Skip to content

HTTPS clone URL

Subversion checkout URL

You can clone with
or
.
Download ZIP
Tree: 9dc87e5755
Fetching contributors…

Cannot retrieve contributors at this time

39 lines (30 sloc) 1.621 kB
hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: testInput.hmm
Sequence file: testInput.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query sequence: Test
Accession: [none]
Description: [none]
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
TEST 184.7 2.5e-56 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
TEST 1/1 8 97 .] 1 95 [] 184.7 2.5e-56
Alignments of top-scoring domains:
TEST: domain 1 of 1, from 8 to 97: score 184.7, E = 2.5e-56
*->svfqqqqssksttgstvtAiAiAigYRYRYRAvtWnsGsLssGvnDn
sv+qqqq+ + +vtAiAiAigYRYRYRAv Wn GsLs G nDn
Test 8 SVYQQQQGGSA----MVTAIAIAIGYRYRYRAVVWNKGSLSTGTNDN 50
DnDqqsdgLYtiYYsvtvpssslpsqtviHHHaHkasstkiiikiePr<-
DnDq +d LYtiYYsvtv +ss+p q+v+HHHaH+asstkiiiki P
Test 51 DNDQAAD-LYTIYYSVTVSASSWPGQSVTHHHAHPASSTKIIIKIAPS 97
*
Test - -
//
Jump to Line
Something went wrong with that request. Please try again.