, 0x72, 0x76, 0x65, 0x64, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65,
+	0x64, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65,
+	0x64, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x22, 0x34, 0x0a, 0x11, 0x56, 0x65, 0x72, 0x69, 0x66,
+	0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x0f, 0x0a, 0x0b,
+	0x44, 0x45, 0x43, 0x4c, 0x41, 0x52, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x10, 0x00, 0x12, 0x0e, 0x0a,
+	0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x01, 0x2a, 0x09, 0x08,
+	0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xc1, 0x06, 0x0a, 0x14, 0x46, 0x69, 0x65,
+	0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74,
+	0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52,
+	0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18,
+	0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x41, 0x0a,
+	0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67,
+	0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46,
+	0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72,
+	0x6f, 0x74, 0x6f, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x52, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c,
+	0x12, 0x3e, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a,
+	0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66,
+	0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72,
+	0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65,
+	0x12, 0x1b, 0x0a, 0x09, 0x74, 0x79, 0x70, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20,
+	0x01, 0x28, 0x09, 0x52, 0x08, 0x74, 0x79, 0x70, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a,
+	0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52,
+	0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, 0x66,
+	0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09,
+	0x52, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f,
+	0x0a, 0x0b, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x18, 0x09, 0x20,
+	0x01, 0x28, 0x05, 0x52, 0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x49, 0x6e, 0x64, 0x65, 0x78, 0x12,
+	0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x01,
+	0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07,
+	0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e,
+	0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e,
+	0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70,
+	0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x27, 0x0a, 0x0f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x5f,
+	0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x18, 0x11, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0e,
+	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x22, 0xb6,
+	0x02, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f,
+	0x44, 0x4f, 0x55, 0x42, 0x4c, 0x45, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45,
+	0x5f, 0x46, 0x4c, 0x4f, 0x41, 0x54, 0x10, 0x02, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45,
+	0x5f, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x03, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45,
+	0x5f, 0x55, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x04, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50,
+	0x45, 0x5f, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x05, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50,
+	0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, 0x34, 0x10, 0x06, 0x12, 0x10, 0x0a, 0x0c, 0x54,
+	0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32, 0x10, 0x07, 0x12, 0x0d, 0x0a,
+	0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, 0x4f, 0x4f, 0x4c, 0x10, 0x08, 0x12, 0x0f, 0x0a, 0x0b,
+	0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x09, 0x12, 0x0e, 0x0a,
+	0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x52, 0x4f, 0x55, 0x50, 0x10, 0x0a, 0x12, 0x10, 0x0a,
+	0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x0b, 0x12,
+	0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x0c, 0x12,
+	0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x0d,
+	0x12, 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x0e, 0x12,
+	0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32,
+	0x10, 0x0f, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45,
+	0x44, 0x36, 0x34, 0x10, 0x10, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49,
+	0x4e, 0x54, 0x33, 0x32, 0x10, 0x11, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53,
+	0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x12, 0x22, 0x43, 0x0a, 0x05, 0x4c, 0x61, 0x62, 0x65, 0x6c,
+	0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e,
+	0x41, 0x4c, 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x52, 0x45,
+	0x50, 0x45, 0x41, 0x54, 0x45, 0x44, 0x10, 0x03, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45,
+	0x4c, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x49, 0x52, 0x45, 0x44, 0x10, 0x02, 0x22, 0x63, 0x0a, 0x14,
+	0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50,
+	0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01,
+	0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69,
+	0x6f, 0x6e, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67,
+	0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f,
+	0x66, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
+	0x73, 0x22, 0xe3, 0x02, 0x0a, 0x13, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69,
+	0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d,
+	0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3f, 0x0a,
+	0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67,
+	0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45,
+	0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
+	0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x36,
+	0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32,
+	0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75,
+	0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f,
+	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5d, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76,
+	0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36,
+	0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66,
+	0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50,
+	0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65,
 	0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64,
 	0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65,
-	0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65,
-	0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0x7a, 0x0a, 0x0e, 0x45, 0x78,
-	0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05,
-	0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61,
-	0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52,
-	0x03, 0x65, 0x6e, 0x64, 0x12, 0x40, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18,
-	0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
-	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f,
-	0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f,
-	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x37, 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76,
-	0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74,
-	0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a,
-	0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22,
-	0xad, 0x04, 0x0a, 0x15, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e,
-	0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69,
-	0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f,
-	0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
-	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74,
-	0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13,
-	0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x12, 0x59, 0x0a, 0x0b, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69,
-	0x6f, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
-	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e,
-	0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-	0x2e, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0x88, 0x01,
-	0x02, 0x52, 0x0b, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x68,
-	0x0a, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03,
-	0x20, 0x01, 0x28, 0x0e, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
-	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e,
-	0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x56, 0x65, 0x72,
-	0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x3a, 0x0a,
-	0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x52, 0x0c, 0x76, 0x65, 0x72, 0x69,
-	0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xb3, 0x01, 0x0a, 0x0b, 0x44, 0x65, 0x63,
-	0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62,
-	0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72,
-	0x12, 0x1b, 0x0a, 0x09, 0x66, 0x75, 0x6c, 0x6c, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20,
-	0x01, 0x28, 0x09, 0x52, 0x08, 0x66, 0x75, 0x6c, 0x6c, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a,
-	0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70,
-	0x65, 0x12, 0x23, 0x0a, 0x0b, 0x69, 0x73, 0x5f, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64,
-	0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x0a, 0x69, 0x73, 0x52, 0x65,
-	0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76,
-	0x65, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76,
-	0x65, 0x64, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x18, 0x06,
-	0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x22, 0x34,
-	0x0a, 0x11, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74,
-	0x61, 0x74, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x44, 0x45, 0x43, 0x4c, 0x41, 0x52, 0x41, 0x54, 0x49,
-	0x4f, 0x4e, 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49,
-	0x45, 0x44, 0x10, 0x01, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22,
-	0xc1, 0x06, 0x0a, 0x14, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70,
-	0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65,
-	0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06,
-	0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75,
-	0x6d, 0x62, 0x65, 0x72, 0x12, 0x41, 0x0a, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x04, 0x20,
-	0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
-	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72,
-	0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c,
-	0x52, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x3e, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18,
-	0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
-	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73,
-	0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x54, 0x79, 0x70,
-	0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x1b, 0x0a, 0x09, 0x74, 0x79, 0x70, 0x65, 0x5f,
-	0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x74, 0x79, 0x70, 0x65,
-	0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65,
-	0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65,
-	0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75,
-	0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74,
-	0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x69,
-	0x6e, 0x64, 0x65, 0x78, 0x18, 0x09, 0x20, 0x01, 0x28, 0x05, 0x52, 0x0a, 0x6f, 0x6e, 0x65, 0x6f,
-	0x66, 0x49, 0x6e, 0x64, 0x65, 0x78, 0x12, 0x1b, 0x0a, 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6e,
-	0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x4e,
-	0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08,
-	0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
-	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69,
-	0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x27, 0x0a, 0x0f,
-	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x18,
-	0x11, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x22, 0xb6, 0x02, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0f,
-	0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x44, 0x4f, 0x55, 0x42, 0x4c, 0x45, 0x10, 0x01, 0x12,
-	0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x4c, 0x4f, 0x41, 0x54, 0x10, 0x02, 0x12,
-	0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x03, 0x12,
-	0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x04,
-	0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x05,
-	0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, 0x34,
-	0x10, 0x06, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44,
-	0x33, 0x32, 0x10, 0x07, 0x12, 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, 0x4f, 0x4f,
-	0x4c, 0x10, 0x08, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x54, 0x52, 0x49,
-	0x4e, 0x47, 0x10, 0x09, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x47, 0x52, 0x4f,
-	0x55, 0x50, 0x10, 0x0a, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53,
-	0x53, 0x41, 0x47, 0x45, 0x10, 0x0b, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42,
-	0x59, 0x54, 0x45, 0x53, 0x10, 0x0c, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55,
-	0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x0d, 0x12, 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f,
-	0x45, 0x4e, 0x55, 0x4d, 0x10, 0x0e, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53,
-	0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32, 0x10, 0x0f, 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50,
-	0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, 0x34, 0x10, 0x10, 0x12, 0x0f, 0x0a, 0x0b,
-	0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x11, 0x12, 0x0f, 0x0a,
-	0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x12, 0x22, 0x43,
-	0x0a, 0x05, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c,
-	0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x41, 0x4c, 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, 0x4c,
-	0x41, 0x42, 0x45, 0x4c, 0x5f, 0x52, 0x45, 0x51, 0x55, 0x49, 0x52, 0x45, 0x44, 0x10, 0x02, 0x12,
-	0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x52, 0x45, 0x50, 0x45, 0x41, 0x54, 0x45,
-	0x44, 0x10, 0x03, 0x22, 0x63, 0x0a, 0x14, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63,
-	0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e,
-	0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12,
-	0x37, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b,
-	0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
-	0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52,
-	0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xe3, 0x02, 0x0a, 0x13, 0x45, 0x6e, 0x75,
-	0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f,
-	0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04,
-	0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3f, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20,
-	0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
-	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44,
-	0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05,
-	0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x36, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-	0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
-	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5d, 0x0a,
-	0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18,
-	0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
-	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63,
-	0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, 0x6e, 0x75, 0x6d,
-	0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0d, 0x72,
-	0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x23, 0x0a, 0x0d,
-	0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20,
-	0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, 0x6d,
-	0x65, 0x1a, 0x3b, 0x0a, 0x11, 0x45, 0x6e, 0x75, 0x6d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65,
-	0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18,
-	0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03,
-	0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0x83,
-	0x01, 0x0a, 0x18, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63,
-	0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e,
-	0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12,
-	0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52,
-	0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x3b, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f,
-	0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
-	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x56,
-	0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa7, 0x01, 0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65,
-	0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12,
-	0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e,
-	0x61, 0x6d, 0x65, 0x12, 0x3e, 0x0a, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x18, 0x02, 0x20,
-	0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
-	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63,
-	0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x06, 0x6d, 0x65, 0x74,
-	0x68, 0x6f, 0x64, 0x12, 0x39, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03,
-	0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
-	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70,
-	0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x89,
-	0x02, 0x0a, 0x15, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70,
+	0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65,
+	0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0x3b, 0x0a, 0x11, 0x45, 0x6e,
+	0x75, 0x6d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12,
+	0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05,
+	0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01,
+	0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0x83, 0x01, 0x0a, 0x18, 0x45, 0x6e, 0x75, 0x6d,
+	0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50,
+	0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01,
+	0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62,
+	0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72,
+	0x12, 0x3b, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28,
+	0x0b, 0x32, 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
+	0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74,
+	0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa7, 0x01,
+	0x0a, 0x16, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70,
 	0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65,
-	0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1d, 0x0a, 0x0a,
-	0x69, 0x6e, 0x70, 0x75, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09,
-	0x52, 0x09, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6f,
-	0x75, 0x74, 0x70, 0x75, 0x74, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09,
-	0x52, 0x0a, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x38, 0x0a, 0x07,
-	0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e,
+	0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3e, 0x0a, 0x06,
+	0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67,
+	0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d,
+	0x65, 0x74, 0x68, 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50,
+	0x72, 0x6f, 0x74, 0x6f, 0x52, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x39, 0x0a, 0x07,
+	0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e,
 	0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e,
-	0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f,
-	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x30, 0x0a, 0x10, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74,
-	0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08,
-	0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53,
-	0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x12, 0x30, 0x0a, 0x10, 0x73, 0x65, 0x72, 0x76,
-	0x65, 0x72, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x18, 0x06, 0x20, 0x01,
-	0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x65,
-	0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x22, 0x91, 0x09, 0x0a, 0x0b, 0x46,
-	0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x6a, 0x61,
-	0x76, 0x61, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09,
-	0x52, 0x0b, 0x6a, 0x61, 0x76, 0x61, 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x30, 0x0a,
-	0x14, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6f, 0x75, 0x74, 0x65, 0x72, 0x5f, 0x63, 0x6c, 0x61, 0x73,
-	0x73, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x6a, 0x61, 0x76,
-	0x61, 0x4f, 0x75, 0x74, 0x65, 0x72, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x12,
-	0x35, 0x0a, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65,
-	0x5f, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61,
-	0x6c, 0x73, 0x65, 0x52, 0x11, 0x6a, 0x61, 0x76, 0x61, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c,
-	0x65, 0x46, 0x69, 0x6c, 0x65, 0x73, 0x12, 0x44, 0x0a, 0x1d, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67,
-	0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x5f, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x73, 0x5f, 0x61,
-	0x6e, 0x64, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x18, 0x14, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18,
-	0x01, 0x52, 0x19, 0x6a, 0x61, 0x76, 0x61, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x45,
-	0x71, 0x75, 0x61, 0x6c, 0x73, 0x41, 0x6e, 0x64, 0x48, 0x61, 0x73, 0x68, 0x12, 0x3a, 0x0a, 0x16,
-	0x6a, 0x61, 0x76, 0x61, 0x5f, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x68, 0x65, 0x63,
-	0x6b, 0x5f, 0x75, 0x74, 0x66, 0x38, 0x18, 0x1b, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61,
-	0x6c, 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x43,
-	0x68, 0x65, 0x63, 0x6b, 0x55, 0x74, 0x66, 0x38, 0x12, 0x53, 0x0a, 0x0c, 0x6f, 0x70, 0x74, 0x69,
-	0x6d, 0x69, 0x7a, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29,
-	0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66,
-	0x2e, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74,
-	0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64, 0x65, 0x3a, 0x05, 0x53, 0x50, 0x45, 0x45, 0x44,
-	0x52, 0x0b, 0x6f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x46, 0x6f, 0x72, 0x12, 0x1d, 0x0a,
-	0x0a, 0x67, 0x6f, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28,
-	0x09, 0x52, 0x09, 0x67, 0x6f, 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x35, 0x0a, 0x13,
-	0x63, 0x63, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69,
-	0x63, 0x65, 0x73, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65,
-	0x52, 0x11, 0x63, 0x63, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69,
-	0x63, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x15, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65,
-	0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x11, 0x20, 0x01,
-	0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x47,
-	0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x35,
-	0x0a, 0x13, 0x70, 0x79, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72,
-	0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x12, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c,
-	0x73, 0x65, 0x52, 0x11, 0x70, 0x79, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72,
-	0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x37, 0x0a, 0x14, 0x70, 0x68, 0x70, 0x5f, 0x67, 0x65, 0x6e,
-	0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x2a, 0x20,
-	0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x12, 0x70, 0x68, 0x70, 0x47,
+	0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07,
+	0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x89, 0x02, 0x0a, 0x15, 0x4d, 0x65, 0x74, 0x68,
+	0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74,
+	0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52,
+	0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x5f, 0x74,
+	0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x69, 0x6e, 0x70, 0x75, 0x74,
+	0x54, 0x79, 0x70, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x5f, 0x74,
+	0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x6f, 0x75, 0x74, 0x70, 0x75,
+	0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x38, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
+	0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
+	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f,
+	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12,
+	0x30, 0x0a, 0x10, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d,
+	0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65,
+	0x52, 0x0f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e,
+	0x67, 0x12, 0x30, 0x0a, 0x10, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x5f, 0x73, 0x74, 0x72, 0x65,
+	0x61, 0x6d, 0x69, 0x6e, 0x67, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c,
+	0x73, 0x65, 0x52, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d,
+	0x69, 0x6e, 0x67, 0x22, 0x97, 0x09, 0x0a, 0x0b, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69,
+	0x6f, 0x6e, 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x70, 0x61, 0x63, 0x6b,
+	0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6a, 0x61, 0x76, 0x61, 0x50,
+	0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x30, 0x0a, 0x14, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6f,
+	0x75, 0x74, 0x65, 0x72, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x08,
+	0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x6a, 0x61, 0x76, 0x61, 0x4f, 0x75, 0x74, 0x65, 0x72, 0x43,
+	0x6c, 0x61, 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x35, 0x0a, 0x13, 0x6a, 0x61, 0x76, 0x61,
+	0x5f, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x18,
+	0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x6a, 0x61,
+	0x76, 0x61, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x46, 0x69, 0x6c, 0x65, 0x73, 0x12,
+	0x44, 0x0a, 0x1d, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65,
+	0x5f, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x73, 0x5f, 0x61, 0x6e, 0x64, 0x5f, 0x68, 0x61, 0x73, 0x68,
+	0x18, 0x14, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x19, 0x6a, 0x61, 0x76, 0x61,
+	0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x45, 0x71, 0x75, 0x61, 0x6c, 0x73, 0x41, 0x6e,
+	0x64, 0x48, 0x61, 0x73, 0x68, 0x12, 0x3a, 0x0a, 0x16, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x73, 0x74,
+	0x72, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x75, 0x74, 0x66, 0x38, 0x18,
+	0x1b, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61,
+	0x76, 0x61, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x55, 0x74, 0x66,
+	0x38, 0x12, 0x53, 0x0a, 0x0c, 0x6f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x5f, 0x66, 0x6f,
+	0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65,
+	0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70,
+	0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f,
+	0x64, 0x65, 0x3a, 0x05, 0x53, 0x50, 0x45, 0x45, 0x44, 0x52, 0x0b, 0x6f, 0x70, 0x74, 0x69, 0x6d,
+	0x69, 0x7a, 0x65, 0x46, 0x6f, 0x72, 0x12, 0x1d, 0x0a, 0x0a, 0x67, 0x6f, 0x5f, 0x70, 0x61, 0x63,
+	0x6b, 0x61, 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x67, 0x6f, 0x50, 0x61,
+	0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x35, 0x0a, 0x13, 0x63, 0x63, 0x5f, 0x67, 0x65, 0x6e, 0x65,
+	0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x10, 0x20, 0x01,
+	0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x63, 0x63, 0x47, 0x65, 0x6e,
+	0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x15,
+	0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72,
+	0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x11, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c,
+	0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53,
+	0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x13, 0x70, 0x79, 0x5f, 0x67, 0x65,
+	0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x12,
+	0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x70, 0x79, 0x47,
 	0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x25,
 	0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x17, 0x20, 0x01,
 	0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65,
@@ -3856,259 +4656,419 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{
 	0x70, 0x68, 0x70, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4e, 0x61, 0x6d, 0x65, 0x73,
 	0x70, 0x61, 0x63, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x72, 0x75, 0x62, 0x79, 0x5f, 0x70, 0x61, 0x63,
 	0x6b, 0x61, 0x67, 0x65, 0x18, 0x2d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x72, 0x75, 0x62, 0x79,
-	0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74,
-	0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18,
-	0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
-	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72,
-	0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e,
-	0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f,
-	0x6e, 0x22, 0x3a, 0x0a, 0x0c, 0x4f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64,
-	0x65, 0x12, 0x09, 0x0a, 0x05, 0x53, 0x50, 0x45, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09,
-	0x43, 0x4f, 0x44, 0x45, 0x5f, 0x53, 0x49, 0x5a, 0x45, 0x10, 0x02, 0x12, 0x10, 0x0a, 0x0c, 0x4c,
-	0x49, 0x54, 0x45, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x03, 0x2a, 0x09, 0x08,
-	0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x26, 0x10, 0x27, 0x22, 0xbb,
-	0x03, 0x0a, 0x0e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
-	0x73, 0x12, 0x3c, 0x0a, 0x17, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x65, 0x74,
-	0x5f, 0x77, 0x69, 0x72, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x01, 0x20, 0x01,
-	0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x14, 0x6d, 0x65, 0x73, 0x73, 0x61,
-	0x67, 0x65, 0x53, 0x65, 0x74, 0x57, 0x69, 0x72, 0x65, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12,
-	0x4c, 0x0a, 0x1f, 0x6e, 0x6f, 0x5f, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x5f, 0x64,
-	0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73,
-	0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52,
-	0x1c, 0x6e, 0x6f, 0x53, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72,
-	0x69, 0x70, 0x74, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x12, 0x25, 0x0a,
-	0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28,
-	0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63,
-	0x61, 0x74, 0x65, 0x64, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x61, 0x70, 0x5f, 0x65, 0x6e, 0x74, 0x72,
-	0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x6d, 0x61, 0x70, 0x45, 0x6e, 0x74, 0x72,
-	0x79, 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f,
-	0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c,
-	0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28,
-	0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65,
-	0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64,
-	0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69,
-	0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f,
-	0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
-	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74,
-	0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13,
-	0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04,
-	0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x4a, 0x04, 0x08, 0x06, 0x10, 0x07,
-	0x4a, 0x04, 0x08, 0x08, 0x10, 0x09, 0x4a, 0x04, 0x08, 0x09, 0x10, 0x0a, 0x22, 0x85, 0x09, 0x0a,
-	0x0c, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x41, 0x0a,
-	0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x23, 0x2e, 0x67,
-	0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46,
-	0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x43, 0x54, 0x79, 0x70,
-	0x65, 0x3a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x52, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65,
-	0x12, 0x16, 0x0a, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08,
-	0x52, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, 0x12, 0x47, 0x0a, 0x06, 0x6a, 0x73, 0x74, 0x79,
-	0x70, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
-	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64,
-	0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x09,
-	0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x52, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70,
-	0x65, 0x12, 0x19, 0x0a, 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a,
-	0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x12, 0x2e, 0x0a, 0x0f,
-	0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, 0x5f, 0x6c, 0x61, 0x7a, 0x79, 0x18,
-	0x0f, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0e, 0x75, 0x6e,
-	0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, 0x4c, 0x61, 0x7a, 0x79, 0x12, 0x25, 0x0a, 0x0a,
+	0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75,
+	0x72, 0x65, 0x73, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67,
+	0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74,
+	0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73,
+	0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65,
+	0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32,
+	0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75,
+	0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f,
+	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72,
+	0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x3a, 0x0a, 0x0c, 0x4f, 0x70,
+	0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64, 0x65, 0x12, 0x09, 0x0a, 0x05, 0x53, 0x50,
+	0x45, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x43, 0x4f, 0x44, 0x45, 0x5f, 0x53, 0x49,
+	0x5a, 0x45, 0x10, 0x02, 0x12, 0x10, 0x0a, 0x0c, 0x4c, 0x49, 0x54, 0x45, 0x5f, 0x52, 0x55, 0x4e,
+	0x54, 0x49, 0x4d, 0x45, 0x10, 0x03, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80,
+	0x02, 0x4a, 0x04, 0x08, 0x2a, 0x10, 0x2b, 0x4a, 0x04, 0x08, 0x26, 0x10, 0x27, 0x22, 0xf4, 0x03,
+	0x0a, 0x0e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
+	0x12, 0x3c, 0x0a, 0x17, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x65, 0x74, 0x5f,
+	0x77, 0x69, 0x72, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28,
+	0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x14, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67,
+	0x65, 0x53, 0x65, 0x74, 0x57, 0x69, 0x72, 0x65, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x4c,
+	0x0a, 0x1f, 0x6e, 0x6f, 0x5f, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65,
+	0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f,
+	0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x1c,
+	0x6e, 0x6f, 0x53, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69,
+	0x70, 0x74, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x12, 0x25, 0x0a, 0x0a,
 	0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08,
 	0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61,
-	0x74, 0x65, 0x64, 0x12, 0x19, 0x0a, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28,
-	0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x12, 0x28,
-	0x0a, 0x0c, 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x10,
-	0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62,
-	0x75, 0x67, 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x4b, 0x0a, 0x09, 0x72, 0x65, 0x74, 0x65,
-	0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2d, 0x2e, 0x67, 0x6f,
-	0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69,
-	0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f,
-	0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x72, 0x65, 0x74, 0x65,
-	0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4a, 0x0a, 0x06, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x18,
-	0x12, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
-	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65,
-	0x74, 0x54, 0x79, 0x70, 0x65, 0x42, 0x02, 0x18, 0x01, 0x52, 0x06, 0x74, 0x61, 0x72, 0x67, 0x65,
-	0x74, 0x12, 0x48, 0x0a, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x18, 0x13, 0x20, 0x03,
-	0x28, 0x0e, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74,
-	0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
-	0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79,
-	0x70, 0x65, 0x52, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75,
-	0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f,
-	0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69,
-	0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
-	0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f,
-	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x2f, 0x0a, 0x05, 0x43, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a,
-	0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x43, 0x4f,
-	0x52, 0x44, 0x10, 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x50,
-	0x49, 0x45, 0x43, 0x45, 0x10, 0x02, 0x22, 0x35, 0x0a, 0x06, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65,
-	0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x10, 0x00, 0x12,
-	0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0d,
-	0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x55, 0x4d, 0x42, 0x45, 0x52, 0x10, 0x02, 0x22, 0x55, 0x0a,
-	0x0f, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e,
-	0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e,
-	0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e,
-	0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x01, 0x12, 0x14,
-	0x0a, 0x10, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x4f, 0x55, 0x52,
-	0x43, 0x45, 0x10, 0x02, 0x22, 0x8c, 0x02, 0x0a, 0x10, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54,
-	0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52,
-	0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e,
-	0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50,
-	0x45, 0x5f, 0x46, 0x49, 0x4c, 0x45, 0x10, 0x01, 0x12, 0x1f, 0x0a, 0x1b, 0x54, 0x41, 0x52, 0x47,
-	0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x58, 0x54, 0x45, 0x4e, 0x53, 0x49, 0x4f,
-	0x4e, 0x5f, 0x52, 0x41, 0x4e, 0x47, 0x45, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52,
-	0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45,
-	0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50,
-	0x45, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52,
-	0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4f, 0x4e, 0x45, 0x4f, 0x46, 0x10, 0x05,
-	0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f,
-	0x45, 0x4e, 0x55, 0x4d, 0x10, 0x06, 0x12, 0x1a, 0x0a, 0x16, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54,
-	0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59,
-	0x10, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50,
-	0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x10, 0x08, 0x12, 0x16, 0x0a, 0x12, 0x54,
-	0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x54, 0x48, 0x4f,
-	0x44, 0x10, 0x09, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04,
-	0x08, 0x04, 0x10, 0x05, 0x22, 0x73, 0x0a, 0x0c, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70,
-	0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20,
-	0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
-	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65,
-	0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74,
-	0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09,
-	0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x98, 0x02, 0x0a, 0x0b, 0x45, 0x6e,
-	0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x6c, 0x6c,
-	0x6f, 0x77, 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a,
-	0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41, 0x6c, 0x69, 0x61, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65,
-	0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05,
-	0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65,
-	0x64, 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f,
-	0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c,
-	0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28,
-	0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65,
-	0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64,
-	0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69,
+	0x74, 0x65, 0x64, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x61, 0x70, 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x79,
+	0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x6d, 0x61, 0x70, 0x45, 0x6e, 0x74, 0x72, 0x79,
+	0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c,
+	0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64,
+	0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08,
+	0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64,
+	0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43,
+	0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74,
+	0x75, 0x72, 0x65, 0x73, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f,
+	0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61,
+	0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65,
+	0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74,
+	0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b,
+	0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
+	0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64,
+	0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70,
+	0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07,
+	0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, 0x08, 0x05,
+	0x10, 0x06, 0x4a, 0x04, 0x08, 0x06, 0x10, 0x07, 0x4a, 0x04, 0x08, 0x08, 0x10, 0x09, 0x4a, 0x04,
+	0x08, 0x09, 0x10, 0x0a, 0x22, 0xad, 0x0a, 0x0a, 0x0c, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70,
+	0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x41, 0x0a, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01,
+	0x20, 0x01, 0x28, 0x0e, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
+	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69,
+	0x6f, 0x6e, 0x73, 0x2e, 0x43, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e,
+	0x47, 0x52, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x61, 0x63, 0x6b,
+	0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64,
+	0x12, 0x47, 0x0a, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e,
+	0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
+	0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e,
+	0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41,
+	0x4c, 0x52, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x12, 0x19, 0x0a, 0x04, 0x6c, 0x61, 0x7a,
+	0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04,
+	0x6c, 0x61, 0x7a, 0x79, 0x12, 0x2e, 0x0a, 0x0f, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69,
+	0x65, 0x64, 0x5f, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66,
+	0x61, 0x6c, 0x73, 0x65, 0x52, 0x0e, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64,
+	0x4c, 0x61, 0x7a, 0x79, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74,
+	0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52,
+	0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x19, 0x0a, 0x04, 0x77,
+	0x65, 0x61, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65,
+	0x52, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x12, 0x28, 0x0a, 0x0c, 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f,
+	0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61,
+	0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67, 0x52, 0x65, 0x64, 0x61, 0x63, 0x74,
+	0x12, 0x4b, 0x0a, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x11, 0x20,
+	0x01, 0x28, 0x0e, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
+	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f,
+	0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69,
+	0x6f, 0x6e, 0x52, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a,
+	0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x18, 0x13, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x2e,
+	0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66,
+	0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70,
+	0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x07,
+	0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x12, 0x57, 0x0a, 0x10, 0x65, 0x64, 0x69, 0x74, 0x69,
+	0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, 0x14, 0x20, 0x03, 0x28,
+	0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
+	0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
+	0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x52,
+	0x0f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73,
+	0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x15, 0x20, 0x01,
+	0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74,
+	0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52,
+	0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69,
 	0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f,
 	0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
 	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74,
 	0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13,
 	0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04,
-	0x08, 0x05, 0x10, 0x06, 0x22, 0x9e, 0x01, 0x0a, 0x10, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c,
-	0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70,
-	0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66,
-	0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64,
-	0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65,
-	0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32,
-	0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75,
-	0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f,
-	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72,
-	0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10,
-	0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x9c, 0x01, 0x0a, 0x0e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63,
-	0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72,
-	0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61,
-	0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12,
-	0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64,
-	0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24,
-	0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66,
-	0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70,
-	0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65,
-	0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80,
-	0x80, 0x80, 0x80, 0x02, 0x22, 0xe0, 0x02, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f,
-	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63,
-	0x61, 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73,
-	0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x71, 0x0a,
-	0x11, 0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x5f, 0x6c, 0x65, 0x76,
-	0x65, 0x6c, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
-	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f,
-	0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74,
-	0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x3a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50,
-	0x4f, 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x52, 0x10,
-	0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c,
-	0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65,
-	0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32,
-	0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75,
-	0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f,
-	0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72,
-	0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x50, 0x0a, 0x10, 0x49, 0x64,
-	0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x17,
-	0x0a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e,
-	0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x4e, 0x4f, 0x5f, 0x53, 0x49,
-	0x44, 0x45, 0x5f, 0x45, 0x46, 0x46, 0x45, 0x43, 0x54, 0x53, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a,
-	0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x54, 0x10, 0x02, 0x2a, 0x09, 0x08, 0xe8,
-	0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x9a, 0x03, 0x0a, 0x13, 0x55, 0x6e, 0x69, 0x6e,
-	0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12,
-	0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e,
+	0x69, 0x6f, 0x6e, 0x1a, 0x5a, 0x0a, 0x0e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65,
+	0x66, 0x61, 0x75, 0x6c, 0x74, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
+	0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
+	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
+	0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c,
+	0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22,
+	0x2f, 0x0a, 0x05, 0x43, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49,
+	0x4e, 0x47, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x43, 0x4f, 0x52, 0x44, 0x10, 0x01, 0x12, 0x10,
+	0x0a, 0x0c, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x50, 0x49, 0x45, 0x43, 0x45, 0x10, 0x02,
+	0x22, 0x35, 0x0a, 0x06, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53,
+	0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x10, 0x00, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f,
+	0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e,
+	0x55, 0x4d, 0x42, 0x45, 0x52, 0x10, 0x02, 0x22, 0x55, 0x0a, 0x0f, 0x4f, 0x70, 0x74, 0x69, 0x6f,
+	0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45,
+	0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10,
+	0x00, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x52,
+	0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x01, 0x12, 0x14, 0x0a, 0x10, 0x52, 0x45, 0x54, 0x45,
+	0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x10, 0x02, 0x22, 0x8c,
+	0x02, 0x0a, 0x10, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54,
+	0x79, 0x70, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59,
+	0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10,
+	0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x4c, 0x45,
+	0x10, 0x01, 0x12, 0x1f, 0x0a, 0x1b, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50,
+	0x45, 0x5f, 0x45, 0x58, 0x54, 0x45, 0x4e, 0x53, 0x49, 0x4f, 0x4e, 0x5f, 0x52, 0x41, 0x4e, 0x47,
+	0x45, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59,
+	0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11,
+	0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x45, 0x4c,
+	0x44, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59,
+	0x50, 0x45, 0x5f, 0x4f, 0x4e, 0x45, 0x4f, 0x46, 0x10, 0x05, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41,
+	0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x06,
+	0x12, 0x1a, 0x0a, 0x16, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f,
+	0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, 0x10, 0x07, 0x12, 0x17, 0x0a, 0x13,
+	0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56,
+	0x49, 0x43, 0x45, 0x10, 0x08, 0x12, 0x16, 0x0a, 0x12, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f,
+	0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x10, 0x09, 0x2a, 0x09, 0x08,
+	0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04,
+	0x08, 0x12, 0x10, 0x13, 0x22, 0xac, 0x01, 0x0a, 0x0c, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70,
+	0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65,
+	0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65,
+	0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72,
+	0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58,
+	0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f,
+	0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e,
 	0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e,
 	0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74,
-	0x69, 0x6f, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x52, 0x04, 0x6e, 0x61,
-	0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72,
-	0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x69, 0x64,
-	0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a,
-	0x12, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61,
-	0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x04, 0x52, 0x10, 0x70, 0x6f, 0x73, 0x69, 0x74,
-	0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x6e,
-	0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75,
-	0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76,
-	0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x6f, 0x75,
-	0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x01, 0x52,
-	0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c,
-	0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01,
-	0x28, 0x0c, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12,
-	0x27, 0x0a, 0x0f, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x5f, 0x76, 0x61, 0x6c,
-	0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67,
-	0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0x4a, 0x0a, 0x08, 0x4e, 0x61, 0x6d, 0x65,
-	0x50, 0x61, 0x72, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x70, 0x61, 0x72,
-	0x74, 0x18, 0x01, 0x20, 0x02, 0x28, 0x09, 0x52, 0x08, 0x6e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72,
-	0x74, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x73, 0x5f, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f,
-	0x6e, 0x18, 0x02, 0x20, 0x02, 0x28, 0x08, 0x52, 0x0b, 0x69, 0x73, 0x45, 0x78, 0x74, 0x65, 0x6e,
-	0x73, 0x69, 0x6f, 0x6e, 0x22, 0xa7, 0x02, 0x0a, 0x0e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43,
-	0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x44, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74,
-	0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67,
-	0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72,
-	0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x74,
-	0x69, 0x6f, 0x6e, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xce, 0x01,
-	0x0a, 0x08, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61,
-	0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61,
-	0x74, 0x68, 0x12, 0x16, 0x0a, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x05,
-	0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x12, 0x29, 0x0a, 0x10, 0x6c, 0x65,
-	0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x03,
-	0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d,
-	0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2b, 0x0a, 0x11, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e,
-	0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09,
-	0x52, 0x10, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e,
-	0x74, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65,
-	0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18,
-	0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x17, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x44, 0x65,
-	0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, 0xd0,
-	0x02, 0x0a, 0x11, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65,
-	0x49, 0x6e, 0x66, 0x6f, 0x12, 0x4d, 0x0a, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69,
-	0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
-	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72,
-	0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e,
-	0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74,
-	0x69, 0x6f, 0x6e, 0x1a, 0xeb, 0x01, 0x0a, 0x0a, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69,
+	0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74,
+	0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80,
+	0x80, 0x80, 0x02, 0x22, 0xd1, 0x02, 0x0a, 0x0b, 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69,
+	0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x61, 0x6c, 0x69,
+	0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41,
+	0x6c, 0x69, 0x61, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74,
+	0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52,
+	0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x56, 0x0a, 0x26, 0x64,
+	0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79,
+	0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66,
+	0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52,
+	0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63,
+	0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69,
+	0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18,
+	0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
+	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53,
+	0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14,
+	0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70,
+	0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f,
+	0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e,
+	0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f,
+	0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64,
+	0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80,
+	0x02, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x22, 0x81, 0x02, 0x0a, 0x10, 0x45, 0x6e, 0x75, 0x6d,
+	0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a,
+	0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08,
+	0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61,
+	0x74, 0x65, 0x64, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18,
+	0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
+	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53,
+	0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x28, 0x0a, 0x0c,
+	0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01,
+	0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67,
+	0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65,
+	0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7,
+	0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
+	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70,
+	0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69,
+	0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
+	0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xd5, 0x01, 0x0a, 0x0e,
+	0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37,
+	0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0b,
+	0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
+	0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66,
+	0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65,
+	0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c,
+	0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x58,
+	0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f,
+	0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e,
+	0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e,
+	0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74,
+	0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74,
+	0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80,
+	0x80, 0x80, 0x02, 0x22, 0x99, 0x03, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70,
+	0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61,
+	0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65,
+	0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x71, 0x0a, 0x11,
+	0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x5f, 0x6c, 0x65, 0x76, 0x65,
+	0x6c, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65,
+	0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64,
+	0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65,
+	0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x3a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f,
+	0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x52, 0x10, 0x69,
+	0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12,
+	0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x23, 0x20, 0x01, 0x28,
+	0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
+	0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08,
+	0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e,
+	0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
+	0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65,
+	0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65,
+	0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75,
+	0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69,
+	0x6f, 0x6e, 0x22, 0x50, 0x0a, 0x10, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63,
+	0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x17, 0x0a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f,
+	0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12,
+	0x13, 0x0a, 0x0f, 0x4e, 0x4f, 0x5f, 0x53, 0x49, 0x44, 0x45, 0x5f, 0x45, 0x46, 0x46, 0x45, 0x43,
+	0x54, 0x53, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45,
+	0x4e, 0x54, 0x10, 0x02, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22,
+	0x9a, 0x03, 0x0a, 0x13, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65,
+	0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18,
+	0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
+	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70,
+	0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65,
+	0x50, 0x61, 0x72, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x69, 0x64,
+	0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03,
+	0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72,
+	0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76,
+	0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28,
+	0x04, 0x52, 0x10, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61,
+	0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f,
+	0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52,
+	0x10, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75,
+	0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75,
+	0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x01, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56,
+	0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76,
+	0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69,
+	0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x27, 0x0a, 0x0f, 0x61, 0x67, 0x67, 0x72, 0x65,
+	0x67, 0x61, 0x74, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09,
+	0x52, 0x0e, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65,
+	0x1a, 0x4a, 0x0a, 0x08, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x1b, 0x0a, 0x09,
+	0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x70, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x02, 0x28, 0x09, 0x52,
+	0x08, 0x6e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x73, 0x5f,
+	0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x02, 0x28, 0x08, 0x52,
+	0x0b, 0x69, 0x73, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x0a, 0x0a,
+	0x0a, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x12, 0x8b, 0x01, 0x0a, 0x0e,
+	0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x18, 0x01,
+	0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
+	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65,
+	0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x42,
+	0x39, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45,
+	0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x49,
+	0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe7, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45,
+	0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe8, 0x07, 0x52, 0x0d, 0x66, 0x69, 0x65, 0x6c,
+	0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x66, 0x0a, 0x09, 0x65, 0x6e, 0x75,
+	0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67,
+	0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46,
+	0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x54, 0x79,
+	0x70, 0x65, 0x42, 0x23, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0b,
+	0x12, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x09, 0x12, 0x04,
+	0x4f, 0x50, 0x45, 0x4e, 0x18, 0xe7, 0x07, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70,
+	0x65, 0x12, 0x92, 0x01, 0x0a, 0x17, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66,
+	0x69, 0x65, 0x6c, 0x64, 0x5f, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20,
+	0x01, 0x28, 0x0e, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
+	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74,
+	0x2e, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e,
+	0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x27, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01,
+	0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, 0x41, 0x4e, 0x44, 0x45, 0x44, 0x18, 0xe6,
+	0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x18, 0xe7, 0x07, 0x52,
+	0x15, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e,
+	0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x78, 0x0a, 0x0f, 0x75, 0x74, 0x66, 0x38, 0x5f, 0x76,
+	0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32,
+	0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75,
+	0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x55, 0x74, 0x66,
+	0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x23, 0x88, 0x01, 0x01,
+	0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x18,
+	0xe6, 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, 0x18, 0xe7, 0x07,
+	0x52, 0x0e, 0x75, 0x74, 0x66, 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e,
+	0x12, 0x78, 0x0a, 0x10, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x6f,
+	0x64, 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f,
+	0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61,
+	0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45,
+	0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x20, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98,
+	0x01, 0x01, 0xa2, 0x01, 0x14, 0x12, 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, 0x50, 0x52,
+	0x45, 0x46, 0x49, 0x58, 0x45, 0x44, 0x18, 0xe6, 0x07, 0x52, 0x0f, 0x6d, 0x65, 0x73, 0x73, 0x61,
+	0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x7c, 0x0a, 0x0b, 0x6a, 0x73,
+	0x6f, 0x6e, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32,
+	0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75,
+	0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4a, 0x73, 0x6f,
+	0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x42, 0x33, 0x88, 0x01, 0x01, 0x98, 0x01, 0x03, 0x98,
+	0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x17, 0x12, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59,
+	0x5f, 0x42, 0x45, 0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x18, 0xe6, 0x07, 0xa2,
+	0x01, 0x0a, 0x12, 0x05, 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x18, 0xe7, 0x07, 0x52, 0x0a, 0x6a, 0x73,
+	0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x22, 0x5c, 0x0a, 0x0d, 0x46, 0x69, 0x65, 0x6c,
+	0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x46, 0x49, 0x45,
+	0x4c, 0x44, 0x5f, 0x50, 0x52, 0x45, 0x53, 0x45, 0x4e, 0x43, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e,
+	0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49,
+	0x54, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x10,
+	0x02, 0x12, 0x13, 0x0a, 0x0f, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x52, 0x45, 0x51, 0x55,
+	0x49, 0x52, 0x45, 0x44, 0x10, 0x03, 0x22, 0x37, 0x0a, 0x08, 0x45, 0x6e, 0x75, 0x6d, 0x54, 0x79,
+	0x70, 0x65, 0x12, 0x15, 0x0a, 0x11, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f,
+	0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x4f, 0x50, 0x45,
+	0x4e, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x10, 0x02, 0x22,
+	0x56, 0x0a, 0x15, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64,
+	0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x23, 0x0a, 0x1f, 0x52, 0x45, 0x50, 0x45,
+	0x41, 0x54, 0x45, 0x44, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44,
+	0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a,
+	0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50,
+	0x41, 0x4e, 0x44, 0x45, 0x44, 0x10, 0x02, 0x22, 0x43, 0x0a, 0x0e, 0x55, 0x74, 0x66, 0x38, 0x56,
+	0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x55, 0x54, 0x46,
+	0x38, 0x5f, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b,
+	0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59,
+	0x10, 0x02, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x03, 0x22, 0x53, 0x0a, 0x0f,
+	0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12,
+	0x1c, 0x0a, 0x18, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44,
+	0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a,
+	0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x45, 0x44,
+	0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x44, 0x45, 0x4c, 0x49, 0x4d, 0x49, 0x54, 0x45, 0x44, 0x10,
+	0x02, 0x22, 0x48, 0x0a, 0x0a, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12,
+	0x17, 0x0a, 0x13, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x46, 0x4f, 0x52, 0x4d, 0x41, 0x54, 0x5f, 0x55,
+	0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x4c, 0x4f,
+	0x57, 0x10, 0x01, 0x12, 0x16, 0x0a, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x42, 0x45,
+	0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x10, 0x02, 0x2a, 0x06, 0x08, 0xe8, 0x07,
+	0x10, 0xe9, 0x07, 0x2a, 0x06, 0x08, 0xe9, 0x07, 0x10, 0xea, 0x07, 0x2a, 0x06, 0x08, 0xea, 0x07,
+	0x10, 0xeb, 0x07, 0x2a, 0x06, 0x08, 0x8b, 0x4e, 0x10, 0x90, 0x4e, 0x2a, 0x06, 0x08, 0x90, 0x4e,
+	0x10, 0x91, 0x4e, 0x4a, 0x06, 0x08, 0xe7, 0x07, 0x10, 0xe8, 0x07, 0x22, 0xfe, 0x02, 0x0a, 0x12,
+	0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c,
+	0x74, 0x73, 0x12, 0x58, 0x0a, 0x08, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, 0x01,
+	0x20, 0x03, 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
+	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65,
+	0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72,
+	0x65, 0x53, 0x65, 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75,
+	0x6c, 0x74, 0x52, 0x08, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x12, 0x41, 0x0a, 0x0f,
+	0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18,
+	0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
+	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52,
+	0x0e, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12,
+	0x41, 0x0a, 0x0f, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69,
+	0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
+	0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69,
+	0x6f, 0x6e, 0x52, 0x0e, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69,
+	0x6f, 0x6e, 0x1a, 0x87, 0x01, 0x0a, 0x18, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65,
+	0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x12,
+	0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e,
+	0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
+	0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74,
+	0x69, 0x6f, 0x6e, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18,
+	0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
+	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53,
+	0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x22, 0xa7, 0x02, 0x0a,
+	0x0e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12,
+	0x44, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28,
+	0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
+	0x62, 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e,
+	0x66, 0x6f, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x6c, 0x6f, 0x63,
+	0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xce, 0x01, 0x0a, 0x08, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69,
 	0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05,
-	0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x1f, 0x0a, 0x0b, 0x73, 0x6f,
-	0x75, 0x72, 0x63, 0x65, 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52,
-	0x0a, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x46, 0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x62,
-	0x65, 0x67, 0x69, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x62, 0x65, 0x67, 0x69,
-	0x6e, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03,
-	0x65, 0x6e, 0x64, 0x12, 0x52, 0x0a, 0x08, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x18,
-	0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70,
-	0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65,
-	0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61,
-	0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x52, 0x08, 0x73,
-	0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x22, 0x28, 0x0a, 0x08, 0x53, 0x65, 0x6d, 0x61, 0x6e,
-	0x74, 0x69, 0x63, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x07, 0x0a,
-	0x03, 0x53, 0x45, 0x54, 0x10, 0x01, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x49, 0x41, 0x53, 0x10,
-	0x02, 0x42, 0x7e, 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
-	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x10, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69,
-	0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x73, 0x48, 0x01, 0x5a, 0x2d, 0x67, 0x6f,
-	0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f,
-	0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x64,
-	0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02,
-	0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72,
-	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x52, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f,
-	0x6e,
+	0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x16, 0x0a, 0x04, 0x73, 0x70,
+	0x61, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x73, 0x70,
+	0x61, 0x6e, 0x12, 0x29, 0x0a, 0x10, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f,
+	0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x65,
+	0x61, 0x64, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2b, 0x0a,
+	0x11, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e,
+	0x74, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69,
+	0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x6c, 0x65,
+	0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x63,
+	0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x17, 0x6c,
+	0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x44, 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x43, 0x6f,
+	0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, 0xd0, 0x02, 0x0a, 0x11, 0x47, 0x65, 0x6e, 0x65, 0x72,
+	0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x4d, 0x0a, 0x0a,
+	0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b,
+	0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
+	0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65,
+	0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52,
+	0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xeb, 0x01, 0x0a, 0x0a,
+	0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61,
+	0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61,
+	0x74, 0x68, 0x12, 0x1f, 0x0a, 0x0b, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x66, 0x69, 0x6c,
+	0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x46,
+	0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x18, 0x03, 0x20, 0x01,
+	0x28, 0x05, 0x52, 0x05, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64,
+	0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x12, 0x52, 0x0a, 0x08, 0x73,
+	0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x36, 0x2e,
+	0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e,
+	0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66,
+	0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x6d,
+	0x61, 0x6e, 0x74, 0x69, 0x63, 0x52, 0x08, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x22,
+	0x28, 0x0a, 0x08, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x12, 0x08, 0x0a, 0x04, 0x4e,
+	0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x53, 0x45, 0x54, 0x10, 0x01, 0x12, 0x09,
+	0x0a, 0x05, 0x41, 0x4c, 0x49, 0x41, 0x53, 0x10, 0x02, 0x2a, 0x92, 0x02, 0x0a, 0x07, 0x45, 0x64,
+	0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x13, 0x0a, 0x0f, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e,
+	0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0e, 0x45, 0x44,
+	0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x32, 0x10, 0xe6, 0x07, 0x12,
+	0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f,
+	0x33, 0x10, 0xe7, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f,
+	0x32, 0x30, 0x32, 0x33, 0x10, 0xe8, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49,
+	0x4f, 0x4e, 0x5f, 0x32, 0x30, 0x32, 0x34, 0x10, 0xe9, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44,
+	0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x31, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c,
+	0x59, 0x10, 0x01, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32,
+	0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x02, 0x12, 0x1d, 0x0a, 0x17,
+	0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x37, 0x5f, 0x54, 0x45,
+	0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9d, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45,
+	0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x38, 0x5f, 0x54, 0x45, 0x53,
+	0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9e, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44,
+	0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x39, 0x5f, 0x54, 0x45, 0x53, 0x54,
+	0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9f, 0x8d, 0x06, 0x12, 0x13, 0x0a, 0x0b, 0x45, 0x44, 0x49,
+	0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x41, 0x58, 0x10, 0xff, 0xff, 0xff, 0xff, 0x07, 0x42, 0x7e,
+	0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f,
+	0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x10, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f,
+	0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x73, 0x48, 0x01, 0x5a, 0x2d, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
+	0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f,
+	0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x64, 0x65, 0x73, 0x63,
+	0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50,
+	0x42, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f,
+	0x62, 0x75, 0x66, 0x2e, 0x52, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e,
 }
 
 var (
@@ -4123,103 +5083,136 @@ func file_google_protobuf_descriptor_proto_rawDescGZIP() []byte {
 	return file_google_protobuf_descriptor_proto_rawDescData
 }
 
-var file_google_protobuf_descriptor_proto_enumTypes = make([]protoimpl.EnumInfo, 10)
-var file_google_protobuf_descriptor_proto_msgTypes = make([]protoimpl.MessageInfo, 28)
+var file_google_protobuf_descriptor_proto_enumTypes = make([]protoimpl.EnumInfo, 17)
+var file_google_protobuf_descriptor_proto_msgTypes = make([]protoimpl.MessageInfo, 32)
 var file_google_protobuf_descriptor_proto_goTypes = []interface{}{
-	(ExtensionRangeOptions_VerificationState)(0),  // 0: google.protobuf.ExtensionRangeOptions.VerificationState
-	(FieldDescriptorProto_Type)(0),                // 1: google.protobuf.FieldDescriptorProto.Type
-	(FieldDescriptorProto_Label)(0),               // 2: google.protobuf.FieldDescriptorProto.Label
-	(FileOptions_OptimizeMode)(0),                 // 3: google.protobuf.FileOptions.OptimizeMode
-	(FieldOptions_CType)(0),                       // 4: google.protobuf.FieldOptions.CType
-	(FieldOptions_JSType)(0),                      // 5: google.protobuf.FieldOptions.JSType
-	(FieldOptions_OptionRetention)(0),             // 6: google.protobuf.FieldOptions.OptionRetention
-	(FieldOptions_OptionTargetType)(0),            // 7: google.protobuf.FieldOptions.OptionTargetType
-	(MethodOptions_IdempotencyLevel)(0),           // 8: google.protobuf.MethodOptions.IdempotencyLevel
-	(GeneratedCodeInfo_Annotation_Semantic)(0),    // 9: google.protobuf.GeneratedCodeInfo.Annotation.Semantic
-	(*FileDescriptorSet)(nil),                     // 10: google.protobuf.FileDescriptorSet
-	(*FileDescriptorProto)(nil),                   // 11: google.protobuf.FileDescriptorProto
-	(*DescriptorProto)(nil),                       // 12: google.protobuf.DescriptorProto
-	(*ExtensionRangeOptions)(nil),                 // 13: google.protobuf.ExtensionRangeOptions
-	(*FieldDescriptorProto)(nil),                  // 14: google.protobuf.FieldDescriptorProto
-	(*OneofDescriptorProto)(nil),                  // 15: google.protobuf.OneofDescriptorProto
-	(*EnumDescriptorProto)(nil),                   // 16: google.protobuf.EnumDescriptorProto
-	(*EnumValueDescriptorProto)(nil),              // 17: google.protobuf.EnumValueDescriptorProto
-	(*ServiceDescriptorProto)(nil),                // 18: google.protobuf.ServiceDescriptorProto
-	(*MethodDescriptorProto)(nil),                 // 19: google.protobuf.MethodDescriptorProto
-	(*FileOptions)(nil),                           // 20: google.protobuf.FileOptions
-	(*MessageOptions)(nil),                        // 21: google.protobuf.MessageOptions
-	(*FieldOptions)(nil),                          // 22: google.protobuf.FieldOptions
-	(*OneofOptions)(nil),                          // 23: google.protobuf.OneofOptions
-	(*EnumOptions)(nil),                           // 24: google.protobuf.EnumOptions
-	(*EnumValueOptions)(nil),                      // 25: google.protobuf.EnumValueOptions
-	(*ServiceOptions)(nil),                        // 26: google.protobuf.ServiceOptions
-	(*MethodOptions)(nil),                         // 27: google.protobuf.MethodOptions
-	(*UninterpretedOption)(nil),                   // 28: google.protobuf.UninterpretedOption
-	(*SourceCodeInfo)(nil),                        // 29: google.protobuf.SourceCodeInfo
-	(*GeneratedCodeInfo)(nil),                     // 30: google.protobuf.GeneratedCodeInfo
-	(*DescriptorProto_ExtensionRange)(nil),        // 31: google.protobuf.DescriptorProto.ExtensionRange
-	(*DescriptorProto_ReservedRange)(nil),         // 32: google.protobuf.DescriptorProto.ReservedRange
-	(*ExtensionRangeOptions_Declaration)(nil),     // 33: google.protobuf.ExtensionRangeOptions.Declaration
-	(*EnumDescriptorProto_EnumReservedRange)(nil), // 34: google.protobuf.EnumDescriptorProto.EnumReservedRange
-	(*UninterpretedOption_NamePart)(nil),          // 35: google.protobuf.UninterpretedOption.NamePart
-	(*SourceCodeInfo_Location)(nil),               // 36: google.protobuf.SourceCodeInfo.Location
-	(*GeneratedCodeInfo_Annotation)(nil),          // 37: google.protobuf.GeneratedCodeInfo.Annotation
+	(Edition)(0), // 0: google.protobuf.Edition
+	(ExtensionRangeOptions_VerificationState)(0),        // 1: google.protobuf.ExtensionRangeOptions.VerificationState
+	(FieldDescriptorProto_Type)(0),                      // 2: google.protobuf.FieldDescriptorProto.Type
+	(FieldDescriptorProto_Label)(0),                     // 3: google.protobuf.FieldDescriptorProto.Label
+	(FileOptions_OptimizeMode)(0),                       // 4: google.protobuf.FileOptions.OptimizeMode
+	(FieldOptions_CType)(0),                             // 5: google.protobuf.FieldOptions.CType
+	(FieldOptions_JSType)(0),                            // 6: google.protobuf.FieldOptions.JSType
+	(FieldOptions_OptionRetention)(0),                   // 7: google.protobuf.FieldOptions.OptionRetention
+	(FieldOptions_OptionTargetType)(0),                  // 8: google.protobuf.FieldOptions.OptionTargetType
+	(MethodOptions_IdempotencyLevel)(0),                 // 9: google.protobuf.MethodOptions.IdempotencyLevel
+	(FeatureSet_FieldPresence)(0),                       // 10: google.protobuf.FeatureSet.FieldPresence
+	(FeatureSet_EnumType)(0),                            // 11: google.protobuf.FeatureSet.EnumType
+	(FeatureSet_RepeatedFieldEncoding)(0),               // 12: google.protobuf.FeatureSet.RepeatedFieldEncoding
+	(FeatureSet_Utf8Validation)(0),                      // 13: google.protobuf.FeatureSet.Utf8Validation
+	(FeatureSet_MessageEncoding)(0),                     // 14: google.protobuf.FeatureSet.MessageEncoding
+	(FeatureSet_JsonFormat)(0),                          // 15: google.protobuf.FeatureSet.JsonFormat
+	(GeneratedCodeInfo_Annotation_Semantic)(0),          // 16: google.protobuf.GeneratedCodeInfo.Annotation.Semantic
+	(*FileDescriptorSet)(nil),                           // 17: google.protobuf.FileDescriptorSet
+	(*FileDescriptorProto)(nil),                         // 18: google.protobuf.FileDescriptorProto
+	(*DescriptorProto)(nil),                             // 19: google.protobuf.DescriptorProto
+	(*ExtensionRangeOptions)(nil),                       // 20: google.protobuf.ExtensionRangeOptions
+	(*FieldDescriptorProto)(nil),                        // 21: google.protobuf.FieldDescriptorProto
+	(*OneofDescriptorProto)(nil),                        // 22: google.protobuf.OneofDescriptorProto
+	(*EnumDescriptorProto)(nil),                         // 23: google.protobuf.EnumDescriptorProto
+	(*EnumValueDescriptorProto)(nil),                    // 24: google.protobuf.EnumValueDescriptorProto
+	(*ServiceDescriptorProto)(nil),                      // 25: google.protobuf.ServiceDescriptorProto
+	(*MethodDescriptorProto)(nil),                       // 26: google.protobuf.MethodDescriptorProto
+	(*FileOptions)(nil),                                 // 27: google.protobuf.FileOptions
+	(*MessageOptions)(nil),                              // 28: google.protobuf.MessageOptions
+	(*FieldOptions)(nil),                                // 29: google.protobuf.FieldOptions
+	(*OneofOptions)(nil),                                // 30: google.protobuf.OneofOptions
+	(*EnumOptions)(nil),                                 // 31: google.protobuf.EnumOptions
+	(*EnumValueOptions)(nil),                            // 32: google.protobuf.EnumValueOptions
+	(*ServiceOptions)(nil),                              // 33: google.protobuf.ServiceOptions
+	(*MethodOptions)(nil),                               // 34: google.protobuf.MethodOptions
+	(*UninterpretedOption)(nil),                         // 35: google.protobuf.UninterpretedOption
+	(*FeatureSet)(nil),                                  // 36: google.protobuf.FeatureSet
+	(*FeatureSetDefaults)(nil),                          // 37: google.protobuf.FeatureSetDefaults
+	(*SourceCodeInfo)(nil),                              // 38: google.protobuf.SourceCodeInfo
+	(*GeneratedCodeInfo)(nil),                           // 39: google.protobuf.GeneratedCodeInfo
+	(*DescriptorProto_ExtensionRange)(nil),              // 40: google.protobuf.DescriptorProto.ExtensionRange
+	(*DescriptorProto_ReservedRange)(nil),               // 41: google.protobuf.DescriptorProto.ReservedRange
+	(*ExtensionRangeOptions_Declaration)(nil),           // 42: google.protobuf.ExtensionRangeOptions.Declaration
+	(*EnumDescriptorProto_EnumReservedRange)(nil),       // 43: google.protobuf.EnumDescriptorProto.EnumReservedRange
+	(*FieldOptions_EditionDefault)(nil),                 // 44: google.protobuf.FieldOptions.EditionDefault
+	(*UninterpretedOption_NamePart)(nil),                // 45: google.protobuf.UninterpretedOption.NamePart
+	(*FeatureSetDefaults_FeatureSetEditionDefault)(nil), // 46: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault
+	(*SourceCodeInfo_Location)(nil),                     // 47: google.protobuf.SourceCodeInfo.Location
+	(*GeneratedCodeInfo_Annotation)(nil),                // 48: google.protobuf.GeneratedCodeInfo.Annotation
 }
 var file_google_protobuf_descriptor_proto_depIdxs = []int32{
-	11, // 0: google.protobuf.FileDescriptorSet.file:type_name -> google.protobuf.FileDescriptorProto
-	12, // 1: google.protobuf.FileDescriptorProto.message_type:type_name -> google.protobuf.DescriptorProto
-	16, // 2: google.protobuf.FileDescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto
-	18, // 3: google.protobuf.FileDescriptorProto.service:type_name -> google.protobuf.ServiceDescriptorProto
-	14, // 4: google.protobuf.FileDescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto
-	20, // 5: google.protobuf.FileDescriptorProto.options:type_name -> google.protobuf.FileOptions
-	29, // 6: google.protobuf.FileDescriptorProto.source_code_info:type_name -> google.protobuf.SourceCodeInfo
-	14, // 7: google.protobuf.DescriptorProto.field:type_name -> google.protobuf.FieldDescriptorProto
-	14, // 8: google.protobuf.DescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto
-	12, // 9: google.protobuf.DescriptorProto.nested_type:type_name -> google.protobuf.DescriptorProto
-	16, // 10: google.protobuf.DescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto
-	31, // 11: google.protobuf.DescriptorProto.extension_range:type_name -> google.protobuf.DescriptorProto.ExtensionRange
-	15, // 12: google.protobuf.DescriptorProto.oneof_decl:type_name -> google.protobuf.OneofDescriptorProto
-	21, // 13: google.protobuf.DescriptorProto.options:type_name -> google.protobuf.MessageOptions
-	32, // 14: google.protobuf.DescriptorProto.reserved_range:type_name -> google.protobuf.DescriptorProto.ReservedRange
-	28, // 15: google.protobuf.ExtensionRangeOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	33, // 16: google.protobuf.ExtensionRangeOptions.declaration:type_name -> google.protobuf.ExtensionRangeOptions.Declaration
-	0,  // 17: google.protobuf.ExtensionRangeOptions.verification:type_name -> google.protobuf.ExtensionRangeOptions.VerificationState
-	2,  // 18: google.protobuf.FieldDescriptorProto.label:type_name -> google.protobuf.FieldDescriptorProto.Label
-	1,  // 19: google.protobuf.FieldDescriptorProto.type:type_name -> google.protobuf.FieldDescriptorProto.Type
-	22, // 20: google.protobuf.FieldDescriptorProto.options:type_name -> google.protobuf.FieldOptions
-	23, // 21: google.protobuf.OneofDescriptorProto.options:type_name -> google.protobuf.OneofOptions
-	17, // 22: google.protobuf.EnumDescriptorProto.value:type_name -> google.protobuf.EnumValueDescriptorProto
-	24, // 23: google.protobuf.EnumDescriptorProto.options:type_name -> google.protobuf.EnumOptions
-	34, // 24: google.protobuf.EnumDescriptorProto.reserved_range:type_name -> google.protobuf.EnumDescriptorProto.EnumReservedRange
-	25, // 25: google.protobuf.EnumValueDescriptorProto.options:type_name -> google.protobuf.EnumValueOptions
-	19, // 26: google.protobuf.ServiceDescriptorProto.method:type_name -> google.protobuf.MethodDescriptorProto
-	26, // 27: google.protobuf.ServiceDescriptorProto.options:type_name -> google.protobuf.ServiceOptions
-	27, // 28: google.protobuf.MethodDescriptorProto.options:type_name -> google.protobuf.MethodOptions
-	3,  // 29: google.protobuf.FileOptions.optimize_for:type_name -> google.protobuf.FileOptions.OptimizeMode
-	28, // 30: google.protobuf.FileOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	28, // 31: google.protobuf.MessageOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	4,  // 32: google.protobuf.FieldOptions.ctype:type_name -> google.protobuf.FieldOptions.CType
-	5,  // 33: google.protobuf.FieldOptions.jstype:type_name -> google.protobuf.FieldOptions.JSType
-	6,  // 34: google.protobuf.FieldOptions.retention:type_name -> google.protobuf.FieldOptions.OptionRetention
-	7,  // 35: google.protobuf.FieldOptions.target:type_name -> google.protobuf.FieldOptions.OptionTargetType
-	7,  // 36: google.protobuf.FieldOptions.targets:type_name -> google.protobuf.FieldOptions.OptionTargetType
-	28, // 37: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	28, // 38: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	28, // 39: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	28, // 40: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	28, // 41: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	8,  // 42: google.protobuf.MethodOptions.idempotency_level:type_name -> google.protobuf.MethodOptions.IdempotencyLevel
-	28, // 43: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
-	35, // 44: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart
-	36, // 45: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location
-	37, // 46: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation
-	13, // 47: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions
-	9,  // 48: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic
-	49, // [49:49] is the sub-list for method output_type
-	49, // [49:49] is the sub-list for method input_type
-	49, // [49:49] is the sub-list for extension type_name
-	49, // [49:49] is the sub-list for extension extendee
-	0,  // [0:49] is the sub-list for field type_name
+	18, // 0: google.protobuf.FileDescriptorSet.file:type_name -> google.protobuf.FileDescriptorProto
+	19, // 1: google.protobuf.FileDescriptorProto.message_type:type_name -> google.protobuf.DescriptorProto
+	23, // 2: google.protobuf.FileDescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto
+	25, // 3: google.protobuf.FileDescriptorProto.service:type_name -> google.protobuf.ServiceDescriptorProto
+	21, // 4: google.protobuf.FileDescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto
+	27, // 5: google.protobuf.FileDescriptorProto.options:type_name -> google.protobuf.FileOptions
+	38, // 6: google.protobuf.FileDescriptorProto.source_code_info:type_name -> google.protobuf.SourceCodeInfo
+	0,  // 7: google.protobuf.FileDescriptorProto.edition:type_name -> google.protobuf.Edition
+	21, // 8: google.protobuf.DescriptorProto.field:type_name -> google.protobuf.FieldDescriptorProto
+	21, // 9: google.protobuf.DescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto
+	19, // 10: google.protobuf.DescriptorProto.nested_type:type_name -> google.protobuf.DescriptorProto
+	23, // 11: google.protobuf.DescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto
+	40, // 12: google.protobuf.DescriptorProto.extension_range:type_name -> google.protobuf.DescriptorProto.ExtensionRange
+	22, // 13: google.protobuf.DescriptorProto.oneof_decl:type_name -> google.protobuf.OneofDescriptorProto
+	28, // 14: google.protobuf.DescriptorProto.options:type_name -> google.protobuf.MessageOptions
+	41, // 15: google.protobuf.DescriptorProto.reserved_range:type_name -> google.protobuf.DescriptorProto.ReservedRange
+	35, // 16: google.protobuf.ExtensionRangeOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	42, // 17: google.protobuf.ExtensionRangeOptions.declaration:type_name -> google.protobuf.ExtensionRangeOptions.Declaration
+	36, // 18: google.protobuf.ExtensionRangeOptions.features:type_name -> google.protobuf.FeatureSet
+	1,  // 19: google.protobuf.ExtensionRangeOptions.verification:type_name -> google.protobuf.ExtensionRangeOptions.VerificationState
+	3,  // 20: google.protobuf.FieldDescriptorProto.label:type_name -> google.protobuf.FieldDescriptorProto.Label
+	2,  // 21: google.protobuf.FieldDescriptorProto.type:type_name -> google.protobuf.FieldDescriptorProto.Type
+	29, // 22: google.protobuf.FieldDescriptorProto.options:type_name -> google.protobuf.FieldOptions
+	30, // 23: google.protobuf.OneofDescriptorProto.options:type_name -> google.protobuf.OneofOptions
+	24, // 24: google.protobuf.EnumDescriptorProto.value:type_name -> google.protobuf.EnumValueDescriptorProto
+	31, // 25: google.protobuf.EnumDescriptorProto.options:type_name -> google.protobuf.EnumOptions
+	43, // 26: google.protobuf.EnumDescriptorProto.reserved_range:type_name -> google.protobuf.EnumDescriptorProto.EnumReservedRange
+	32, // 27: google.protobuf.EnumValueDescriptorProto.options:type_name -> google.protobuf.EnumValueOptions
+	26, // 28: google.protobuf.ServiceDescriptorProto.method:type_name -> google.protobuf.MethodDescriptorProto
+	33, // 29: google.protobuf.ServiceDescriptorProto.options:type_name -> google.protobuf.ServiceOptions
+	34, // 30: google.protobuf.MethodDescriptorProto.options:type_name -> google.protobuf.MethodOptions
+	4,  // 31: google.protobuf.FileOptions.optimize_for:type_name -> google.protobuf.FileOptions.OptimizeMode
+	36, // 32: google.protobuf.FileOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 33: google.protobuf.FileOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	36, // 34: google.protobuf.MessageOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 35: google.protobuf.MessageOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	5,  // 36: google.protobuf.FieldOptions.ctype:type_name -> google.protobuf.FieldOptions.CType
+	6,  // 37: google.protobuf.FieldOptions.jstype:type_name -> google.protobuf.FieldOptions.JSType
+	7,  // 38: google.protobuf.FieldOptions.retention:type_name -> google.protobuf.FieldOptions.OptionRetention
+	8,  // 39: google.protobuf.FieldOptions.targets:type_name -> google.protobuf.FieldOptions.OptionTargetType
+	44, // 40: google.protobuf.FieldOptions.edition_defaults:type_name -> google.protobuf.FieldOptions.EditionDefault
+	36, // 41: google.protobuf.FieldOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 42: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	36, // 43: google.protobuf.OneofOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 44: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	36, // 45: google.protobuf.EnumOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 46: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	36, // 47: google.protobuf.EnumValueOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 48: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	36, // 49: google.protobuf.ServiceOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 50: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	9,  // 51: google.protobuf.MethodOptions.idempotency_level:type_name -> google.protobuf.MethodOptions.IdempotencyLevel
+	36, // 52: google.protobuf.MethodOptions.features:type_name -> google.protobuf.FeatureSet
+	35, // 53: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption
+	45, // 54: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart
+	10, // 55: google.protobuf.FeatureSet.field_presence:type_name -> google.protobuf.FeatureSet.FieldPresence
+	11, // 56: google.protobuf.FeatureSet.enum_type:type_name -> google.protobuf.FeatureSet.EnumType
+	12, // 57: google.protobuf.FeatureSet.repeated_field_encoding:type_name -> google.protobuf.FeatureSet.RepeatedFieldEncoding
+	13, // 58: google.protobuf.FeatureSet.utf8_validation:type_name -> google.protobuf.FeatureSet.Utf8Validation
+	14, // 59: google.protobuf.FeatureSet.message_encoding:type_name -> google.protobuf.FeatureSet.MessageEncoding
+	15, // 60: google.protobuf.FeatureSet.json_format:type_name -> google.protobuf.FeatureSet.JsonFormat
+	46, // 61: google.protobuf.FeatureSetDefaults.defaults:type_name -> google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault
+	0,  // 62: google.protobuf.FeatureSetDefaults.minimum_edition:type_name -> google.protobuf.Edition
+	0,  // 63: google.protobuf.FeatureSetDefaults.maximum_edition:type_name -> google.protobuf.Edition
+	47, // 64: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location
+	48, // 65: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation
+	20, // 66: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions
+	0,  // 67: google.protobuf.FieldOptions.EditionDefault.edition:type_name -> google.protobuf.Edition
+	0,  // 68: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition:type_name -> google.protobuf.Edition
+	36, // 69: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.features:type_name -> google.protobuf.FeatureSet
+	16, // 70: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic
+	71, // [71:71] is the sub-list for method output_type
+	71, // [71:71] is the sub-list for method input_type
+	71, // [71:71] is the sub-list for extension type_name
+	71, // [71:71] is the sub-list for extension extendee
+	0,  // [0:71] is the sub-list for field type_name
 }
 
 func init() { file_google_protobuf_descriptor_proto_init() }
@@ -4475,19 +5468,21 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[19].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*SourceCodeInfo); i {
+			switch v := v.(*FeatureSet); i {
 			case 0:
 				return &v.state
 			case 1:
 				return &v.sizeCache
 			case 2:
 				return &v.unknownFields
+			case 3:
+				return &v.extensionFields
 			default:
 				return nil
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[20].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*GeneratedCodeInfo); i {
+			switch v := v.(*FeatureSetDefaults); i {
 			case 0:
 				return &v.state
 			case 1:
@@ -4499,7 +5494,7 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[21].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*DescriptorProto_ExtensionRange); i {
+			switch v := v.(*SourceCodeInfo); i {
 			case 0:
 				return &v.state
 			case 1:
@@ -4511,7 +5506,7 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[22].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*DescriptorProto_ReservedRange); i {
+			switch v := v.(*GeneratedCodeInfo); i {
 			case 0:
 				return &v.state
 			case 1:
@@ -4523,7 +5518,7 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[23].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*ExtensionRangeOptions_Declaration); i {
+			switch v := v.(*DescriptorProto_ExtensionRange); i {
 			case 0:
 				return &v.state
 			case 1:
@@ -4535,7 +5530,7 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[24].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*EnumDescriptorProto_EnumReservedRange); i {
+			switch v := v.(*DescriptorProto_ReservedRange); i {
 			case 0:
 				return &v.state
 			case 1:
@@ -4547,7 +5542,7 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[25].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*UninterpretedOption_NamePart); i {
+			switch v := v.(*ExtensionRangeOptions_Declaration); i {
 			case 0:
 				return &v.state
 			case 1:
@@ -4559,7 +5554,7 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[26].Exporter = func(v interface{}, i int) interface{} {
-			switch v := v.(*SourceCodeInfo_Location); i {
+			switch v := v.(*EnumDescriptorProto_EnumReservedRange); i {
 			case 0:
 				return &v.state
 			case 1:
@@ -4571,6 +5566,54 @@ func file_google_protobuf_descriptor_proto_init() {
 			}
 		}
 		file_google_protobuf_descriptor_proto_msgTypes[27].Exporter = func(v interface{}, i int) interface{} {
+			switch v := v.(*FieldOptions_EditionDefault); i {
+			case 0:
+				return &v.state
+			case 1:
+				return &v.sizeCache
+			case 2:
+				return &v.unknownFields
+			default:
+				return nil
+			}
+		}
+		file_google_protobuf_descriptor_proto_msgTypes[28].Exporter = func(v interface{}, i int) interface{} {
+			switch v := v.(*UninterpretedOption_NamePart); i {
+			case 0:
+				return &v.state
+			case 1:
+				return &v.sizeCache
+			case 2:
+				return &v.unknownFields
+			default:
+				return nil
+			}
+		}
+		file_google_protobuf_descriptor_proto_msgTypes[29].Exporter = func(v interface{}, i int) interface{} {
+			switch v := v.(*FeatureSetDefaults_FeatureSetEditionDefault); i {
+			case 0:
+				return &v.state
+			case 1:
+				return &v.sizeCache
+			case 2:
+				return &v.unknownFields
+			default:
+				return nil
+			}
+		}
+		file_google_protobuf_descriptor_proto_msgTypes[30].Exporter = func(v interface{}, i int) interface{} {
+			switch v := v.(*SourceCodeInfo_Location); i {
+			case 0:
+				return &v.state
+			case 1:
+				return &v.sizeCache
+			case 2:
+				return &v.unknownFields
+			default:
+				return nil
+			}
+		}
+		file_google_protobuf_descriptor_proto_msgTypes[31].Exporter = func(v interface{}, i int) interface{} {
 			switch v := v.(*GeneratedCodeInfo_Annotation); i {
 			case 0:
 				return &v.state
@@ -4588,8 +5631,8 @@ func file_google_protobuf_descriptor_proto_init() {
 		File: protoimpl.DescBuilder{
 			GoPackagePath: reflect.TypeOf(x{}).PkgPath(),
 			RawDescriptor: file_google_protobuf_descriptor_proto_rawDesc,
-			NumEnums:      10,
-			NumMessages:   28,
+			NumEnums:      17,
+			NumMessages:   32,
 			NumExtensions: 0,
 			NumServices:   0,
 		},
diff --git a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go
new file mode 100644
index 000000000..25de5ae00
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go
@@ -0,0 +1,177 @@
+// Protocol Buffers - Google's data interchange format
+// Copyright 2023 Google Inc.  All rights reserved.
+//
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file or at
+// https://developers.google.com/open-source/licenses/bsd
+
+// Code generated by protoc-gen-go. DO NOT EDIT.
+// source: reflect/protodesc/proto/go_features.proto
+
+package proto
+
+import (
+	protoreflect "google.golang.org/protobuf/reflect/protoreflect"
+	protoimpl "google.golang.org/protobuf/runtime/protoimpl"
+	descriptorpb "google.golang.org/protobuf/types/descriptorpb"
+	reflect "reflect"
+	sync "sync"
+)
+
+type GoFeatures struct {
+	state         protoimpl.MessageState
+	sizeCache     protoimpl.SizeCache
+	unknownFields protoimpl.UnknownFields
+
+	// Whether or not to generate the deprecated UnmarshalJSON method for enums.
+	LegacyUnmarshalJsonEnum *bool `protobuf:"varint,1,opt,name=legacy_unmarshal_json_enum,json=legacyUnmarshalJsonEnum" json:"legacy_unmarshal_json_enum,omitempty"`
+}
+
+func (x *GoFeatures) Reset() {
+	*x = GoFeatures{}
+	if protoimpl.UnsafeEnabled {
+		mi := &file_reflect_protodesc_proto_go_features_proto_msgTypes[0]
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		ms.StoreMessageInfo(mi)
+	}
+}
+
+func (x *GoFeatures) String() string {
+	return protoimpl.X.MessageStringOf(x)
+}
+
+func (*GoFeatures) ProtoMessage() {}
+
+func (x *GoFeatures) ProtoReflect() protoreflect.Message {
+	mi := &file_reflect_protodesc_proto_go_features_proto_msgTypes[0]
+	if protoimpl.UnsafeEnabled && x != nil {
+		ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+		if ms.LoadMessageInfo() == nil {
+			ms.StoreMessageInfo(mi)
+		}
+		return ms
+	}
+	return mi.MessageOf(x)
+}
+
+// Deprecated: Use GoFeatures.ProtoReflect.Descriptor instead.
+func (*GoFeatures) Descriptor() ([]byte, []int) {
+	return file_reflect_protodesc_proto_go_features_proto_rawDescGZIP(), []int{0}
+}
+
+func (x *GoFeatures) GetLegacyUnmarshalJsonEnum() bool {
+	if x != nil && x.LegacyUnmarshalJsonEnum != nil {
+		return *x.LegacyUnmarshalJsonEnum
+	}
+	return false
+}
+
+var file_reflect_protodesc_proto_go_features_proto_extTypes = []protoimpl.ExtensionInfo{
+	{
+		ExtendedType:  (*descriptorpb.FeatureSet)(nil),
+		ExtensionType: (*GoFeatures)(nil),
+		Field:         1002,
+		Name:          "google.protobuf.go",
+		Tag:           "bytes,1002,opt,name=go",
+		Filename:      "reflect/protodesc/proto/go_features.proto",
+	},
+}
+
+// Extension fields to descriptorpb.FeatureSet.
+var (
+	// optional google.protobuf.GoFeatures go = 1002;
+	E_Go = &file_reflect_protodesc_proto_go_features_proto_extTypes[0]
+)
+
+var File_reflect_protodesc_proto_go_features_proto protoreflect.FileDescriptor
+
+var file_reflect_protodesc_proto_go_features_proto_rawDesc = []byte{
+	0x0a, 0x29, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x64,
+	0x65, 0x73, 0x63, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x5f, 0x66, 0x65, 0x61,
+	0x74, 0x75, 0x72, 0x65, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0f, 0x67, 0x6f, 0x6f,
+	0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x1a, 0x20, 0x67, 0x6f,
+	0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x65,
+	0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x6a,
+	0x0a, 0x0a, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x5c, 0x0a, 0x1a,
+	0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x75, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, 0x6c,
+	0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08,
+	0x42, 0x1f, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x74, 0x72, 0x75,
+	0x65, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0a, 0x12, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x18, 0xe7,
+	0x07, 0x52, 0x17, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x55, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68,
+	0x61, 0x6c, 0x4a, 0x73, 0x6f, 0x6e, 0x45, 0x6e, 0x75, 0x6d, 0x3a, 0x49, 0x0a, 0x02, 0x67, 0x6f,
+	0x12, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62,
+	0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x18, 0xea, 0x07,
+	0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72,
+	0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65,
+	0x73, 0x52, 0x02, 0x67, 0x6f, 0x42, 0x34, 0x5a, 0x32, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
+	0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f,
+	0x62, 0x75, 0x66, 0x2f, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x2f, 0x70, 0x72, 0x6f, 0x74,
+	0x6f, 0x64, 0x65, 0x73, 0x63, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f,
+}
+
+var (
+	file_reflect_protodesc_proto_go_features_proto_rawDescOnce sync.Once
+	file_reflect_protodesc_proto_go_features_proto_rawDescData = file_reflect_protodesc_proto_go_features_proto_rawDesc
+)
+
+func file_reflect_protodesc_proto_go_features_proto_rawDescGZIP() []byte {
+	file_reflect_protodesc_proto_go_features_proto_rawDescOnce.Do(func() {
+		file_reflect_protodesc_proto_go_features_proto_rawDescData = protoimpl.X.CompressGZIP(file_reflect_protodesc_proto_go_features_proto_rawDescData)
+	})
+	return file_reflect_protodesc_proto_go_features_proto_rawDescData
+}
+
+var file_reflect_protodesc_proto_go_features_proto_msgTypes = make([]protoimpl.MessageInfo, 1)
+var file_reflect_protodesc_proto_go_features_proto_goTypes = []interface{}{
+	(*GoFeatures)(nil),              // 0: google.protobuf.GoFeatures
+	(*descriptorpb.FeatureSet)(nil), // 1: google.protobuf.FeatureSet
+}
+var file_reflect_protodesc_proto_go_features_proto_depIdxs = []int32{
+	1, // 0: google.protobuf.go:extendee -> google.protobuf.FeatureSet
+	0, // 1: google.protobuf.go:type_name -> google.protobuf.GoFeatures
+	2, // [2:2] is the sub-list for method output_type
+	2, // [2:2] is the sub-list for method input_type
+	1, // [1:2] is the sub-list for extension type_name
+	0, // [0:1] is the sub-list for extension extendee
+	0, // [0:0] is the sub-list for field type_name
+}
+
+func init() { file_reflect_protodesc_proto_go_features_proto_init() }
+func file_reflect_protodesc_proto_go_features_proto_init() {
+	if File_reflect_protodesc_proto_go_features_proto != nil {
+		return
+	}
+	if !protoimpl.UnsafeEnabled {
+		file_reflect_protodesc_proto_go_features_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} {
+			switch v := v.(*GoFeatures); i {
+			case 0:
+				return &v.state
+			case 1:
+				return &v.sizeCache
+			case 2:
+				return &v.unknownFields
+			default:
+				return nil
+			}
+		}
+	}
+	type x struct{}
+	out := protoimpl.TypeBuilder{
+		File: protoimpl.DescBuilder{
+			GoPackagePath: reflect.TypeOf(x{}).PkgPath(),
+			RawDescriptor: file_reflect_protodesc_proto_go_features_proto_rawDesc,
+			NumEnums:      0,
+			NumMessages:   1,
+			NumExtensions: 1,
+			NumServices:   0,
+		},
+		GoTypes:           file_reflect_protodesc_proto_go_features_proto_goTypes,
+		DependencyIndexes: file_reflect_protodesc_proto_go_features_proto_depIdxs,
+		MessageInfos:      file_reflect_protodesc_proto_go_features_proto_msgTypes,
+		ExtensionInfos:    file_reflect_protodesc_proto_go_features_proto_extTypes,
+	}.Build()
+	File_reflect_protodesc_proto_go_features_proto = out.File
+	file_reflect_protodesc_proto_go_features_proto_rawDesc = nil
+	file_reflect_protodesc_proto_go_features_proto_goTypes = nil
+	file_reflect_protodesc_proto_go_features_proto_depIdxs = nil
+}
diff --git a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto
new file mode 100644
index 000000000..d24657129
--- /dev/null
+++ b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto
@@ -0,0 +1,28 @@
+// Protocol Buffers - Google's data interchange format
+// Copyright 2023 Google Inc.  All rights reserved.
+//
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file or at
+// https://developers.google.com/open-source/licenses/bsd
+
+syntax = "proto2";
+
+package google.protobuf;
+
+import "google/protobuf/descriptor.proto";
+
+option go_package = "google.golang.org/protobuf/types/gofeaturespb";
+
+extend google.protobuf.FeatureSet {
+  optional GoFeatures go = 1002;
+}
+
+message GoFeatures {
+  // Whether or not to generate the deprecated UnmarshalJSON method for enums.
+  optional bool legacy_unmarshal_json_enum = 1 [
+    retention = RETENTION_RUNTIME,
+    targets = TARGET_TYPE_ENUM,
+    edition_defaults = { edition: EDITION_PROTO2, value: "true" },
+    edition_defaults = { edition: EDITION_PROTO3, value: "false" }
+  ];
+}
diff --git a/vendor/modules.txt b/vendor/modules.txt
index d49b2c65b..e850808bc 100644
--- a/vendor/modules.txt
+++ b/vendor/modules.txt
@@ -2,10 +2,10 @@
 ## explicit; go 1.20
 filippo.io/edwards25519
 filippo.io/edwards25519/field
-# github.com/cespare/xxhash/v2 v2.2.0
+# github.com/cespare/xxhash/v2 v2.3.0
 ## explicit; go 1.11
 github.com/cespare/xxhash/v2
-# github.com/cpuguy83/go-md2man/v2 v2.0.2
+# github.com/cpuguy83/go-md2man/v2 v2.0.4
 ## explicit; go 1.11
 github.com/cpuguy83/go-md2man/v2/md2man
 # github.com/davecgh/go-spew v1.1.1
@@ -35,25 +35,25 @@ github.com/go-task/slim-sprig
 # github.com/gogo/protobuf v1.3.2
 ## explicit; go 1.15
 github.com/gogo/protobuf/proto
-# github.com/golang/glog v1.1.1
+# github.com/golang/glog v1.2.1
 ## explicit; go 1.19
 github.com/golang/glog
 github.com/golang/glog/internal/logsink
 github.com/golang/glog/internal/stackdump
-# github.com/golang/protobuf v1.5.3
-## explicit; go 1.9
+# github.com/golang/protobuf v1.5.4
+## explicit; go 1.17
 github.com/golang/protobuf/proto
 # github.com/golang/snappy v0.0.4
 ## explicit
 github.com/golang/snappy
-# github.com/google/flatbuffers v23.5.26+incompatible
+# github.com/google/flatbuffers v24.3.25+incompatible
 ## explicit
 github.com/google/flatbuffers/go
-# github.com/google/pprof v0.0.0-20210407192527-94a9f03dee38
-## explicit; go 1.14
+# github.com/google/pprof v0.0.0-20240424215950-a892ee059fd6
+## explicit; go 1.19
 github.com/google/pprof/profile
-# github.com/klauspost/compress v1.16.7
-## explicit; go 1.18
+# github.com/klauspost/compress v1.17.8
+## explicit; go 1.20
 github.com/klauspost/compress
 github.com/klauspost/compress/fse
 github.com/klauspost/compress/huff0
@@ -61,11 +61,11 @@ github.com/klauspost/compress/internal/cpuinfo
 github.com/klauspost/compress/internal/snapref
 github.com/klauspost/compress/zstd
 github.com/klauspost/compress/zstd/internal/xxhash
-# github.com/klauspost/cpuid/v2 v2.0.12
+# github.com/klauspost/cpuid/v2 v2.2.7
 ## explicit; go 1.15
 github.com/klauspost/cpuid/v2
-# github.com/onsi/ginkgo/v2 v2.9.5
-## explicit; go 1.18
+# github.com/onsi/ginkgo/v2 v2.17.1
+## explicit; go 1.20
 github.com/onsi/ginkgo/v2/config
 github.com/onsi/ginkgo/v2/formatter
 github.com/onsi/ginkgo/v2/ginkgo
@@ -111,8 +111,8 @@ github.com/quic-go/quic-go/quicvarint
 # github.com/russross/blackfriday/v2 v2.1.0
 ## explicit
 github.com/russross/blackfriday/v2
-# github.com/shopspring/decimal v1.3.1
-## explicit; go 1.13
+# github.com/shopspring/decimal v1.4.0
+## explicit; go 1.10
 github.com/shopspring/decimal
 # github.com/stretchr/testify v1.9.0
 ## explicit; go 1.17
@@ -121,8 +121,8 @@ github.com/stretchr/testify/require
 # github.com/urfave/cli/v2 v2.27.1
 ## explicit; go 1.18
 github.com/urfave/cli/v2
-# github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673
-## explicit
+# github.com/xrash/smetrics v0.0.0-20240312152122-5f08fbb34913
+## explicit; go 1.15.0
 github.com/xrash/smetrics
 # github.com/zeebo/blake3 v0.2.3
 ## explicit; go 1.13
@@ -149,16 +149,16 @@ golang.org/x/crypto/hkdf
 golang.org/x/crypto/internal/alias
 golang.org/x/crypto/internal/poly1305
 golang.org/x/crypto/sha3
-# golang.org/x/exp v0.0.0-20221205204356-47842c84f3db
-## explicit; go 1.18
+# golang.org/x/exp v0.0.0-20240416160154-fe59bbe5cc7f
+## explicit; go 1.20
 golang.org/x/exp/rand
-# golang.org/x/mod v0.11.0
-## explicit; go 1.17
+# golang.org/x/mod v0.17.0
+## explicit; go 1.18
 golang.org/x/mod/internal/lazyregexp
 golang.org/x/mod/modfile
 golang.org/x/mod/module
 golang.org/x/mod/semver
-# golang.org/x/net v0.21.0
+# golang.org/x/net v0.24.0
 ## explicit; go 1.18
 golang.org/x/net/bpf
 golang.org/x/net/internal/iana
@@ -170,11 +170,11 @@ golang.org/x/net/trace
 # golang.org/x/sys v0.19.0
 ## explicit; go 1.18
 golang.org/x/sys/cpu
-golang.org/x/sys/execabs
 golang.org/x/sys/unix
 golang.org/x/sys/windows
-# golang.org/x/tools v0.9.1
-## explicit; go 1.18
+# golang.org/x/tools v0.20.0
+## explicit; go 1.19
+golang.org/x/tools/cover
 golang.org/x/tools/go/ast/astutil
 golang.org/x/tools/go/ast/inspector
 golang.org/x/tools/imports
@@ -182,18 +182,19 @@ golang.org/x/tools/internal/event
 golang.org/x/tools/internal/event/core
 golang.org/x/tools/internal/event/keys
 golang.org/x/tools/internal/event/label
-golang.org/x/tools/internal/fastwalk
+golang.org/x/tools/internal/event/tag
 golang.org/x/tools/internal/gocommand
 golang.org/x/tools/internal/gopathwalk
 golang.org/x/tools/internal/imports
-golang.org/x/tools/internal/typeparams
-# google.golang.org/protobuf v1.31.0
-## explicit; go 1.11
+golang.org/x/tools/internal/stdlib
+# google.golang.org/protobuf v1.33.0
+## explicit; go 1.17
 google.golang.org/protobuf/encoding/prototext
 google.golang.org/protobuf/encoding/protowire
 google.golang.org/protobuf/internal/descfmt
 google.golang.org/protobuf/internal/descopts
 google.golang.org/protobuf/internal/detrand
+google.golang.org/protobuf/internal/editiondefaults
 google.golang.org/protobuf/internal/encoding/defval
 google.golang.org/protobuf/internal/encoding/messageset
 google.golang.org/protobuf/internal/encoding/tag
@@ -216,6 +217,7 @@ google.golang.org/protobuf/reflect/protoregistry
 google.golang.org/protobuf/runtime/protoiface
 google.golang.org/protobuf/runtime/protoimpl
 google.golang.org/protobuf/types/descriptorpb
+google.golang.org/protobuf/types/gofeaturespb
 # gopkg.in/yaml.v3 v3.0.1
 ## explicit
 gopkg.in/yaml.v3