Permalink
Find file Copy path
Fetching contributors…
Cannot retrieve contributors at this time
2565 lines (1918 sloc) 122 KB
BLASTP 2.0MP-WashU [04-May-2006] [linux26-x64-I32LPF64 2006-05-10T17:22:28]
Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.
Reference: Gish, W. (1996-2006) http://blast.wustl.edu
Query= Celegans_dcr1
(1845 letters)
Database: swissprot
353,658 sequences; 132,868,552 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done
Smallest
Sum
High Probability
Sequences producing High-scoring Segment Pairs: Score P(N) N
sp|P34529.2|DCR1_CAEEL RecName: Full=Endoribonuclease dcr-1 9560 0. 1
sp|Q9VCU9.1|DCR1_DROME RecName: Full=Endoribonuclease Dcr... 1792 1.5e-232 3
sp|Q9UPY3.2|DICER_HUMAN RecName: Full=Endoribonuclease Di... 2152 6.4e-223 1
sp|Q8R418.2|DICER_MOUSE RecName: Full=Endoribonuclease Di... 2120 1.6e-219 1
sp|P84634.1|DCL4_ARATH RecName: Full=Dicer-like protein 4 471 8.6e-72 5
sp|Q7S8J7.1|DCL1_NEUCR RecName: Full=Dicer-like protein 1... 505 3.0e-69 6
sp|A4RKC3.2|DCL1_MAGGR RecName: Full=Dicer-like protein 1... 481 3.5e-69 6
sp|Q0CW42.2|DCL1_ASPTN RecName: Full=Dicer-like protein 1... 464 4.8e-65 6
sp|Q1DKI1.2|DCL1_COCIM RecName: Full=Dicer-like protein 1... 498 8.4e-64 6
sp|A2RAF3.2|DCL1_ASPNC RecName: Full=Dicer-like protein 1... 466 5.3e-62 5
sp|Q09884.1|DCR1_SCHPO RecName: Full=Protein Dicer; AltNa... 415 7.7e-61 4
sp|A1CBC9.2|DCL1_ASPCL RecName: Full=Dicer-like protein 1... 428 1.2e-60 6
sp|A1DE13.1|DCL1_NEOFI RecName: Full=Dicer-like protein 1... 457 1.6e-60 6
sp|Q2VF19.1|DCL1_CRYPA RecName: Full=Dicer-like protein 1... 465 4.2e-60 4
sp|Q0UI93.2|DCL1_PHANO RecName: Full=Dicer-like protein 1... 490 3.8e-59 5
sp|Q4WVE3.3|DCL1_ASPFU RecName: Full=Dicer-like protein 1... 466 4.8e-59 6
sp|Q2U6C4.2|DCL1_ASPOR RecName: Full=Dicer-like protein 1... 474 8.5e-58 4
sp|Q2UNX5.1|DCL2_ASPOR RecName: Full=Dicer-like protein 2... 396 1.0e-53 5
sp|Q4WA22.2|DCL2_ASPFU RecName: Full=Dicer-like protein 2... 369 1.7e-51 5
>sp|P34529.2|DCR1_CAEEL RecName: Full=Endoribonuclease dcr-1
Length = 1845
Score = 9560 (3370.3 bits), Expect = 0., P = 0.
Identities = 1845/1845 (100%), Positives = 1845/1845 (100%)
Links = (1)
Query: 1 MVRVRADLQCFNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQ 60
MVRVRADLQCFNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQ
Sbjct: 1 MVRVRADLQCFNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQ 60
Query: 61 GGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVI 120
GGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVI
Sbjct: 61 GGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVI 120
Query: 121 TAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLT 180
TAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLT
Sbjct: 121 TAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLT 180
Query: 181 ASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLG 240
ASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLG
Sbjct: 181 ASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLG 240
Query: 241 IPNFDTVIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQ 300
IPNFDTVIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQ
Sbjct: 241 IPNFDTVIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQ 300
Query: 301 VWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIR 360
VWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIR
Sbjct: 301 VWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIR 360
Query: 361 LFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPD 420
LFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPD
Sbjct: 361 LFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPD 420
Query: 421 YVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDR 480
YVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDR
Sbjct: 421 YVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDR 480
Query: 481 PLDMRSYVQSKGRARRAGSRYVITVEEKDTAAYCSKLPSDIFTRLVPHNQIIPIEENGVT 540
PLDMRSYVQSKGRARRAGSRYVITVEEKDTAAYCSKLPSDIFTRLVPHNQIIPIEENGVT
Sbjct: 481 PLDMRSYVQSKGRARRAGSRYVITVEEKDTAAYCSKLPSDIFTRLVPHNQIIPIEENGVT 540
Query: 541 KYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESI 600
KYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESI
Sbjct: 541 KYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESI 600
Query: 601 AKLLEHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADKECFIYAFELERF 660
AKLLEHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADKECFIYAFELERF
Sbjct: 601 AKLLEHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADKECFIYAFELERF 660
Query: 661 REAELTLNPKRRKFEDPFNYEYCFGFLSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTV 720
REAELTLNPKRRKFEDPFNYEYCFGFLSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTV
Sbjct: 661 REAELTLNPKRRKFEDPFNYEYCFGFLSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTV 720
Query: 721 TAAQLQEIQLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKY 780
TAAQLQEIQLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKY
Sbjct: 721 TAAQLQEIQLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKY 780
Query: 781 VSEVVANMENMPRIPKDEVRRQYKFNAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPS 840
VSEVVANMENMPRIPKDEVRRQYKFNAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPS
Sbjct: 781 VSEVVANMENMPRIPKDEVRRQYKFNAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPS 840
Query: 841 SKFPDTHFETFNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNS 900
SKFPDTHFETFNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNS
Sbjct: 841 SKFPDTHFETFNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNS 900
Query: 901 STSNIPQASASDSKESNTSVPHSSQRQILVPELMDIHPISATLWNVIAALPSIFYRVNQL 960
STSNIPQASASDSKESNTSVPHSSQRQILVPELMDIHPISATLWNVIAALPSIFYRVNQL
Sbjct: 901 STSNIPQASASDSKESNTSVPHSSQRQILVPELMDIHPISATLWNVIAALPSIFYRVNQL 960
Query: 961 LLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIVKKIQQLRDLNQKSIE 1020
LLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIVKKIQQLRDLNQKSIE
Sbjct: 961 LLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIVKKIQQLRDLNQKSIE 1020
Query: 1021 DQERETRENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDG 1080
DQERETRENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDG
Sbjct: 1021 DQERETRENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDG 1080
Query: 1081 NISDEDDELPFVMHDYTARLTSNRNGIGAWSGSESIVPSGWGDWDGPEPDNSPMPFQILG 1140
NISDEDDELPFVMHDYTARLTSNRNGIGAWSGSESIVPSGWGDWDGPEPDNSPMPFQILG
Sbjct: 1081 NISDEDDELPFVMHDYTARLTSNRNGIGAWSGSESIVPSGWGDWDGPEPDNSPMPFQILG 1140
Query: 1141 GPGGLNVQALMADVGRVFDPSTASSSLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQA 1200
GPGGLNVQALMADVGRVFDPSTASSSLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQA
Sbjct: 1141 GPGGLNVQALMADVGRVFDPSTASSSLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQA 1200
Query: 1201 KERLEALEMSEDMEKPRRLEDTVNLEDYGDDQENQEDENTPTNFPKTIDEEIEELSIGAR 1260
KERLEALEMSEDMEKPRRLEDTVNLEDYGDDQENQEDENTPTNFPKTIDEEIEELSIGAR
Sbjct: 1201 KERLEALEMSEDMEKPRRLEDTVNLEDYGDDQENQEDENTPTNFPKTIDEEIEELSIGAR 1260
Query: 1261 KKQEIDDNAAKTDVLERENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHID 1320
KKQEIDDNAAKTDVLERENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHID
Sbjct: 1261 KKQEIDDNAAKTDVLERENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHID 1320
Query: 1321 SDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSF 1380
SDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSF
Sbjct: 1321 SDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSF 1380
Query: 1381 ARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAEEKDNE 1440
ARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAEEKDNE
Sbjct: 1381 ARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAEEKDNE 1440
Query: 1441 IERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQ 1500
IERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQ
Sbjct: 1441 IERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQ 1500
Query: 1501 QHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTPT 1560
QHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTPT
Sbjct: 1501 QHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTPT 1560
Query: 1561 NPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLG 1620
NPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLG
Sbjct: 1561 NPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLG 1620
Query: 1621 DAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHM 1680
DAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHM
Sbjct: 1621 DAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHM 1680
Query: 1681 IEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSG 1740
IEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSG
Sbjct: 1681 IEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSG 1740
Query: 1741 RNLDTTWQVIFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVE 1800
RNLDTTWQVIFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVE
Sbjct: 1741 RNLDTTWQVIFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVE 1800
Query: 1801 VVNNMRFTGMGRNYRIAKATAAKRALKYLHQIEQQRRQSPSLTTV 1845
VVNNMRFTGMGRNYRIAKATAAKRALKYLHQIEQQRRQSPSLTTV
Sbjct: 1801 VVNNMRFTGMGRNYRIAKATAAKRALKYLHQIEQQRRQSPSLTTV 1845
>sp|Q9VCU9.1|DCR1_DROME RecName: Full=Endoribonuclease Dcr-1; Short=Protein
dicer-1
Length = 2249
Score = 1792 (635.9 bits), Expect = 1.5e-232, Sum P(3) = 1.5e-232
Identities = 522/1454 (35%), Positives = 748/1454 (51%)
Links = 2-3-(1)
Query: 513 YCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQM 572
YC++LPSD FT+L + E GVT + L LPINSP+KH IV PMP + A+
Sbjct: 832 YCARLPSDTFTKLTALWRCTRNERAGVTLFQYTLRLPINSPLKHDIV-GLPMPTQTLARR 890
Query: 573 AVALEACRQLHLEGELDDNLLPKGRESIAKL---LEHIDEEP-DEYAPGIA--AKVGSSK 626
AL+AC +LH GELDD L P G+E L E + EP DE ++ + G++K
Sbjct: 891 LAALQACVELHRIGELDDQLQPIGKEGFRALEPDWECFELEPEDEQIVQLSDEPRPGTTK 950
Query: 627 RKQLYDKKIARALNESFVEADKECFIYAFELERFREAELTLNPKRRKFEDPFNYEYCFGF 686
R+Q Y K+IA + A C++Y +L N + RK P + + FG
Sbjct: 951 RRQYYYKRIASEFCDCRPVAGAPCYLYFIQLTLQCPIPEEQNTRGRKIYPPEDAQQGFGI 1010
Query: 687 LSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMCKTG 746
L+ K IPK+ F +F R G +KV L +A ++ +T+ Q+ I F NY FT VL++ K
Sbjct: 1011 LTTKRIPKLSAFSIFTRSGEVKVSLELAKERVILTSEQIVCINGFLNYTFTNVLRLQKFL 1070
Query: 747 NL-EFDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQYKF 805
L + D T N IVP K + I+ +++ + AN MPR DE R+ F
Sbjct: 1071 MLFDPDSTENC---VFIVPTVKAPAGGKH-IDWQFLELIQANGNTMPRAVPDEERQAQPF 1126
Query: 806 NAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLEIYD 865
+ + ++DA+VMPWYRN +QP ++YVAEI P P S FP ++ TF Y++ KY L I +
Sbjct: 1127 DPQRFQDAVVMPWYRNQDQPQYFYVAEICPHLSPLSCFPGDNYRTFKHYYLVKYGLTIQN 1186
Query: 866 QNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNSSTSNIPQASASDSKESNTSVPHSSQ 925
+Q LLDVD TS RLN L PR N+ + S+ T +K N Q
Sbjct: 1187 TSQPLLDVDHTSARLNFLTPRYVNRKGVALPTSSEETKR--------AKRENLE-----Q 1233
Query: 926 RQILVPELMDIHPISATLWNVIAALPSIFYRVNQLLLTDELRETILVK-AFGKEKTKLDD 984
+QILVPEL +HP A+LW LP I YR+N LLL D++R+ + G+++ + D+
Sbjct: 1234 KQILVPELCTVHPFPASLWRTAVCLPCILYRINGLLLADDIRKQVSADLGLGRQQIE-DE 1292
Query: 985 NVEWNSLAYATEYEE--KQTIIVKKIQQLRD--LNQKSIEDQERE-TRENDKID-DGEEL 1038
+ EW L + E K++ K+ + L+D +N K + D E++ T E ++D D ++
Sbjct: 1293 DFEWPMLDFGWSLSEVLKKSRESKQKESLKDDTINGKDLADVEKKPTSEETQLDKDSKD- 1351
Query: 1039 FNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGL-TQGLHDGNIS------DEDD--EL 1089
D E I + I + + +D +G + + D S DEDD L
Sbjct: 1352 ------DKVEKSAIELIIEGEEKLQEADDFIEIGTWSNDMADDIASFNQEDDDEDDAFHL 1405
Query: 1090 PFV-----MHDYTARLTSNR-----NGIGAWSGSESIV--PSGWGDWDGP-EP------- 1129
P + D R S NG + G +S G G GP +P
Sbjct: 1406 PVLPANVKFCDQQTRYGSPTFWDVSNGESGFKGPKSSQNKQGGKGKAKGPAKPTFNYYDS 1465
Query: 1130 DNS-PMPFQILGGPGGLNVQA--LMADVGRVFDPSTASSSLSQTVQES-TVSPPKQLTKE 1185
DNS + G LN +D V D A + E+ T+ +++ K
Sbjct: 1466 DNSLGSSYDDDDNAGPLNYMHHNYSSDDDDVADDIDAGRIAFTSKNEAETIETAQEVEKR 1525
Query: 1186 EEQFKKLQ----NDL-LKQAKERLEALEMS-EDMEKPR--RLEDTV-----NLEDYG--- 1229
++Q +Q N+ +Q K L ED ++P R E+++ +E G
Sbjct: 1526 QKQLSIIQATNANERQYQQTKNLLIGFNFKHEDQKEPATIRYEESIAKLKTEIESGGMLV 1585
Query: 1230 -DDQEN--QEDENTPTNFPKT------------IDEEIEELSIGARKKQEIDD----NAA 1270
DQ+ + + K ++E++ +G R++ + D NA
Sbjct: 1586 PHDQQLVLKRSDAAEAQVAKVSMMELLKQLLPYVNEDVLAKKLGDRRELLLSDLVELNAD 1645
Query: 1271 KTDVLERENCEVLPVA-------------INEKSRSFSFEK-------ESKAINGRLIR- 1309
E+E V+ ++EK +E+ +KAI ++
Sbjct: 1646 WVARHEQETYNVMGCGDSFDNYNDHHRLNLDEKQLKLQYERIEIEPPTSTKAITSAILPA 1705
Query: 1310 ----QRSEEYVSHIDSDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDY 1365
R + V H G SP ++L ALT SNA DG++LER ETIGDSFLK+A T Y
Sbjct: 1706 GFSFDRQPDLVGHP------GPSPSIILQALTMSNANDGINLERLETIGDSFLKYAITTY 1759
Query: 1366 LYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCY-IPT- 1423
LY T + HEGKLS RSK+V+N NLYRLG++ + + ++A KF+ HD+WLPPCY +P
Sbjct: 1760 LYITYENVHEGKLSHLRSKQVANLNLYRLGRRKRLGEYMIATKFEPHDNWLPPCYYVPKE 1819
Query: 1424 -----CDFKAPNTDDAEEKDN-EIERILDGQVIEEKPE--NKTGWDIGGDVSKSTTDGIE 1475
+ K P T + D +I+ + Q+ E E + G + G D
Sbjct: 1820 LEKALIEAKIP-THHWKLADLLDIKNLSSVQICEMVREKADALGLEQNGGAQNGQLDDSN 1878
Query: 1476 TITFPKQARVGNDDISPLPYNLLTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWM 1535
ND +PYNL++Q I DKSIAD VEALIG +L+ GP L M W+
Sbjct: 1879 DSC--------NDFSCFIPYNLVSQHSIPDKSIADCVEALIGAYLIECGPRGALLFMAWL 1930
Query: 1536 GLKVI----QKD---QKSDVPS---PLLRFIDT-----PTNPNASLNFLNNLWQQFQ--- 1577
G++V+ Q D Q+ +P P + T PT + L+F N ++
Sbjct: 1931 GVRVLPITRQLDGGNQEQRIPGSTKPNAENVVTVYGAWPTPRSPLLHFAPNATEELDQLL 1990
Query: 1578 --FTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFED 1635
F + EE +GY+F++R+YL+QA THASY NR+T CYQRLEFLGDAVLDY+ITR+L+ED
Sbjct: 1991 SGFEEFEESLGYKFRDRSYLLQAMTHASYTPNRLTDCYQRLEFLGDAVLDYLITRHLYED 2050
Query: 1636 SRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHMIEKFVKLCSERNFDT 1695
RQ+SPG LTDLRSALVNNTIFASLAV+ F K F + PGL +I++FV++ E
Sbjct: 2051 PRQHSPGALTDLRSALVNNTIFASLAVRHGFHKFFRHLSPGLNDVIDRFVRIQQENG--- 2107
Query: 1696 NFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSGRNLDTTWQVIFHMMR 1755
+ +E Y + +EEE D+ ED+EVPKA+GD+FES+AGAI+LDS +LD W V +MM
Sbjct: 2108 HCISEEYYLLSEEECDDA--EDVEVPKALGDVFESIAGAIFLDSNMSLDVVWHVYSNMMS 2165
Query: 1756 GTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVEVVNNMRFTGMGRNYR 1815
IE + P+SPIREL+E E +F K E++ + +VRVTV+V F G+GRNYR
Sbjct: 2166 PEIEQFSNSVPKSPIRELLELEPETAKFGKPEKLADGRRVRVTVDVFCKGTFRGIGRNYR 2225
Query: 1816 IAKATAAKRALKYL 1829
IAK TAAK AL+ L
Sbjct: 2226 IAKCTAAKCALRQL 2239
Score = 253 (94.1 bits), Expect = 1.5e-232, Sum P(3) = 1.5e-232
Identities = 95/376 (25%), Positives = 169/376 (44%)
Links = (2)-3-1
Query: 11 FNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVE 70
F PRD+QVELL A ++NTI+ LG S K FIA+ LL+E + G + E
Sbjct: 15 FTPRDFQVELLATAYERNTIICLGHRSSKEFIALKLLQELSRRARR---HGRVSVYLSCE 71
Query: 71 KVNLVEQQAIHIEV-H-TSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDL 128
E +I+ + H T +V Q D + D +HV ++ + L L
Sbjct: 72 VGTSTEPCSIYTMLTHLTDLRVWQEQP-------DMQIPFDHCWTDYHVSILRPEGFLYL 124
Query: 129 IRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKV 188
+ L + + +++ ++CH + Q R + ++ + PR+LGL L A
Sbjct: 125 LETRELLLSSVELIVLEDCHDSAVYQR-IRPLFENHIMPAPPADRPRILGLAGPLHSAGC 183
Query: 189 APEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVI 248
++L L LE ++ IETASD+V++ +Y ++P+E ++ C FE+ L + D +
Sbjct: 184 ELQQLSAMLATLEQSVLCQIETASDIVTVLRYCSRPHEYIVQCAPFEMDELSLVLADVLN 243
Query: 249 E----IFDETVA--FVNTTTEFHPDL-DL-DPRRPIKDSLKTTRAVFRQLGPWAAWRTAQ 300
+ D + T +F +L D+ DP+ + + + V ++GPW R A
Sbjct: 244 THKSFLLDHRYDPYEIYGTDQFMDELKDIPDPKVDPLNVINSLLVVLHEMGPWCTQRAAH 303
Query: 301 VWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKK-----IKSIEALRPYVP 355
+ + + +K + ++ + T++I + L E + S + + Y
Sbjct: 304 HFY-QCNEKLKVKTPHERHYLLYCLVSTALIQLYSLCEHAFHRHLGSGSDSRQTIERYSS 362
Query: 356 QRVIRLFEILETFNPE 371
+V RL + L F PE
Sbjct: 363 PKVRRLLQTLRCFKPE 378
Score = 238 (88.8 bits), Expect = 1.5e-232, Sum P(3) = 1.5e-232
Identities = 51/125 (40%), Positives = 76/125 (60%)
Links = 2-(3)-1
Query: 382 AEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVG-ASGRNLASSDSQGLHK 440
++ L A+I+ +Q + A L ++ I +P KF+ Y + +++ H+
Sbjct: 490 SDTLCALIYCNQNHTARVLFELLAEISRRDPDLKFLRCQYTTDRVADPTTEPKEAELEHR 549
Query: 441 RQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSR 500
RQ EVL+RF ++ N LI TSVLEEG+DV +CNLV+++D P RSYVQ KGRAR A +
Sbjct: 550 RQEEVLKRFRMHDCNVLIGTSVLEEGIDVPKCNLVVRWDPPTTYRSYVQCKGRARAAPAY 609
Query: 501 YVITV 505
+VI V
Sbjct: 610 HVILV 614
Score = 44 (20.5 bits), Expect = 4.4e-212, Sum P(3) = 4.4e-212
Identities = 10/34 (29%), Positives = 17/34 (50%)
Links = 2-(4)-1
Query: 580 RQLHLEGELDDNLLPKGRESIAKLLEHIDEEPDE 613
R H + D N L ES ++++ +D+ P E
Sbjct: 389 RMRHQVDQADFNRLSHTLESKCRMVDQMDQPPTE 422
>sp|Q9UPY3.2|DICER_HUMAN RecName: Full=Endoribonuclease Dicer; AltName:
Full=Helicase with RNase motif; Short=Helicase MOI
Length = 1912
Score = 2152 (762.6 bits), Expect = 6.4e-223, P = 6.4e-223
Identities = 706/2058 (34%), Positives = 1011/2058 (49%)
Links = (1)
Query: 11 FNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVE 70
+ PR YQVELL+ A NTIV L TGSGKTFIAVLL KE Q+ + GKR F+V
Sbjct: 32 YTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVN 91
Query: 71 KVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIR 130
N V QQ + H+ KVG+ + W +KE+ +Q +H V+++T L++++
Sbjct: 92 SANQVAQQVSAVRTHSDLKVGEYSNLEVNASW-TKERWNQEFTKHQVLIMTCYVALNVLK 150
Query: 131 HAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVAP 190
+ YL + D+ +L+FDECH A+ HPYR IM KL + PR+LGLTAS++ K P
Sbjct: 151 NGYLSLSDINLLVFDECHLAI-LDHPYREIM---KLCENCPSCPRILGLTASILNGKCDP 206
Query: 191 EKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIEI 250
E+L E+++KLE + S ETA+DLV L +Y ++P E+V+ C F G+ ++ ++
Sbjct: 207 EELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRS-GL--YERLLME 263
Query: 251 FDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKII 310
+E + F+N + D K L RAV LGPW A + A + +EL K I
Sbjct: 264 LEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYI 323
Query: 311 KSQVLPDKTLRFLNMAKTSMITIKRLLEPEM------------KKIKSIEALRPYVPQRV 358
K + + +FL T + I L E K IK +E LR Y P
Sbjct: 324 KHEQ-EELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYER 382
Query: 359 IRLFEILETFN------------PEFQKERMKLEKAEH------------LSAIIFVDQR 394
+ FE +E +N E E ++E+ E L IIFV++R
Sbjct: 383 -QQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERR 441
Query: 395 YIAYSLLLMMRHIKSWEPKFKFVNPDYVVGAS-GRNLA-SSDSQGLHKRQTEVLRRFHRN 452
Y A L +++ +P+ +++ +++ G G+N + + ++Q EVLR+F +
Sbjct: 442 YTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAH 501
Query: 453 EINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVE------ 506
E N LIATS++EEGVD+ +CNLV++FD P + RSYVQSKGRAR S Y++ +
Sbjct: 502 ETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKS 561
Query: 507 -EKD-----------------------------------------------------TAA 512
E+D TA
Sbjct: 562 FEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAI 621
Query: 513 -----YCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNK 567
YC++LPSD FT L P + + + T Y + L LPINSP++ +IV PM
Sbjct: 622 GHINRYCARLPSDPFTHLAPKCRTRELPDG--TFY-STLYLPINSPLRASIV-GPPMSCV 677
Query: 568 KTAQMAVALEACRQLHLEGELDDNLLPKGRESIAKLLEHIDEEPDEYAPGIAAKVGSSKR 627
+ A+ VAL C +LH GELDD+L+P G+E++ K E +D DE + + GS+KR
Sbjct: 678 RLAERVVALICCEKLHKIGELDDHLMPVGKETV-KYEEELDLH-DEEETSVPGRPGSTKR 735
Query: 628 KQLYDKKIARALNESFVEADKECFIYAFELERFREAELTLNPKRRKFEDPFNYEYCFGFL 687
+Q Y K I L +S+ D+ C++Y + LN +RRK P + CFG L
Sbjct: 736 RQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGIL 795
Query: 688 SAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMCKTGN 747
+AK IP+IP FPV+ R G + + + + ++ L+ I H Y+F+ +L++ K
Sbjct: 796 TAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPA- 854
Query: 748 LEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQ--YKF 805
LEF T +A ++PLN D + I+ K++ ++ + E IP + ++ + F
Sbjct: 855 LEFKPT-DADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKS-EARIGIPSTKYTKETPFVF 912
Query: 806 NAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLEIYD 865
EDY+DA+++P YRN +QP +YVA++ + P SKFP +ETF EY+ KY L++ +
Sbjct: 913 KLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTN 972
Query: 866 QNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNSSTSNIPQASASDSKESNTSVPHSSQ 925
NQ LLDVD TS+RLNLL PR NQ ++ +P +SA K S+ +
Sbjct: 973 LNQPLLDVDHTSSRLNLLTPRHLNQKGKA----------LPLSSAEKRKAKWESLQN--- 1019
Query: 926 RQILVPELMDIHPISATLWNVIAALPSIFYRVNQLLLTDELRETILVKAFGKEKTKLDDN 985
+QILVPEL IHPI A+LW LPSI YR++ LL +ELR +T D
Sbjct: 1020 KQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRA----------QTASDAG 1069
Query: 986 VEWNSLAYATEYEEKQTIIVKKIQQLRDLNQKSIEDQERETRENDKIDDGEELFNIGVWD 1045
V SL Y K I ++ I + END +
Sbjct: 1070 VGVRSLPADFRYPNLDFGWKKSID-----SKSFISISNSSSAENDNYCKHSTIV------ 1118
Query: 1046 PEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDGNISDEDDELPFVMHDYTARLTSNRN 1105
PE A G ++R ++ DQ +V L
Sbjct: 1119 PENAAHQG---ANRTSSLENHDQMSVNCRTLL---------------------------- 1147
Query: 1106 GIGAWSGSESIVPSGWGDWDGPEPDNSPMPFQILGGPGGLNVQALMADVGRVFDPSTASS 1165
SES PG L+V+ + AD+ TA +
Sbjct: 1148 -------SES--------------------------PGKLHVE-VSADL-------TAIN 1166
Query: 1166 SLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQAKERLEALEMSEDMEKPRRLEDTVNL 1225
LS ++ + L + F Q + L K+ + +P NL
Sbjct: 1167 GLSYN--QNLANGSYDLANRD--F--CQGNQLNYYKQEIPV--------QPTTSYSIQNL 1212
Query: 1226 EDYGDDQENQEDENTPTNFPKTIDEEIEELSIGARKKQEIDDNAAKTDVLERENCEVLPV 1285
Y ENQ P+ DE ++ + K +D NA K+ V+P
Sbjct: 1213 YSY----ENQ---------PQPSDE----CTLLSNKY--LDGNANKSTSDGSPVMAVMPG 1253
Query: 1286 AINEKSRSFSFEKESKAINGRLIRQRSEEYVSHIDSDIGLGVSPCLLLTALTTSNAADGM 1345
+ + + GR+ ++S + + S LG +P L+L ALT SNA+DG
Sbjct: 1254 TTDT----------IQVLKGRMDSEQSPS-IGY--SSRTLGPNPGLILQALTLSNASDGF 1300
Query: 1346 SLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIV 1405
+LER E +GDSFLK A T YL+ T D HEG+LS+ RSK+VSNCNLYRLGKK G+P +V
Sbjct: 1301 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMV 1360
Query: 1406 ANKFDAHDSWLPPCYIPTCDFKAPNTD--------------------DAEEKDNEIERIL 1445
+ FD +WLPP Y+ D K+ NTD D EE+D E E ++
Sbjct: 1361 VSIFDPPVNWLPPGYVVNQD-KS-NTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLM 1418
Query: 1446 ----------DGQVIEEKPENKTGWD-----IGGDVSK------STTDGIETITFPKQAR 1484
+ +E E+ D G V K STTD PK++
Sbjct: 1419 WRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSS 1478
Query: 1485 VGN-----------------------------DDI-----SP-------------LPYNL 1497
+G+ DD +P + Y+L
Sbjct: 1479 LGSMPFSSDFEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDL 1538
Query: 1498 LTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSD-----VP--- 1549
T+Q I+DKSIAD VEAL+G +L + G + +GLKV+ +++D P
Sbjct: 1539 HTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRE 1598
Query: 1550 ----------------------SPLLR-----FIDTPT-----NPNASLNFLNNLWQQFQ 1577
S +L+ + P +P+A LN+L F+
Sbjct: 1599 NFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKT-LNHLISGFE 1657
Query: 1578 FTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFEDSR 1637
E+KI YRFK +AYL+QAFTHASY N +T CYQRLEFLGDA+LDY+IT++L+ED R
Sbjct: 1658 --NFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPR 1715
Query: 1638 QYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHMIEKFVKLCSERNFDTNF 1697
Q+SPGVLTDLRSALVNNTIFASLAVK+++ K+F A+ P L+H+I+ FV+ E+N
Sbjct: 1716 QHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGM 1775
Query: 1698 NAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSGRNLDTTWQVIFHMMRGT 1757
++E+ +EE DE +EEDIEVPKAMGDIFES+AGAIY+DSG +L+T WQV + MMR
Sbjct: 1776 DSELRR--SEE--DEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPL 1831
Query: 1758 IELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVEVVNNMRFTGMGRNYRIA 1817
IE AN PRSP+REL+E E +FS ER + GKVRVTVEVV +F G+GR+YRIA
Sbjct: 1832 IEKFSANVPRSPVRELLEMEPETAKFSPAERTYD-GKVRVTVEVVGKGKFKGVGRSYRIA 1890
Query: 1818 KATAAKRALKYLHQIEQQ 1835
K+ AA+RAL+ L + Q
Sbjct: 1891 KSAAARRALRSLKANQPQ 1908
>sp|Q8R418.2|DICER_MOUSE RecName: Full=Endoribonuclease Dicer; AltName:
Full=Double-strand-specific ribonuclease mDCR-1
Length = 1906
Score = 2120 (751.3 bits), Expect = 1.6e-219, P = 1.6e-219
Identities = 698/2050 (34%), Positives = 1005/2050 (49%)
Links = (1)
Query: 11 FNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVE 70
+ PR YQVELL+ A NTIV L TGSGKTFIAVLL KE Q+ L+ KR F+V
Sbjct: 32 YTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELAHQIRGDLNPHAKRTVFLVN 91
Query: 71 KVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIR 130
N V QQ + H+ KVG+ + W +KE+ Q +H V+++T L +++
Sbjct: 92 SANQVAQQVSAVRTHSDLKVGEYSDLEVNASW-TKERWSQEFTKHQVLIMTCYVALTVLK 150
Query: 131 HAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVAP 190
+ YL + D+ +L+FDECH A+ HPYR IM KL + PR+LGLTAS++ K P
Sbjct: 151 NGYLSLSDINLLVFDECHLAI-LDHPYREIM---KLCESCPSCPRILGLTASILNGKCDP 206
Query: 191 EKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIEI 250
E+L E+++KLE + S ETA+DLV L +Y ++P E+V+ C F G+ ++ ++
Sbjct: 207 EELEEKIQKLERILRSDAETATDLVVLDRYTSQPCEIVVDCGPFTDRS-GL--YERLLME 263
Query: 251 FDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKII 310
+ + F+N + D K L RAV LGPW A + A + +EL K I
Sbjct: 264 LEAALDFINDCNVAVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYI 323
Query: 311 KSQVLPDKTLRFLNMAKTSMITIKRLLE----P---EMKKI-----KSIEALRPYVPQRV 358
K + + +FL T + I L E P ++K + K +E LR Y P
Sbjct: 324 KHEQ-EELHRKFLLFTDTLLRKIHALCEEYFSPASLDLKYVTPKVMKLLEILRKYKPYER 382
Query: 359 IRLFEILETFNPEFQ---------------KERMKLEKAEH---------LSAIIFVDQR 394
+ FE +E +N Q +E + EK E L IIFV++R
Sbjct: 383 -QQFESVEWYNNRNQDNYVSWSDSEDDDDDEEIEEKEKPETNFPSPFTNILCGIIFVERR 441
Query: 395 YIAYSLLLMMRHIKSWEPKFKFVNPDYVVGAS-GRNLA-SSDSQGLHKRQTEVLRRFHRN 452
Y A L +++ +P+ +++ +++ G G+N S + ++Q EVLR+F +
Sbjct: 442 YTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRSKQMEAEFRKQEEVLRKFRAH 501
Query: 453 EINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVIT-------- 504
E N LIATSV+EEGVD+ +CNLV++FD P + RSYVQSKGRAR S YV+
Sbjct: 502 ETNLLIATSVVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLADTDKIKS 561
Query: 505 ---------------------------------VEEKD-------------------TAA 512
V+++D TA
Sbjct: 562 FEEDLKTYKAIEKILRNKCSKSADGAEADVHAGVDDEDAFPPYVLRPDDGGPRVTINTAI 621
Query: 513 -----YCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNK 567
YC++LPSD FT L P + + + T Y + L LPINSP++ +IV PM +
Sbjct: 622 GHINRYCARLPSDPFTHLAPKCRTRELPDG--TFY-STLYLPINSPLRASIV-GPPMDSV 677
Query: 568 KTAQMAVALEACRQLHLEGELDDNLLPKGRESIAKLLEHIDEEPDEYAPGIAAKVGSSKR 627
+ A+ VAL C +LH GELD++L+P G+E++ K E +D DE + + GS+KR
Sbjct: 678 RLAERVVALICCEKLHKIGELDEHLMPVGKETV-KYEEELDLH-DEEETSVPGRPGSTKR 735
Query: 628 KQLYDKKIARALNESFVEADKECFIYAFELERFREAELTLNPKRRKFEDPFNYEYCFGFL 687
+Q Y K I L ES+ + D+ C++Y + LN +RRK P + CFG L
Sbjct: 736 RQCYPKAIPECLRESYPKPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGIL 795
Query: 688 SAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMCKTGN 747
+AK IP+IP FPV+ R G + + + + T++ L+ I H Y+F+ +L++ K
Sbjct: 796 TAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSQQMLELITRLHQYIFSHILRLEKPA- 854
Query: 748 LEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQ--YKF 805
LEF T A ++PLN D + I+ K++ ++ + E IP + ++ + F
Sbjct: 855 LEFKPTG-AESAYCVLPLNVVNDSGTLDIDFKFMEDIEKS-EARIGIPSTKYSKETPFVF 912
Query: 806 NAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLEIYD 865
EDY+DA+++P YRN +QP +YVA++ + P SKFP +ETF EY+ KY L++ +
Sbjct: 913 KLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTN 972
Query: 866 QNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNSSTSNIPQASASDSKESNTSVPHSSQ 925
NQ LLDVD TS+RLNLL PR NQ ++ +P +SA K S+ +
Sbjct: 973 LNQPLLDVDHTSSRLNLLTPRHLNQKGKA----------LPLSSAEKRKAKWESLQN--- 1019
Query: 926 RQILVPELMDIHPISATLWNVIAALPSIFYRVNQLLLTDELRETILVKAFGKEKTKLDDN 985
+QILVPEL IHPI A+LW LPSI YR++ LL +ELR A G L +
Sbjct: 1020 KQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDA-GVGVRSLPVD 1078
Query: 986 VEWNSLAYATEYEEKQTIIVKKIQQLRDLNQKSIEDQERETRENDKIDDGEELFNIGVWD 1045
+ +L ++ K++I K + N S+ + + + + +
Sbjct: 1079 FRYPNL----DFGWKKSIDSKSF--ISTCNS-SLAESDNYCKHSTTVV------------ 1119
Query: 1046 PEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDGNISDEDDELPFVMHDYTARLTSNRN 1105
PE A G S ++ DQ +V RL
Sbjct: 1120 PEHAAHQGATRPS----LENHDQMSVNCK------------------------RL----- 1146
Query: 1106 GIGAWSGSESIVPSGWGDWDGPEPDNSPMPFQILGGPGGLNVQALMADVGRVFDPSTASS 1165
P SP Q + D+ TA +
Sbjct: 1147 -----------------------PAESPAKLQ----------SEVSTDL-------TAIN 1166
Query: 1166 SLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQAKERLEALEMSEDMEKPRRLEDTVNL 1225
LS ++ + L + F Q + L K+ + +P NL
Sbjct: 1167 GLSYN--KNLANGSYDLVNRD--F--CQGNQLNYFKQEIPV--------QPTTSYPIQNL 1212
Query: 1226 EDYGDDQENQEDENTPTNFPKTIDEEIEELSIGARKKQEIDDNAAKTDVLERENCEVLPV 1285
+Y ENQ P+N E LS +D NA + +P
Sbjct: 1213 YNY----ENQPK---PSN-------ECPLLS-----NTYLDGNANTSTSDGSPAVSTMPA 1253
Query: 1286 AINEKSRSFSFEKESKAINGRLIRQRSEEYVSHIDSDIGLGVSPCLLLTALTTSNAADGM 1345
+N KA+ R+ ++S V + S LG +P L+L ALT SNA+DG
Sbjct: 1254 MMNAV----------KALKDRMDSEQSPS-VGY--SSRTLGPNPGLILQALTLSNASDGF 1300
Query: 1346 SLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIV 1405
+LER E +GDSFLK A T YL+ T D HEG+LS+ RSK+VSNCNLYRLGKK G+P +V
Sbjct: 1301 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMV 1360
Query: 1406 ANKFDAHDSWLPPCYI----------------------------PTCD------FKAPNT 1431
+ FD +WLPP Y+ C+ ++AP
Sbjct: 1361 VSIFDPPVNWLPPGYVVNQDKSNSEKWEKDEMTKDCLLANGKLGEACEEEEDLTWRAPK- 1419
Query: 1432 DDAEEKDNEIE------RILDGQVI---------------------EEKPENK------- 1457
++AE++D+ +E + +D ++ E K K
Sbjct: 1420 EEAEDEDDFLEYDQEHIQFIDSMLMGSGAFVRKISLSPFSASDSAYEWKMPKKASLGSMP 1479
Query: 1458 ----------TGWDIGG--DVSKSTTDGIETITF--PKQARVGNDD-ISPLPYNLLTQQH 1502
+ WD D SK+ + + F P + G D + Y+L T+Q
Sbjct: 1480 FASGLEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQC 1539
Query: 1503 ISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKV---IQKDQKSDVPSP-------- 1551
I+DKSIAD VEAL+G +L + G + +GLKV I++ + P
Sbjct: 1540 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTSREKALDPAQENGSSQ 1599
Query: 1552 ---LLRFIDTPTNPNAS----LNF-------------------LNNLWQQFQFTQLEEKI 1585
L P P +S L + LN+L F+ E+KI
Sbjct: 1600 QKSLSGSCAAPVGPRSSAGKDLEYGCLKIPPRCMFDHPDAEKTLNHLISGFE--TFEKKI 1657
Query: 1586 GYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLT 1645
YRFK +AYL+QAFTHASY N +T CYQRLEFLGDA+LDY+IT++L+ED RQ+SPGVLT
Sbjct: 1658 NYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLT 1717
Query: 1646 DLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVT 1705
DLRSALVNNTIFASLAVK+++ K+F A+ P L+H+I+ FVK E+N ++E+
Sbjct: 1718 DLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRR-- 1775
Query: 1706 TEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSGRNLDTTWQVIFHMMRGTIELCCANP 1765
+EE DE +EEDIEVPKAMGDIFES+AGAIY+DSG +L+ WQV + MM+ IE AN
Sbjct: 1776 SEE--DEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANV 1833
Query: 1766 PRSPIRELMEFEQSKVRFSKMERILESGKVRVTVEVVNNMRFTGMGRNYRIAKATAAKRA 1825
PRSP+REL+E E +FS ER + GKVRVTVEVV +F G+GR+YRIAK+ AA+RA
Sbjct: 1834 PRSPVRELLEMEPETAKFSPAERTYD-GKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRA 1892
Query: 1826 LKYLHQIEQQ 1835
L+ L + Q
Sbjct: 1893 LRSLKANQPQ 1902
>sp|P84634.1|DCL4_ARATH RecName: Full=Dicer-like protein 4
Length = 1589
Score = 471 (170.9 bits), Expect = 8.6e-72, Sum P(5) = 8.6e-72
Identities = 201/689 (29%), Positives = 323/689 (46%)
Links = (1)-4-3-2-5
Query: 14 RDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVN 73
R YQVEL KAT++N IV LGTG GKT IAV+L+ E G + +P F+ V
Sbjct: 125 RRYQVELCKKATEENVIVYLGTGCGKTHIAVMLIYELGHLVLSPKKSV---CIFLAPTVA 181
Query: 74 LVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAY 133
LVEQQA I +FKV +H + S + ++ + + V+V+T Q LL ++H +
Sbjct: 182 LVEQQAKVIADSVNFKVA-IHCG-GKRIVKSHSEWEREIAANEVLVMTPQILLHNLQHCF 239
Query: 134 LKIEDMCVLIFDECHHALG-SQHPYRSIM-VDYKLLKKDKPVPRVLGLTASLIKAKVAPE 191
+K+E + +LIFDECHHA S HPY IM V YK +P R+ G+TAS + K P
Sbjct: 240 IKMECISLLIFDECHHAQQQSNHPYAEIMKVFYKSESLQRP--RIFGMTASPVVGKDGPP 297
Query: 192 KLMEQLKKLESAMDSVIETASDLVSLSKY-GAKPYEVVIICKDFEIGCLGIPNFDTV-IE 249
++ + S + + SL AK Y V + + G + V +
Sbjct: 298 --LDSFTYFSGSFQSE-NLSKSINSLENLLNAKVYSV-----ESNVQLDGFVSSPLVKVY 349
Query: 250 IFDETVAFVNTTTEFHPDL--DLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELG 307
+ ++ + +T + ++ D+ RR L+ A QL V ++ +G
Sbjct: 350 YYRSALSDASQSTIRYENMLEDIKQRRANVYCLRFLEAAKIQLNS-----DHNVQDEPVG 404
Query: 308 KIIKSQVLPDKTLRFLNMAKTSMIT-IKRLLEPEMKKIKSIEALR-PYVPQRVIRLFEIL 365
K KS++ +L+MA ++ + + + + + S+ AL+ P +++++L +IL
Sbjct: 405 KNPKSKICDT----YLSMAAEALSSGVAK--DENASDLLSLAALKEPLFSRKLVQLIKIL 458
Query: 366 ETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHI---KSWEPKFKFVNPDYV 422
F +LE H+ IIFV++ A +L ++ ++ +SW+ D++
Sbjct: 459 SVF---------RLEP--HMKCIIFVNRIVTARTLSCILNNLELLRSWKS-------DFL 500
Query: 423 VGASGRNLASSDSQGLHKRQTE-VLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRP 481
VG S S + + +R E +L+RF E+N L+AT V EEG+D++ C LVI++D P
Sbjct: 501 VGLS------SGLKSMSRRSMETILKRFQSKELNLLVATKVGEEGLDIQTCCLVIRYDLP 554
Query: 482 LDMRSYVQSKGRARRAGSRYVITVE---EKD----------------------------- 509
+ S++QS+GRAR S Y V+ EK+
Sbjct: 555 ETVTSFIQSRGRARMPQSEYAFLVDSGNEKEMDLIENFKVNEDRMNLEITYRSSEETCPR 614
Query: 510 ----------TAA-------------YCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAEL 546
T A YCS+LP D F + P Q P++E G T C +
Sbjct: 615 LDEELYKVHETGACISGGSSISLLYKYCSRLPHDEFFQPKPEFQFKPVDEFGGT-IC-RI 672
Query: 547 LLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESIAKLLEH 606
LP N+PI + + +P+ + A+ L+A +LH G L+D LLP ++ I L
Sbjct: 673 TLPANAPISE--IESSLLPSTEAAKKDACLKAVHELHNLGVLNDFLLPDSKDEIEDELS- 729
Query: 607 IDEEPDEYAPGIAAKVGSSKRKQLYDKKI 635
D+E D I + G S R LY+ ++
Sbjct: 730 -DDEFD--FDNIKGE-GCS-RGDLYEMRV 753
Score = 290 (107.1 bits), Expect = 8.6e-72, Sum P(5) = 8.6e-72
Identities = 76/182 (41%), Positives = 99/182 (54%)
Links = 1-4-3-(2)-5
Query: 1506 KSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKV-IQKDQKSDVPSPLLRFIDTPTNPNA 1564
K+IAD VEAL+G L+ G +K + W+G+ V + Q D R++ T
Sbjct: 1162 KTIADVVEALVGAFLVDSGFKGAVKFLKWIGVNVDFESLQVQDACIASRRYLPLTTR--- 1218
Query: 1565 SLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVL 1624
NNL LE ++ Y+F + LVQAF H SY N GCYQRLEFLGDAVL
Sbjct: 1219 -----NNL------ETLENQLDYKFLHKGLLVQAFIHPSY-NRHGGGCYQRLEFLGDAVL 1266
Query: 1625 DYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLY-H-MIE 1682
DY++T Y F + PG LTDLRS VNN A++AV F K F+ C +Y H +IE
Sbjct: 1267 DYLMTSYFFTVFPKLKPGQLTDLRSLSVNNEALANVAVSFSL-KRFL-FCESIYLHEVIE 1324
Query: 1683 KF 1684
+
Sbjct: 1325 DY 1326
Score = 109 (43.4 bits), Expect = 8.6e-72, Sum P(5) = 8.6e-72
Identities = 28/59 (47%), Positives = 38/59 (64%)
Links = 1-4-(3)-2-5
Query: 1327 VSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLY--HTLLDQHEGKLSFARS 1383
VS +L ALTT + +SLER E +GD+FLKFA + +L+ H LD EG+L+ RS
Sbjct: 1044 VSGHRVLEALTTEKCHERLSLERLEVLGDAFLKFAVSRHLFLHHDSLD--EGELTRRRS 1100
Score = 58 (25.5 bits), Expect = 8.6e-72, Sum P(5) = 8.6e-72
Identities = 14/42 (33%), Positives = 25/42 (59%)
Links = 1-(4)-3-2-5
Query: 931 PEL--MDIHPISATLWNVIAALPSIFYRVNQLLLTDELRETI 970
PEL + I +S + + ++ LPSI +R+ LL+ EL+ +
Sbjct: 993 PELSHLKIKGLSKDIGSSLSLLPSIMHRMENLLVAIELKHVL 1034
Score = 57 (25.1 bits), Expect = 8.6e-72, Sum P(5) = 8.6e-72
Identities = 22/79 (27%), Positives = 33/79 (41%)
Links = 1-4-3-2-(5)
Query: 1765 PPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVEVVNN---MRFTGMGRNYRIAKATA 1821
P SPI+EL+E QS ++ + G V ++V N + + GRN R A
Sbjct: 1346 PKISPIKELIELCQSYKWDREISATKKDGAFTVELKVTKNGCCLTVSATGRNKREGTKKA 1405
Query: 1822 AKRALKYLHQIEQQRRQSP 1840
A+ + L E P
Sbjct: 1406 AQLMITNLKAHENITTSHP 1424
>sp|Q7S8J7.1|DCL1_NEUCR RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease dcl-1; Includes: RecName: Full=ATP-dependent
helicase dcl-1
Length = 1584
Score = 505 (182.8 bits), Expect = 3.0e-69, Sum P(6) = 3.0e-69
Identities = 164/507 (32%), Positives = 269/507 (53%)
Links = (1)-4-6-3-2-8
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKR--AFFVV 69
+PR+YQVEL ++A ++NTI L TGSGKT IA +LL+ ++G R AFF+V
Sbjct: 121 SPREYQVELFERAKQQNTIAVLDTGSGKTLIAAMLLRWVITGELEDREKGLPRRIAFFLV 180
Query: 70 EKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLI 129
+KV LV QQ + + F + ++ G+ G+ +SK + ++++ VVV TA+ L +
Sbjct: 181 DKVALVFQQHSFLTKNLDFPMEKLCGEMVEGV-ESKAFWKEALEQNEVVVCTAEILSTAL 239
Query: 130 RHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVA 189
H++++++ + +LIFDE HH HPY I+ ++ + ++ + PR+LGLTAS + AKV
Sbjct: 240 HHSWIRMDQINLLIFDEAHHTK-KDHPYARIIKNFYIDEQLERRPRILGLTASPVDAKVD 298
Query: 190 PEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIE 249
P + +L E+ + S I TA+D +L KP +++ ++ G P+ +TV+
Sbjct: 299 PRRAAAEL---EALLHSQIATAADPAALQHTICKPKTELVV--EY---VRGRPDSETVLN 350
Query: 250 IFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKI 309
+ V F ++P+ TT A + LG W A R Q++ K+ I
Sbjct: 351 --KQLRKLVGGQELF--------KKPLNF---TTSAASK-LGTWCADRYWQLFFKQ-EDI 395
Query: 310 IKSQVLPDKTLRFLNMAKTSMIT---IKRLLEP-EMKKIKSIE--ALRP-YVPQRVIRLF 362
+K + ++ L + +A IT +K++ E E+ + AL P + +VI L
Sbjct: 396 VKLESRTERDL--MKVAALDEITEKHVKQVREAHELVNAHTFSPAALDPTMLSSKVIMLV 453
Query: 363 EILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSL--LLMMRHIKSWEPKFKFVNPD 420
IL +F++ A+ IIFV QR A L LL IKS P + +
Sbjct: 454 RILRD---QFERG----VGAQR--CIIFVRQRNTAMLLADLLQQPEIKSHIPS---IAAE 501
Query: 421 YVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDR 480
+VG + +++ ++Q ++R+F EINCL ATSV EEG+D+ CN+VI+FD
Sbjct: 502 VLVGGGTTGSSYVNAKINFQQQNRIIRKFKLGEINCLFATSVAEEGLDIPDCNIVIRFDL 561
Query: 481 PLDMRSYVQSKGRARRAGSRYVITVEE 507
+ +QS+GRARR SRY+ +E+
Sbjct: 562 YDTLIQCIQSRGRARRPDSRYIQMIEK 588
Score = 233 (87.1 bits), Expect = 3.0e-69, Sum P(6) = 3.0e-69
Identities = 81/263 (30%), Positives = 117/263 (44%)
Links = 1-4-6-3-(2)-8
Query: 1500 QQHI-SDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPS--PLLRFI 1556
Q+H+ +DKSIAD EALIG LT G M + + KD+K + S
Sbjct: 1182 QRHVLADKSIADVCEALIGAAYLT-GQEKGSFDMAIKAVTAMVKDKKHRMISYGDYYAVY 1240
Query: 1557 DTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASY--INNRVTGCYQ 1614
PT S N Q+ + E++GY+FK L AF H +Y + R+ YQ
Sbjct: 1241 QKPTWQTESANSA----QRDMAKKFSERMGYKFKHPRLLRAAFQHPTYPSLYERLPS-YQ 1295
Query: 1615 RLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMC 1674
RLEFLGDA+ D + YLF P LT+ + A+V+N L+ F K M
Sbjct: 1296 RLEFLGDALFDMVAVDYLFRKFPAADPQWLTEHKMAMVSNQFLCCLSFHLGFNKCIATMS 1355
Query: 1675 PGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDI----EVPKAMGDIFES 1730
P + I ++V E +T + T +E I +PK + D+ E+
Sbjct: 1356 PSILKDIAEYVTEIEEA-LETAKQEAINAGKTADEYSRDYWVHITHASRLPKCLSDVVEA 1414
Query: 1731 VAGAIYLDSGRNLDTTWQVIFHM 1753
GAI++DS + Q F+M
Sbjct: 1415 YIGAIFVDSEYDYSVV-QNFFNM 1436
Score = 109 (43.4 bits), Expect = 3.0e-69, Sum P(6) = 3.0e-69
Identities = 49/187 (26%), Positives = 86/187 (45%)
Links = 1-4-6-(3)-2-8
Query: 1249 DEEIEELSIGARKKQEIDDNAAKTDVLERENCEVL--PVAINEKSRSFSFEKESKAINGR 1306
D+ + E ++ + ++ +DD DV E + C ++ P+ I+ + + +
Sbjct: 987 DQPVVEAALISTRRDFLDDTLRDEDV-EPQQCFLILEPMRISP----IPADVVAMLLCFP 1041
Query: 1307 LIRQRSEEYVSHIDSD--IGLGVSPCLLLTALTT-SNAAD-----------GM--SLERF 1350
I R E + +D+ +GL + P L L A T S+ +D GM + ER
Sbjct: 1042 SIIHRVESNLVALDACKLLGLDLRPDLALEAFTKDSDNSDEHDAEKENFQTGMGDNYERL 1101
Query: 1351 ETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIVANKFD 1410
E +GDSFLK ATT +Y + D+ E + R + N NL+ ++G+ + I + F+
Sbjct: 1102 EFLGDSFLKMATTIAIYTLIPDKGEFEYHVERMLLICNKNLFNNALEIGLEEYIRSMSFN 1161
Query: 1411 AHDSWLP 1417
W P
Sbjct: 1162 RRQ-WYP 1167
Score = 69 (29.3 bits), Expect = 3.0e-69, Sum P(6) = 3.0e-69
Identities = 28/82 (34%), Positives = 40/82 (48%)
Links = 1-(4)-6-3-2-8
Query: 511 AAYCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTA 570
A + + LP T L P I + G C E+++P SPIK A+ K + +K A
Sbjct: 659 ANFTATLPHPPETSLSPEYYITTVP-GGFQ--C-EVVMPDASPIKSAVG-KVHL-SKGVA 712
Query: 571 QMAVALEACRQLHLEGELDDNL 592
+ A A E C L G LD++L
Sbjct: 713 KCAAAFELCLALLKAGHLDNHL 734
Score = 65 (27.9 bits), Expect = 1.0e-64, Sum P(6) = 1.0e-64
Identities = 21/69 (30%), Positives = 36/69 (52%)
Links = 1-4-6-(5)-2-8
Query: 925 QRQILVPELMDIHPISATLWNVIAALPSIFYRV-NQLLLTD-------ELRETILVKAFG 976
Q+ L+ E M I PI A + ++ PSI +RV + L+ D +LR + ++AF
Sbjct: 1015 QQCFLILEPMRISPIPADVVAMLLCFPSIIHRVESNLVALDACKLLGLDLRPDLALEAFT 1074
Query: 977 KEKTKLDDN 985
K+ D++
Sbjct: 1075 KDSDNSDEH 1083
Score = 49 (22.3 bits), Expect = 3.0e-69, Sum P(6) = 3.0e-69
Identities = 44/220 (20%), Positives = 84/220 (38%)
Links = 1-4-(6)-3-2-8
Query: 687 LSAKEIPKIPPFPVFLRQGNM-KVRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMCKT 745
LS +P++ FP+F KVR + P ++++ F F V
Sbjct: 801 LSRSALPEVASFPLFFGTKRFSKVRCVPIPGSVQADDTLVEQLTRFTLKAFMDVFSK--- 857
Query: 746 GNLEFDGTS-NAPLNTLIVPLN-------KRKDDMSYTINMKYVSEVVANMENMPR--IP 795
E++ T+ N P + P++ + ++ I+ K ++ V N E +P +
Sbjct: 858 ---EYEATAVNLPY--FLSPMDGGHGFDFRLAKSPAHLIDRKALAYVSEN-EKVPYTFLE 911
Query: 796 KDEVRRQYKFNAEDYKDAI-VMPWYRNLEQPVFYYVAE--ILPEWRPSSKFPDTH--FET 850
D+ Q KF + Y A +R + V + + P R TH
Sbjct: 912 PDDFF-QDKFVVDPYDGARKFFTHHRRHDMKPTDPVPDGIVAPNHRAWRGLGTTHDILNY 970
Query: 851 FNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQ 890
N + K I+ +Q +++ STR + L ++++
Sbjct: 971 SNSLWSKSRGFMIFQADQPVVEAALISTRRDFLDDTLRDE 1010
Score = 45 (20.9 bits), Expect = 4.1e-60, Sum P(4) = 4.1e-60
Identities = 25/88 (28%), Positives = 41/88 (46%)
Links = 1-(7)-2-8
Query: 535 EENGVTKYCAELLLPIN-SPIKH---AIVLKNPMPNKKTAQMAVALEACRQLHLEGELDD 590
+E+ + C +L P+ SPI A++L P + VAL+AC+ L L+ D
Sbjct: 1009 DEDVEPQQCFLILEPMRISPIPADVVAMLLCFPSIIHRVESNLVALDACKLLGLDLRPDL 1068
Query: 591 NLLPKGRESIAKLLEHIDEEPDEYAPGI 618
L ++S EH D E + + G+
Sbjct: 1069 ALEAFTKDS-DNSDEH-DAEKENFQTGM 1094
Score = 40 (19.1 bits), Expect = 3.0e-69, Sum P(6) = 3.0e-69
Identities = 10/26 (38%), Positives = 16/26 (61%)
Links = 1-4-6-3-2-(8)
Query: 1815 RIAKATAAKRALKYLH--QIEQQRRQ 1838
R AK+ AK+A+K L +E+ R +
Sbjct: 1529 RYAKSAMAKKAIKLLEGMSVEEFRER 1554
>sp|A4RKC3.2|DCL1_MAGGR RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease DCL1; Includes: RecName: Full=ATP-dependent
helicase DCL1
Length = 1591
Score = 481 (174.4 bits), Expect = 3.5e-69, Sum P(6) = 3.5e-69
Identities = 152/502 (30%), Positives = 238/502 (47%)
Links = (1)-4-5-7-3-2
Query: 13 PRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEY-GVQLFAPLDQGGKR-AFFVVE 70
PR+YQ+EL ++A +KNTI L TG+GKT IA+LL++ ++L A KR FF+V+
Sbjct: 108 PREYQIELFERAKQKNTIAVLDTGTGKTLIAILLIRHIIELELGARWQGREKRITFFLVD 167
Query: 71 KVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIR 130
KV LV QQ HI + F V +HG T LW SKE ++ ++ VVV TA+ L +
Sbjct: 168 KVALVRQQTDHIRANLDFPVTGLHGDTVRNLWYSKEYFEKLLQEQEVVVCTAEILYRCLH 227
Query: 131 HAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKD-KPVPRVLGLTASLIKAKVA 189
+YL I + +++FDE HHA H Y I+ D+ L+++D + PR+ G+TAS I K
Sbjct: 228 RSYLNISQVSLVVFDEAHHAK-KNHVYARIIKDFYLMEEDCQKRPRIFGMTASPIDTKDT 286
Query: 190 PEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIE 249
+LES + S I T SD L G++P EV ++ V+
Sbjct: 287 CISYERATHELESLLHSEIATISDRDLLKVIGSRPQEVR-------------KSYARVLR 333
Query: 250 IFDETVAFVNTTTEFHPDLDLDPRRPI-KDSLKTTRAVFRQLGPWAAWRTAQV-WEKELG 307
E N E L P+ K + + +LG W A + ++ + +E
Sbjct: 334 --QENTELCNQLRE------LVGNHPLFKQTFDSAEFAVTELGAWCADKLWELCFREEAV 385
Query: 308 KIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILET 367
+ +V + R + S + E + ++ P + +++E
Sbjct: 386 STLDGRVEGSRA-RDPDEVGESSHEVSNAREA-LSLVQQWSFSPPEDGSLSTKTHKLIEI 443
Query: 368 FNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSL--LLMMRHIKSWEPKFKFVNPDYVVGA 425
F + + I+FV +R A L L I++ P K +++GA
Sbjct: 444 LAECFSQA----SAGNAIQCIVFVKRRDTAVLLNALCEQAEIRTKIPDLKGA---FLIGA 496
Query: 426 S-GRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDM 484
G N A + + ++Q + + RF EINCL ATS+ EEG+D+ CN+VI+FD
Sbjct: 497 GRGGNAAFTTT----RQQEQTVSRFRDGEINCLFATSIAEEGLDIPGCNVVIRFDLHGTT 552
Query: 485 RSYVQSKGRARRAGSRYVITVE 506
Y+QS+GRAR S ++ E
Sbjct: 553 IQYIQSRGRARMRNSWFIHMTE 574
Score = 251 (93.4 bits), Expect = 3.5e-69, Sum P(6) = 3.5e-69
Identities = 83/256 (32%), Positives = 125/256 (48%)
Links = 1-4-5-7-3-(2)
Query: 1501 QH-ISDKSIADAVEALIGVHLLTL----GPN-----PTLKVMNWMGLKVIQ--KDQKSDV 1548
+H + DKSIAD EALIG LT PN + VM +Q D +
Sbjct: 1166 EHALGDKSIADVCEALIGAAYLTAQAQSSPNFDLAVKAVTVMTHSKTHTMQAWSDYYASY 1225
Query: 1549 PSPLLRFIDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNR 1608
P ++ TP P+ + Q +Q++ K+GYRFK L AF H SY
Sbjct: 1226 QCP--EWLSTP--PSQT--------QLELCSQIKNKMGYRFKNPRLLRCAFMHPSYPRQY 1273
Query: 1609 VT-GCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQ 1667
YQRLEFLGD++LD + YLF+ P LT+ + A+V+N F +AV F
Sbjct: 1274 ENIPSYQRLEFLGDSLLDMVCVDYLFKKHPDKDPQWLTEHKMAMVSNQFFGCVAVGLGFH 1333
Query: 1668 KHFIAMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEV---PKAM 1724
+H I M P L I ++ +L +++ + ++ + + E D ++ IEV PK +
Sbjct: 1334 RHLIHMQPALGGSITEWAELVTKKREEAR---QLAVRRGQREEDYARDFWIEVHHPPKCL 1390
Query: 1725 GDIFESVAGAIYLDSG 1740
DI E+ GA+++D+G
Sbjct: 1391 PDILEAYVGALFVDTG 1406
Score = 99 (39.9 bits), Expect = 3.5e-69, Sum P(6) = 3.5e-69
Identities = 25/75 (33%), Positives = 39/75 (52%)
Links = 1-4-5-7-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQL 1403
G + ER E +GD FLK AT+ LY TL++ E + R ++ N NL + + +
Sbjct: 1079 GQNYERLEFLGDCFLKMATSIALY-TLVEGDEFEYHVERMLDICNKNLLNWALESNLQEH 1137
Query: 1404 IVANKFDAHDSWLPP 1418
I + F+ +W PP
Sbjct: 1138 IRSKSFNRR-TWYPP 1151
Score = 70 (29.7 bits), Expect = 3.5e-69, Sum P(6) = 3.5e-69
Identities = 20/60 (33%), Positives = 34/60 (56%)
Links = 1-(4)-5-7-3-2
Query: 545 ELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESIAKLL 604
E+ LP +SP++ A + +K+ A+ A A C QL+ LDD+L + ++AK+L
Sbjct: 674 EVYLPASSPLRSA--MGGVYRSKQLAKCAAAYAMCIQLYNSNYLDDHL----KSTLAKVL 727
Score = 65 (27.9 bits), Expect = 3.5e-69, Sum P(6) = 3.5e-69
Identities = 35/168 (20%), Positives = 70/168 (41%)
Links = 1-4-(5)-7-3-2
Query: 687 LSAKEIPKIPPFPVFLRQGNMK---VRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMC 743
L+ K +P+I FP+F +G+ + VR I + T Q++ I F +F +
Sbjct: 786 LTRKPLPEIAQFPLFFGKGSSRRSNVRCIPLAHPWSPTTTQVEGICAFTLCIFRDIFSK- 844
Query: 744 KTGNLEFDGTSNAPLNTLIVPLN--KRKDDMSYTINMKYVSE--VVANMENMPRIPKDEV 799
+ + GT + P + P + D+S +N + + + V R+P
Sbjct: 845 ---DFQASGT-DMPY--FLAPSTGIEHGTDLSSLVNPERIIDWATVHRTTTTDRVP---- 894
Query: 800 RRQYKFNAED--YKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPD 845
Y FN D ++D V + + +++ ++ + +P K P+
Sbjct: 895 ---YNFNEPDEFFQDKYVSDPFDGSRK---FFMRKVRRDLKPQDKVPE 936
Score = 51 (23.0 bits), Expect = 3.9e-66, Sum P(4) = 3.9e-66
Identities = 33/139 (23%), Positives = 58/139 (41%)
Links = 1-(6)-3-2
Query: 490 SKGRA-RRAGSRYVITVEEKDTAAYCSKLPSDIF-TRLVPHNQIIPIEENGV------TK 541
SK RA Y +++ +K A + S+ + L P + + E +G T
Sbjct: 942 SKWRAVEHTILNYSVSLWKKSRAGHNSRQDQPVVEAELAPLRRNLLDETDGENSTGPQTC 1001
Query: 542 YCA-ELLLPINSPIKHAIVLKN-PMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRES 599
Y E LL P+ ++ P + ++LEAC+ L L+ +D L+ ++S
Sbjct: 1002 YLVLETLLISQIPVDTVVMAYTFPAIIYRLENSLISLEACQNLGLDIPIDIALIAMTKDS 1061
Query: 600 IAKLLEHIDEEPDEYAPGI 618
+H DE P + G+
Sbjct: 1062 -DNSDDH-DEAPINFQSGM 1078
Score = 40 (19.1 bits), Expect = 3.5e-69, Sum P(6) = 3.5e-69
Identities = 8/26 (30%), Positives = 13/26 (50%)
Links = 1-4-5-(7)-3-2
Query: 1231 DQENQED-ENTPTNFPKTIDEEIEEL 1255
D +N +D + P NF + + E L
Sbjct: 1060 DSDNSDDHDEAPINFQSGMGQNYERL 1085
>sp|Q0CW42.2|DCL1_ASPTN RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease dcl1; Includes: RecName: Full=ATP-dependent
helicase dcl1
Length = 1519
Score = 464 (168.4 bits), Expect = 4.8e-65, Sum P(6) = 4.8e-65
Identities = 159/512 (31%), Positives = 242/512 (47%)
Links = (1)-4-5-9-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEY-GVQLFAPLDQGGKR-AFFVV 69
NPR+YQ+EL ++A +NTI L TGSGKT IAVLLLK +L + R +FF+V
Sbjct: 108 NPREYQIELFERAKVQNTIAVLDTGSGKTLIAVLLLKHVIQTELIDRANGNPPRISFFLV 167
Query: 70 EKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLI 129
+ V LV QQA + + V G LW+ + + F K + V+V TA+ L +
Sbjct: 168 DSVTLVYQQASVLRNNLDQNVAHFFGAMGVDLWNKQTWAEHFEK-NMVIVCTAEILNQCL 226
Query: 130 RHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVA 189
+AY+ ++ + +L+FDE HH HPY I+ D L PR+ G+TAS + K
Sbjct: 227 LNAYITMQQINLLVFDEAHHTK-KDHPYARIIRDSYLRVPPSSRPRIFGMTASPVDTK-- 283
Query: 190 PEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIE 249
++E + LE+ +DS I T S L L + +P E V I + P F + +
Sbjct: 284 -GDVLEAARNLEALLDSKIATTSKLTILRQVVNRPNEEVWIYDKLQ------PTFTSDLY 336
Query: 250 IFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKI 309
E+ F L+P + R +LG W A R VW L
Sbjct: 337 KLMES--------RFGDISHLEPM------FRFARHATSELGTWCADR---VWVSALADD 379
Query: 310 IKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILETFN 369
+ +V + ++ + T + + + + ++ +IK L P E L +
Sbjct: 380 VLPKV--EGSIGGKRQS-TGLGQLPKDVHRDITRIKEASELVESHPPNDPGAPEALSSKV 436
Query: 370 PEFQKERMKLEKAE-HLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGASGR 428
KE + E + I+F ++RY A L + + P + P ++G
Sbjct: 437 RVLWKEISQCFGQETNTKCIVFTEKRYTAKVLFDLFTVLNV--PGLR---PGVLIG---- 487
Query: 429 NLASSDSQGLH---KRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMR 485
+ SSD G++ ++Q + RF EINCL AT+V EEG+D+ CNLV++FD +
Sbjct: 488 -VRSSDRIGMNVTFRQQILTMVRFRTGEINCLFATAVAEEGLDIPDCNLVVRFDLYKTLI 546
Query: 486 SYVQSKGRARRAGSRYVITVEEKDTAAYCSKL 517
YVQS+GRAR A S Y +E KD A + S L
Sbjct: 547 QYVQSRGRARHADSTYASMIE-KDNADHESIL 577
Score = 208 (78.3 bits), Expect = 4.8e-65, Sum P(6) = 4.8e-65
Identities = 91/350 (26%), Positives = 148/350 (42%)
Links = 1-4-5-9-3-(2)
Query: 1503 ISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQK--DQKSDVPSPLLRFIDTPT 1560
+++K+IAD EALIG LLT GP MG++ + D + +I +
Sbjct: 1163 LAEKTIADVCEALIGAALLTPGPQHRFD----MGVRAVSAVVDSNEHNAASWRDYISLYS 1218
Query: 1561 NPNASLNFLNNLWQQFQFTQ-LEEKIGYRFKERAYLVQAFTHASYINN--RVTGCYQRLE 1617
P + + + +EEK+GY F+ L AFTH SY + RV CYQ LE
Sbjct: 1219 IPKYQEQAPDG--SEIDLCRRVEEKLGYHFRYPRLLHSAFTHPSYPSAWARVP-CYQSLE 1275
Query: 1618 FLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGL 1677
FLGDA+LD + LF P LT+ + A+V+N +LAVK H L
Sbjct: 1276 FLGDALLDMVCVEDLFRRFPDRDPQWLTEHKMAMVSNKFLGALAVKLGLHTHLSYFSSAL 1335
Query: 1678 YHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKA-MGDIFESVAGAIY 1736
I + + ++ + + +T + PK + D+ E+ GA++
Sbjct: 1336 QSQITHYAEEAQAAASQSDVAVDYWTLTQDP------------PKVCLPDMVEAYLGAVF 1383
Query: 1737 LDSG---RNLDTTWQV----IFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFS-KMER 1788
+DS ++ +Q FH M + P + + + E + + K
Sbjct: 1384 VDSNFRFEEVEVFFQQHIKPYFHDM-AIYDTFANRHPTTFLHNKLTNEYGCLNYCLKAGE 1442
Query: 1789 IL----ESGKVRVTVEVVNNMRFTGMGRNYRIAKATAAKRALKYLHQIEQ 1834
I ++ V V V + + TG+ + R AK A++ AL L I++
Sbjct: 1443 IPGADGDASTVLAAVIVHDTILTTGVASSGRYAKVKASENALTELLHIDR 1492
Score = 94 (38.1 bits), Expect = 4.8e-65, Sum P(6) = 4.8e-65
Identities = 25/74 (33%), Positives = 37/74 (50%)
Links = 1-4-5-9-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQL 1403
G + ER E +GD FLK AT+ L++ D +E R + N NL+ K + Q
Sbjct: 1068 GKNYERLEFLGDCFLKMATSISLFNQHPDDNEFDYHVNRMCLICNRNLFNSAVKKELYQF 1127
Query: 1404 IVANKFDAHDSWLP 1417
I + F + D+W P
Sbjct: 1128 IRSRGF-SRDTWYP 1140
Score = 85 (35.0 bits), Expect = 4.8e-65, Sum P(6) = 4.8e-65
Identities = 27/82 (32%), Positives = 38/82 (46%)
Links = 1-(4)-5-9-3-2
Query: 511 AAYCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTA 570
A Y S L + T ++P+ + Y E++LP SPI+ A + P K TA
Sbjct: 639 ARYASSLQYENDTSAQVTYVVLPVND----AYVCEVILPEKSPIRGATGM--PAMKKSTA 692
Query: 571 QMAVALEACRQLHLEGELDDNL 592
+ A EACR L LD+ L
Sbjct: 693 KRYAAFEACRLLRKHRLLDEYL 714
Score = 76 (31.8 bits), Expect = 4.8e-65, Sum P(6) = 4.8e-65
Identities = 50/220 (22%), Positives = 88/220 (40%)
Links = 1-4-(5)-9-3-2
Query: 692 IPKIPPFPVFLRQGNMKVRLIVAPKKTTV--TAAQLQEIQLFHNYLFTQVLQMCKTGNLE 749
+P+ P FP+FL + +++ ++ P + +A +L + F +F V + KT + E
Sbjct: 788 LPQFPTFPIFLGE-DVETIVLTVPVNMELQPSADELDYMTTFTLRIFRDVFR--KTYDKE 844
Query: 750 FDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQYKFNAED 809
+ L + P N+ D +N + +S V +D++ Q E
Sbjct: 845 PEKLPYWLLPAISFPCNQEADPRD-VVNWEILSSVHE---------RDDIEYQADMPPEM 894
Query: 810 YKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPD-----THFETFNEYFIKKYK---- 860
D V Y + + Y+ + +PSS P H +T Y I K
Sbjct: 895 LVDRFV---YDHWDGRYRYFTLAVDENLQPSSPPPSHVARRRHMDTIMNYSISLSKNSRA 951
Query: 861 --LEIYDQNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVS 898
L + NQ +L + R NLL R+ ++ R+ T S
Sbjct: 952 KFLSRCNWNQPVLHAELVRLRRNLLD-RMTDKERKLETRS 990
Score = 49 (22.3 bits), Expect = 3.5e-58, Sum P(5) = 3.5e-58
Identities = 20/74 (27%), Positives = 31/74 (41%)
Links = 1-(6)-10-3-2
Query: 1028 ENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDGNISDEDD 1087
E D D E + V D E+ ++ ++ D + G D DT D + E+
Sbjct: 567 EKDNAD--HESILVQVNDAEKIMQSFCQLLPEDRILHGNDDDT--------DAVLDREEW 616
Query: 1088 ELPFVMHDYTARLT 1101
E P+ + ARLT
Sbjct: 617 EEPYTLPSTAARLT 630
Score = 41 (19.5 bits), Expect = 2.2e-58, Sum P(4) = 2.2e-58
Identities = 8/16 (50%), Positives = 12/16 (75%)
Links = 1-(7)-3-2
Query: 574 VALEACRQLHLEGELD 589
+ LEAC++L LE L+
Sbjct: 1025 IGLEACKKLGLEISLE 1040
Score = 39 (18.8 bits), Expect = 3.8e-57, Sum P(5) = 3.8e-57
Identities = 15/79 (18%), Positives = 35/79 (44%)
Links = 1-(8)-9-3-2
Query: 729 QLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANM 788
+L H+ T + + + L+++ ++A + +++P+N D + + S +
Sbjct: 628 RLTHHSAITVLARYASS--LQYENDTSAQVTYVVLPVN---DAYVCEVILPEKSPI-RGA 681
Query: 789 ENMPRIPKDEVRRQYKFNA 807
MP + K +R F A
Sbjct: 682 TGMPAMKKSTAKRYAAFEA 700
Score = 38 (18.4 bits), Expect = 4.8e-65, Sum P(6) = 4.8e-65
Identities = 10/37 (27%), Positives = 18/37 (48%)
Links = 1-4-5-(9)-3-2
Query: 926 RQILVPELMDIHPISATLWNVIAALPSIFYRVNQLLL 962
R ++ E + I I A + A P+I R++ L+
Sbjct: 989 RSVICIEPLKISAIPAAIAATCLAFPAIISRLDAYLI 1025
Score = 38 (18.4 bits), Expect = 6.7e-62, Sum P(5) = 6.7e-62
Identities = 9/35 (25%), Positives = 18/35 (51%)
Links = 1-4-(10)-3-2
Query: 1241 PTNFPKTIDEEIEELSIGARKKQEIDDNAAKTDVL 1275
PT FP + E++E + + E+ +A + D +
Sbjct: 792 PT-FPIFLGEDVETIVLTVPVNMELQPSADELDYM 825
>sp|Q1DKI1.2|DCL1_COCIM RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease DCL1; Includes: RecName: Full=ATP-dependent
helicase DCL1
Length = 1464
Score = 498 (180.4 bits), Expect = 8.4e-64, Sum P(6) = 8.4e-64
Identities = 159/507 (31%), Positives = 260/507 (51%)
Links = (1)-3-5-8-4-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKR----AFF 67
+PR+YQVEL +KA K N I L TGSGKT IAVLLLK Q +D+ ++ +FF
Sbjct: 98 DPREYQVELFEKAKKDNIIAVLDTGSGKTLIAVLLLKHIIEQEL--IDRSAEKPHRVSFF 155
Query: 68 VVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLD 127
+V+ V LV QQA ++ + + +V + G + LW+ E ++ + ++ V+V TA+ L
Sbjct: 156 LVDSVTLVFQQAAVLQNNINQRVDKFCGAMETDLWNG-ETWERHLAKNMVIVCTAEVLYQ 214
Query: 128 LIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAK 187
+ HA++K+E++ +LIFDE H+A HPY I+ D+ L + P++ G+TAS + AK
Sbjct: 215 CLLHAFVKMENINLLIFDEAHNAK-KDHPYARIVKDFYLKDGNAKRPKIFGMTASPVDAK 273
Query: 188 VAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTV 247
+ +++ + LE+ ++S I TAS+L L + +P E V ++D +
Sbjct: 274 M---DVVKAARNLETLLNSQIATASNLSLLRQSVPRPNEEVW-------------SYDRL 317
Query: 248 IEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAA-WRTAQVWEKEL 306
+ F ET + + F DL R ++ + LG W A W VW L
Sbjct: 318 DQPF-ETRLYKELRSRFG-DL-----RALEKLFTFSLKASSNLGAWCADW----VWSYAL 366
Query: 307 GKIIKSQVLPDKTLRFLNMAKTSM--ITIKRLLEPE--MKKIKSI-EALRPY-VPQRVIR 360
+ + LP R A+T+M + I +++ PE +++I+ E +R + +R
Sbjct: 367 TE----ESLPKLEGR---AARTAMGNLPIAKIVRPEAEIQRIREASEIIRSHKFGDPAVR 419
Query: 361 LFEILETFNPEFQKERMK-LEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNP 419
E+L E +K E+ I+F +QR+ A L + I + K + P
Sbjct: 420 P-ELLSPKVRRLHHELLKYFERHTDTKCIVFTEQRHTARILCDLFSRIGT-----KHLRP 473
Query: 420 DYVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFD 479
++G R+ AS ++Q + F + E+NCL ATSV EEG+D+ CNL+++FD
Sbjct: 474 GVLIGV--RSDASGGMNISFRQQVLAVVSFRKGEVNCLFATSVAEEGLDIPDCNLIVRFD 531
Query: 480 RPLDMRSYVQSKGRARRAGSRYVITVE 506
+ Y+QS+GRAR S + VE
Sbjct: 532 LASTLTQYIQSRGRARHMNSTFAHLVE 558
Score = 218 (81.8 bits), Expect = 8.4e-64, Sum P(6) = 8.4e-64
Identities = 68/241 (28%), Positives = 108/241 (44%)
Links = 1-3-5-8-4-(2)
Query: 1503 ISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVP-SPLLRFIDTPTN 1561
++DK+IAD EALIG L N + ++ D + + R P
Sbjct: 1115 LADKTIADVCEALIGACCLLASKNHRFDIAVKAVTALVSSDDHNVLNWEQYSRLYSIPKY 1174
Query: 1562 PNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINN--RVTGCYQRLEFL 1619
A ++ + Q+++K+GY FK L AFTH SY + RV CYQRLEFL
Sbjct: 1175 QTAVVDAA----ELDLAAQVKKKLGYDFKYPKLLRSAFTHPSYPSAWARVP-CYQRLEFL 1229
Query: 1620 GDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYH 1679
GDA+LD +++ P LT+ + A+V+N S+AV+ H L
Sbjct: 1230 GDALLDMACVEHIYHKHPDKDPQWLTEHKMAMVSNKFLGSVAVRLGLHSHLNHFSTSLQS 1289
Query: 1680 MIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDS 1739
I +V+ ++ + + +T++ PK + D+ E+ GAI++DS
Sbjct: 1290 QITNYVEEIEAAELESGDPPDAWTLTSDP------------PKCLPDMVEAYIGAIFIDS 1337
Query: 1740 G 1740
G
Sbjct: 1338 G 1338
Score = 75 (31.5 bits), Expect = 8.4e-64, Sum P(6) = 8.4e-64
Identities = 20/52 (38%), Positives = 28/52 (53%)
Links = 1-(3)-5-8-4-2
Query: 542 YCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLL 593
+ E++LP SPI+ IV K P K A+ + A E C L G LDD+ +
Sbjct: 655 FVCEVVLPEKSPIR-GIVGK-PASKKLIAKQSAAFETCLLLRKHGLLDDHFV 704
Score = 66 (28.3 bits), Expect = 8.4e-64, Sum P(6) = 8.4e-64
Identities = 28/84 (33%), Positives = 40/84 (47%)
Links = 1-3-5-8-(4)-2
Query: 1308 IRQRSEEYVSHIDS--DIGLGVSPCLLLTALTT-SNAAD-------------GMSLERFE 1351
I R E Y+ +++ ++ L +SP L L ALT S+ D G + ER E
Sbjct: 1005 IISRIESYLIALEACQELDLPISPELALEALTKDSDNTDEHRAQQIHFQRGMGKNYERLE 1064
Query: 1352 TIGDSFLKFATTDYLYHTLLDQHE 1375
+GD FLK AT+ L+ D E
Sbjct: 1065 FLGDCFLKMATSISLFAMNPDNDE 1088
Score = 55 (24.4 bits), Expect = 8.4e-64, Sum P(6) = 8.4e-64
Identities = 44/218 (20%), Positives = 88/218 (40%)
Links = 1-3-(5)-8-4-2
Query: 687 LSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKT--TVTAAQLQEIQLFHNYLFTQVLQMCK 744
L+ +++P P FP++L + +++ +I + + V++ L+ + F +F +
Sbjct: 772 LTREKLPHFPEFPLYL-EDDIECDVICSSISSGFQVSSHDLEVLTTFTLRIFQDIFHKVY 830
Query: 745 TGNLEFDGTSNAPLN-TLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQY 803
++ APLN + + + +D + + I +++V +N P IP
Sbjct: 831 DRDVGMMTYWLAPLNLSCDISSSASRDLLDWGI-LQFV------FDN-PEIPWSSSN--- 879
Query: 804 KFNAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPDT-----HFETFNEYFIKK 858
+A + + V Y + Y+ I P RPS P + H +Y +
Sbjct: 880 --SAAFFANRFV---YDRWDGRYRYFTHGIDPSLRPSDPPPSSMARRRHMGNIMDYCLSL 934
Query: 859 YK------LEIYDQNQSLLDVDFTSTRLNLLQPRIQNQ 890
+K LE D Q ++ + R NLL R +
Sbjct: 935 FKNARKKFLENCDWTQPVIKAEIIQLRRNLLDKRTNKE 972
Score = 39 (18.8 bits), Expect = 4.1e-60, Sum P(4) = 4.1e-60
Identities = 12/49 (24%), Positives = 24/49 (48%)
Links = 1-(6)-4-2
Query: 957 VNQLLLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIV 1005
V+ L +D R++ V+ G + T V A + +YE++ + +V
Sbjct: 596 VDALYESDRNRKSYTVQTTGAKLTYSSSLVVLAHFANSLQYEKETSTVV 644
Score = 39 (18.8 bits), Expect = 2.0e-58, Sum P(3) = 2.0e-58
Identities = 7/11 (63%), Positives = 10/11 (90%)
Links = 1-(7)-2
Query: 574 VALEACRQLHL 584
+ALEAC++L L
Sbjct: 1014 IALEACQELDL 1024
Score = 37 (18.1 bits), Expect = 8.4e-64, Sum P(6) = 8.4e-64
Identities = 9/20 (45%), Positives = 11/20 (55%)
Links = 1-3-5-(8)-4-2
Query: 965 ELRETILVKAFGKEKTKLDD 984
+LR +L K KEK K D
Sbjct: 959 QLRRNLLDKRTNKEKIKEGD 978
>sp|A2RAF3.2|DCL1_ASPNC RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease dcl1; Includes: RecName: Full=ATP-dependent
helicase dcl1
Length = 1525
Score = 466 (169.1 bits), Expect = 5.3e-62, Sum P(5) = 5.3e-62
Identities = 154/501 (30%), Positives = 233/501 (46%)
Links = (1)-4-5-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKE-YGVQLFAPLDQGGKR-AFFVV 69
+PR+YQ+EL ++A +NTI L TGSGKT IAVLLLK +L ++ R AFF+V
Sbjct: 116 DPREYQLELFERAKVQNTIAVLDTGSGKTLIAVLLLKHTLEKELNDRMEGKPHRIAFFLV 175
Query: 70 EKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLI 129
+ V L QQA + + VG G + LW SK DQ +++ V+V TA+ L +
Sbjct: 176 DSVTLAYQQAAVLRNNLDQSVGHFFGAMGTDLW-SKSVWDQHFQKNMVIVCTAEILNQCL 234
Query: 130 RHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVA 189
++Y+K+ + +LIFDE HH HPY I+ D L + PR+ G+TAS I K
Sbjct: 235 LNSYIKMSQINILIFDEAHHTK-KDHPYARIIRDSYLEEVYSKRPRIFGMTASPIDTK-- 291
Query: 190 PEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIE 249
++++ +LE +DS I T S++ L + +P E V +F+ + +
Sbjct: 292 -GDIVDEATRLEKLLDSRIATTSNMSLLRQVARRPVERVW-------------SFNKLEQ 337
Query: 250 IFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKI 309
F T + + F D+ ++ + +LG W + R W + L
Sbjct: 338 PF-ATSLYKHLEDRFG-DMAC-----LEGIFRFAWQASSELGRWCSDRA---WARALA-- 385
Query: 310 IKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILETFN 369
VLP A + T + E K+I I V E +
Sbjct: 386 --DDVLPKLEGSVRKTANSE--TSSNVPESAYKEILRITEASEIVKSYAFSSPETFGQLS 441
Query: 370 PEFQKERMKLEK----AEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGA 425
P+ Q R +L + I+F +RY A L + + + F+ P ++G
Sbjct: 442 PKVQVLREELARYFGRQTETKCIVFTQKRYTALILAELFQTLN-----IPFLRPGVLIGV 496
Query: 426 SGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMR 485
+LA + ++Q L +F EINCL ATSV EEG+D+ CNLV++FD +
Sbjct: 497 RSGDLAGMNIT--FRQQFISLVKFRTGEINCLFATSVAEEGLDIPDCNLVVRFDLYQTLI 554
Query: 486 SYVQSKGRARRAGSRYVITVE 506
YVQS+GRAR S Y VE
Sbjct: 555 QYVQSRGRARHFNSTYASMVE 575
Score = 220 (82.5 bits), Expect = 5.3e-62, Sum P(5) = 5.3e-62
Identities = 67/244 (27%), Positives = 112/244 (45%)
Links = 1-4-5-3-(2)
Query: 1503 ISDKSIADAVEALIGVHLLTLGPNPTLKV-MNWMGLKVIQKDQKSDVPSPLLRFIDTPTN 1561
+++K+IAD EALIG LL+ GP+ + + + V K++ + F P
Sbjct: 1171 LAEKTIADVCEALIGAALLSGGPDHRFDMAVKAVTTLVNSPSHKAERWKDYISFYTIPKY 1230
Query: 1562 PNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRV-TGCYQRLEFLG 1620
+ + + + ++EEK+ YRF+ L AFTH SY + CYQRLEFLG
Sbjct: 1231 QRRAADGA----ELYLSRKIEEKLSYRFRYPTLLGSAFTHPSYPSAWAKVPCYQRLEFLG 1286
Query: 1621 DAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHM 1680
D+++D + LF P LT+ + A+V+N +LAVK H L
Sbjct: 1287 DSLIDMVCVEDLFARFPDRDPQWLTEHKMAMVSNKFLGALAVKLGLHTHLKYFSAPLQSQ 1346
Query: 1681 IEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSG 1740
I ++ + ++ + + VT + PK + D+ E+ GA+++DS
Sbjct: 1347 ITQYAEEIQTAEGESEGAVDYWTVTKDP------------PKCLPDMVEAYVGAVFVDSD 1394
Query: 1741 RNLD 1744
N +
Sbjct: 1395 FNFE 1398
Score = 81 (33.6 bits), Expect = 5.3e-62, Sum P(5) = 5.3e-62
Identities = 24/74 (32%), Positives = 33/74 (44%)
Links = 1-4-5-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQL 1403
G + ER E +GD FLK AT+ L+ D E R + N NL+ I +
Sbjct: 1076 GRNYERLEFLGDCFLKMATSIALFTQNPDDDEFDYHVNRMCLICNKNLFNAAVDKEIYKY 1135
Query: 1404 IVANKFDAHDSWLP 1417
I + F H +W P
Sbjct: 1136 IRSRGFSRH-TWYP 1148
Score = 71 (30.1 bits), Expect = 5.3e-62, Sum P(5) = 5.3e-62
Identities = 32/122 (26%), Positives = 52/122 (42%)
Links = 1-(4)-5-3-2
Query: 474 LVIKFDRPLD---MRSYVQSKGRARRAGSRYVITVEEKDTAAYCSKLPSDI-FTRLVPHN 529
L+ FD LD + R + G++ A Y S L + F+ V +
Sbjct: 606 LLYGFDHDLDTVLQKDEGNRTFRIKSTGAKLTYHSATAILARYASSLQYEKEFSAQVTY- 664
Query: 530 QIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELD 589
++PI NG + E++LP SPI+ + +P K A+ + A + C L LD
Sbjct: 665 VVLPI--NGA--FVCEVILPEKSPIRG--LTGSPAMKKSIAKRSAAFDTCLLLRKNKLLD 718
Query: 590 DN 591
D+
Sbjct: 719 DH 720
Score = 52 (23.4 bits), Expect = 5.3e-62, Sum P(5) = 5.3e-62
Identities = 12/52 (23%), Positives = 27/52 (51%)
Links = 1-4-(5)-3-2
Query: 690 KEIPKIPPFPVFLRQGNMKVRLIVAP--KKTTVTAAQLQEIQLFHNYLFTQV 739
+ +P P FP+FL +++ +I P K+ ++ ++ + +F +F V
Sbjct: 793 ERLPHFPEFPIFL-DDDVETTIITTPLEKQLLLSEKEVDALTVFTLRVFRDV 843
>sp|Q09884.1|DCR1_SCHPO RecName: Full=Protein Dicer; AltName: Full=Cell cycle
control protein dcr1; AltName: Full=RNA interference pathway
protein dcr1; Includes: RecName: Full=Endoribonuclease dcr1;
Includes: RecName: Full=ATP-dependent helicase dcr1
Length = 1374
Score = 415 (151.1 bits), Expect = 7.7e-61, Sum P(4) = 7.7e-61
Identities = 147/509 (28%), Positives = 247/509 (48%)
Links = (1)-4-3-2
Query: 14 RDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKE-YGVQLFAPLD--QGGKRAFFVVE 70
R YQ ++ + A+K+NT++ + TG+GKT +AV L+K+ Q+ + K + F+V
Sbjct: 13 RKYQQDVYNIASKQNTLLVMRTGAGKTLLAVKLIKQKLEEQILIQESNLEHKKISVFLVN 72
Query: 71 KVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIR 130
KV LV QQA +I KVG +G+ S + S++ + +++V+VITA +
Sbjct: 73 KVPLVFQQAEYIRSQLPAKVGMFYGELSIEM--SEQLLTNIILKYNVIVITADLFYLFLA 130
Query: 131 HAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYK------LLKKDKPVPRVLGLTASLI 184
+L I D+ ++IFDECHHA+G+ Y IM D+ L KK +PR+ G+TAS
Sbjct: 131 RGFLSINDLNLIIFDECHHAIGND-AYARIMNDFYHRAKAVLSKKHFTLPRIFGMTASPF 189
Query: 185 KAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNF 244
K L +L + E DS S+ L+ Y P E ++ + L +P
Sbjct: 190 TGKKG--NLYHRLYQWEQLFDSKAHVVSEN-ELADYFCLPEESYVMYSNK----LVVPPS 242
Query: 245 DTVIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEK 304
D++I+ +ET L + I ++KT A +G W QVW
Sbjct: 243 DSIIKKCEET---------------LQGCKLISRAVKTALAETIDMGLWFG---EQVW-L 283
Query: 305 ELGKIIKSQVLPDKTLRFLNMAKTSMITIKRL-LEPEMKKIKSIEALRPYVPQRVIRLFE 363
L ++++ L K L ++ + I RL + E K P +P +F+
Sbjct: 284 YLVDFVETKRLKKKALG-KQLSDDEELAIDRLKIFVEDWKNNKYSDNGPRIP-----VFD 337
Query: 364 ILETFNPEFQK-ERMKL--EKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPD 420
+ + F+ E +K K++ + +IFV+++ A++L L M+ + P +
Sbjct: 338 STDVTDKVFKLLELLKATYRKSDSVRTVIFVERKATAFTLSLFMKTLNL--PN---IRAH 392
Query: 421 YVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDR 480
+G + + +RQ + L +F + N LIAT+V EEG+DV CNLVI+F+
Sbjct: 393 SFIGHGPSD--QGEFSMTFRRQKDTLHKFKTGKYNVLIATAVAEEGIDVPSCNLVIRFNI 450
Query: 481 PLDMRSYVQSKGRARRAGSRYVITVEEKD 509
+ YVQS+GRAR S+++I + ++
Sbjct: 451 CRTVTQYVQSRGRARAMASKFLIFLNTEE 479
Score = 224 (83.9 bits), Expect = 7.7e-61, Sum P(4) = 7.7e-61
Identities = 81/254 (31%), Positives = 123/254 (48%)
Links = 1-4-3-(2)
Query: 1501 QHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTPT 1560
Q +S K IAD VEA IG LL G + LK+ + + ++ + + + D T
Sbjct: 1015 QKLSVKRIADMVEASIGACLLDSGLDSALKICKSLSVGLLDISNWDEWNN----YFDLNT 1070
Query: 1561 NPNASLNFLNNLWQQFQFTQ-LEEKIGYRFKERAYLVQAFTHASYINNR-VTGCYQRLEF 1618
++ L N+ QF ++ +EE IGY FK + L AF H S ++ + + YQ+LEF
Sbjct: 1071 YADS----LRNV--QFPYSSYIEETIGYSFKNKKLLHLAFIHPSMMSQQGIYENYQQLEF 1124
Query: 1619 LGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHF----IAMC 1674
LGDAVLDY+I +YL++ + G LTD +S V N + + K+ AMC
Sbjct: 1125 LGDAVLDYIIVQYLYKKYPNATSGELTDYKSFYVCNKSLSYIGFVLNLHKYIQHESAAMC 1184
Query: 1675 PGLYH---MIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESV 1731
++ +IE F + SE N + EID PK + D E++
Sbjct: 1185 DAIFEYQELIEAFRETASE-------NPWFWF-----EIDS--------PKFISDTLEAM 1224
Query: 1732 AGAIYLDSGRNLDT 1745
AI+LDSG +L +
Sbjct: 1225 ICAIFLDSGFSLQS 1238
Score = 118 (46.6 bits), Expect = 7.7e-61, Sum P(4) = 7.7e-61
Identities = 34/136 (25%), Positives = 61/136 (44%)
Links = 1-4-(3)-2
Query: 1282 VLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHIDSDIGLGVSPCLLLTALTTSNA 1341
+LPV+ + K+ + I L+ + ++ H D + + C ALT++ +
Sbjct: 871 ILPVSRHLKNSALLIPSILYHIENLLV---ASSFIEHFRLDCKIDTA-C---QALTSAES 923
Query: 1342 ADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIP 1401
+R E GD FLK + ++ D E +L F R K +SNCNLY++ +P
Sbjct: 924 QLNFDYDRLEFYGDCFLKLGASITVFLKFPDTQEYQLHFNRKKIISNCNLYKVAIDCELP 983
Query: 1402 QLIVANKFDAHDSWLP 1417
+ ++ + W P
Sbjct: 984 KYALSTPLEIRH-WCP 998
Score = 73 (30.8 bits), Expect = 7.7e-61, Sum P(4) = 7.7e-61
Identities = 32/104 (30%), Positives = 43/104 (41%)
Links = 1-(4)-3-2
Query: 513 YCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQM 572
+C+ L D++TR P P YC E+ LP K +P + + A+
Sbjct: 544 FCNTLSRDVYTRYYPTFTAQPCLSGW---YCFEVELP--KACKVPAAQGSPAKSIRKAKQ 598
Query: 573 AVALEACRQLHLEGELDDNLLPKG-RESIAKL--LEHIDEEPDE 613
A C L G +D +L P R IA L LE DE DE
Sbjct: 599 NAAFIMCLDLIRMGLIDKHLKPLDFRRKIADLETLEE-DELKDE 641
Score = 66 (28.3 bits), Expect = 1.9e-55, Sum P(4) = 1.9e-55
Identities = 18/51 (35%), Positives = 25/51 (49%)
Links = 1-4-(5)-2
Query: 919 SVPHSSQ-RQILVPELMDIHPISATLWNVIAALPSIFYRVNQLLLTDELRE 968
S+P S Q R + +L I P+S L N +PSI Y + LL+ E
Sbjct: 854 SIPKSQQVRSFYINDLY-ILPVSRHLKNSALLIPSILYHIENLLVASSFIE 903
Score = 57 (25.1 bits), Expect = 4.2e-52, Sum P(3) = 4.2e-52
Identities = 21/72 (29%), Positives = 29/72 (40%)
Links = 1-(6)-2
Query: 1324 GLGVSPCLLLTALTTSNAADG--MSLERFETIGDSFLKFATTD-YLYHTLLDQHEGKLSF 1380
G+ V C L+ S R + FL F T+ L H + E L F
Sbjct: 436 GIDVPSCNLVIRFNICRTVTQYVQSRGRARAMASKFLIFLNTEELLIHERILHEEKNLKF 495
Query: 1381 ARSKEVSNCNLY 1392
A S E+SN N++
Sbjct: 496 ALS-ELSNSNIF 506
Score = 56 (24.8 bits), Expect = 4.5e-59, Sum P(4) = 4.5e-59
Identities = 19/66 (28%), Positives = 36/66 (54%)
Links = 1-(7)-3-2
Query: 499 SRYVITVEEKDTA--AYCSKLPSDIFTRLVPHN-QIIPIEENGVTKYCAEL-LLPINSPI 554
S ++I ++KD A A C KLP + L + + IP + + Y +L +LP++ +
Sbjct: 819 SEFMIPAKKKDKAPSALCKKLPLRLNYSLWGNRAKSIPKSQQVRSFYINDLYILPVSRHL 878
Query: 555 KHAIVL 560
K++ +L
Sbjct: 879 KNSALL 884
>sp|A1CBC9.2|DCL1_ASPCL RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease dcl1; Includes: RecName: Full=ATP-dependent
helicase dcl1
Length = 1534
Score = 428 (155.7 bits), Expect = 1.2e-60, Sum P(6) = 1.2e-60
Identities = 151/514 (29%), Positives = 241/514 (46%)
Links = (1)-4-5-7-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKR---AFFV 68
+PR+YQ+EL ++A +NTI L TGSGKT IAVLLL+ +Q GK +FF+
Sbjct: 122 DPREYQIELFERAKAQNTIAVLDTGSGKTLIAVLLLRHV-LQNELNDRANGKPHRVSFFL 180
Query: 69 VEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDL 128
V+ V L QQA + + V G + LWD ++ ++ ++++ V+V TA+ L
Sbjct: 181 VDSVTLAYQQAAVLRNNIDQNVAHFFGAMGTDLWD-RQVWEEHLQQNMVIVCTAEILNQC 239
Query: 129 IRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPV-PRVLGLTASLIKAK 187
+ ++++++ + +LIFDE HH HPY I+ D K P PR+ G+TAS I K
Sbjct: 240 LLNSHVRMNQINLLIFDEAHHTK-KDHPYARIIRD-SYFKASPPQRPRIFGMTASPIDTK 297
Query: 188 VAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTV 247
++ +LE+ +DS I T S + L + ++P E V + L P F T
Sbjct: 298 ---GDIIAAATRLETLLDSRIATTSKITLLRQVVSRPIEKV-----WAYDRLESP-FKTN 348
Query: 248 IEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELG 307
+ E F N + ++ + +LG W + R W L
Sbjct: 349 LHKLMEN-RFGNV-------------KALEGVFRFAWYASSELGRWCSDRA---WLYALA 391
Query: 308 KIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILET 367
VLP +A+++ +R + K+I I+ V E
Sbjct: 392 ----DDVLPKLEGHVNKLAESTAAATER--DMAFKEITLIKEASNIVKAHTFNDPEFPGE 445
Query: 368 FNPEFQKERMKLEK----AEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVV 423
+P+ + + +L K A IIF +RY A +L + + P + P ++
Sbjct: 446 LSPKVRLLQTELSKHFSHAPETKCIIFTQKRYTAKTLHELFTILSI--PHLR---PGVLI 500
Query: 424 GASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLD 483
G ++ + ++Q L +F + EINCL ATSV EEG+D+ CNLV++FD
Sbjct: 501 GVRSGDIGGMNIT--FRQQFLALVKFRKGEINCLFATSVAEEGLDIPDCNLVVRFDLYHT 558
Query: 484 MRSYVQSKGRARRAGSRYVITVEEKDTAAYCSKL 517
+ YVQS+GRAR S Y VE KD + + ++L
Sbjct: 559 LIQYVQSRGRARHYHSTYASMVE-KDNSDHEARL 591
Score = 244 (91.0 bits), Expect = 1.2e-60, Sum P(6) = 1.2e-60
Identities = 85/261 (32%), Positives = 122/261 (46%)
Links = 1-4-5-7-3-(2)
Query: 1497 LLTQ-QH-ISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQK--DQKSDVPSPL 1552
+L+Q +H + +K+IAD EALIG LL+ GP MG+K + D S S
Sbjct: 1170 MLSQAKHALGEKTIADVCEALIGACLLSGGPEHRFD----MGVKAVSVFVDSPSHAVSRW 1225
Query: 1553 LRFIDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINN---RV 1609
+I PN + Q+EEK+GY F+ L A TH S + RV
Sbjct: 1226 KEYIGLYKPPNYQVRKAEGAETNLAL-QVEEKLGYHFRYPRLLCSAVTHPSTPSTWYFRV 1284
Query: 1610 TGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKH 1669
CYQRLEFLGD++LD + LF P LT+ + A+V+N +LAVK F KH
Sbjct: 1285 P-CYQRLEFLGDSLLDMVCVEDLFHRFPDRDPQWLTEHKMAMVSNKFLGALAVKLGFHKH 1343
Query: 1670 FIAMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFE 1729
A L I +V+ ++ A Y V ++ PK + D+ E
Sbjct: 1344 IKAFSNPLQAQITYYVEEIETAEAESE-GAVDYWVVAKDP-----------PKCLPDMVE 1391
Query: 1730 SVAGAIYLDSGRNLDTTWQVI 1750
+ GAI++DS D +++VI
Sbjct: 1392 AYLGAIFVDS----DFSFEVI 1408
Score = 93 (37.8 bits), Expect = 1.2e-60, Sum P(6) = 1.2e-60
Identities = 26/74 (35%), Positives = 34/74 (45%)
Links = 1-4-5-7-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQL 1403
G + ER E +GD FLK AT+ L+ D E R + N NL+ KK I +
Sbjct: 1083 GKNYERLEFLGDCFLKMATSIALFTQNPDDDEFDYHVNRMCLICNKNLFNTAKKRQIYRY 1142
Query: 1404 IVANKFDAHDSWLP 1417
I + F H W P
Sbjct: 1143 IRSRSFSRH-VWYP 1155
Score = 66 (28.3 bits), Expect = 1.2e-60, Sum P(6) = 1.2e-60
Identities = 31/113 (27%), Positives = 48/113 (42%)
Links = 1-(4)-5-7-3-2
Query: 483 DMRSYVQ-SKGR----ARRAGSRYVITVEEKDTAAYCSKLPSDIFTRLVPHNQIIPIEEN 537
D+ S +Q +GR + G+R A Y S L + T P + ++
Sbjct: 620 DLDSLLQHEEGRRTFTVKSTGARLTYHSAIAILARYASSLQYEKET--TPQATYV-VQSV 676
Query: 538 GVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDD 590
G T C E++LP SPI+ + +P K A+ + A + C L LDD
Sbjct: 677 GNTYVC-EVILPEKSPIRG--LTGSPAIRKSIAKQSAAFDTCLLLRRHKLLDD 726
Score = 50 (22.7 bits), Expect = 1.2e-60, Sum P(6) = 1.2e-60
Identities = 12/55 (21%), Positives = 31/55 (56%)
Links = 1-4-(5)-7-3-2
Query: 687 LSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKT--TVTAAQLQEIQLFHNYLFTQV 739
L+ +++P P FP++L + +++ +++ T ++A +L+ + F +F V
Sbjct: 797 LTREKLPDFPAFPIYLDE-DIETKVVPRSLDTGMELSAEELRALTTFTLRIFRDV 850
Score = 45 (20.9 bits), Expect = 4.1e-54, Sum P(3) = 4.1e-54
Identities = 39/168 (23%), Positives = 66/168 (39%)
Links = 1-(6)-2
Query: 1232 QENQEDENTPTNFPKTIDEEIEELSIGARKKQEID-----DNAAKTDVLERENCEVL--- 1283
+E +E E T NF +T+ E+ + G ++D + +T ++ +
Sbjct: 592 REVREAEKTMQNFCETLPED--RILHG--NDHDLDSLLQHEEGRRTFTVKSTGARLTYHS 647
Query: 1284 PVAINEK-SRSFSFEKESKAINGRLIRQRSEEYVSHI----DSDI-GLGVSPCLLLTALT 1337
+AI + + S +EKE+ +++ YV + S I GL SP + +
Sbjct: 648 AIAILARYASSLQYEKETTPQATYVVQSVGNTYVCEVILPEKSPIRGLTGSPAIRKSIAK 707
Query: 1338 TSNAADGMSLERFETIGDSFLKFATTDYLYHTLLD-QHEGKLSFARSK 1384
S A D L R + D F K +YH L KL+ K
Sbjct: 708 QSAAFDTCLLLRRHKLLDDFFKS-----IYHKRLPAMRNAKLAITSKK 750
Score = 44 (20.5 bits), Expect = 1.2e-60, Sum P(6) = 1.2e-60
Identities = 17/61 (27%), Positives = 30/61 (49%)
Links = 1-4-5-(7)-3-2
Query: 932 ELMDIHPISATLWNVIAALPSIFYRVNQLLLT----DELRETILVKAFGKEK-TKLDDNV 986
E + I I ++ + A P+I R++ L++ DEL + ++ + E TK DN
Sbjct: 1010 EPLKISAIPPSIASTCLAFPAIITRLDSYLISIEACDEL-DLVIRSDYALEAVTKDSDNT 1068
Query: 987 E 987
E
Sbjct: 1069 E 1069
Score = 39 (18.8 bits), Expect = 6.9e-58, Sum P(4) = 6.9e-58
Identities = 19/76 (25%), Positives = 31/76 (40%)
Links = 1-(8)-3-2
Query: 933 LMDIHPISATLWNVIAALPS--IFYR----VNQLLLTDELRETILVKAFGKEKTKLDDNV 986
L ++ T+ N LP I + ++ LL +E R T VK+ G T
Sbjct: 591 LREVREAEKTMQNFCETLPEDRILHGNDHDLDSLLQHEEGRRTFTVKSTGARLTYHSAIA 650
Query: 987 EWNSLAYATEYEEKQT 1002
A + +YE++ T
Sbjct: 651 ILARYASSLQYEKETT 666
>sp|A1DE13.1|DCL1_NEOFI RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease dcl1; Includes: RecName: Full=ATP-dependent
helicase dcl1
Length = 1538
Score = 457 (165.9 bits), Expect = 1.6e-60, Sum P(6) = 1.6e-60
Identities = 157/517 (30%), Positives = 237/517 (45%)
Links = (1)-4-6-5-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQ--GGKR---AF 66
+PR+YQ+EL ++A +NTI L TGSGKT IAVLLL+ + LD GK +F
Sbjct: 126 DPREYQIELFERAKTQNTIAVLDTGSGKTLIAVLLLRH---TILNELDNRANGKPHRVSF 182
Query: 67 FVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLL 126
F+V+ V L QQA + + V G + LWD K D+ ++R+ V+V TA+ L
Sbjct: 183 FLVDSVTLAYQQAAVLRNNIDQNVAHFFGAMGTDLWD-KRTWDEHLQRNMVIVCTAEILN 241
Query: 127 DLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKA 186
+ ++Y+K++ + +LIFDE HHA HPY I+ D + PRV G+TAS I
Sbjct: 242 QCLLNSYVKMDQINLLIFDEAHHAK-KDHPYARIIRDSYFKAQPSQRPRVFGMTASPIDT 300
Query: 187 KVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDT 246
K + E +LE+ +DS I T S + L + ++P E V + L P
Sbjct: 301 K---GDITEAATRLETLLDSRIATTSKITLLREVVSRPIEKV-----WAYNRLESPFATE 352
Query: 247 VIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKEL 306
+ ++ D + ++ + +LG W + R W L
Sbjct: 353 LYKLMDTRYGNIKV---------------LEGVYRFAWHASSELGKWCSDRA---WWHAL 394
Query: 307 GKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILE 366
VLP + +++ + + K I I V E+
Sbjct: 395 A----DDVLPKLEGNISKLVESNTLNAEH--GAVFKDIIRIREASETVKNYSFADPELPG 448
Query: 367 TFNPEFQKERMKLEKAEHLS------AIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPD 420
+P+ Q RM+L K H S I+F +RY A L + + P + P
Sbjct: 449 ELSPKVQLLRMELSK--HFSDTTGTKCIVFTQKRYTAKILNELFTVLNI--PHLR---PG 501
Query: 421 YVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDR 480
++G ++ + ++Q L +F EINCL ATSV EEG+D+ CNLV++FD
Sbjct: 502 VLIGVRPGDIGGMNVT--FRQQFLALVKFRTGEINCLFATSVAEEGLDIPDCNLVVRFDL 559
Query: 481 PLDMRSYVQSKGRARRAGSRYVITVEEKDTAAYCSKL 517
+ YVQS+GRAR S Y I VE KD A + +L
Sbjct: 560 YRTLIQYVQSRGRARHCTSTYAIMVE-KDNAEHEGRL 595
Score = 210 (79.0 bits), Expect = 1.6e-60, Sum P(6) = 1.6e-60
Identities = 74/248 (29%), Positives = 111/248 (44%)
Links = 1-4-6-5-3-(2)
Query: 1497 LLTQ-QH-ISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLR 1554
LL++ +H + +K+IAD EALIG LL+ GP + ++ D S S
Sbjct: 1174 LLSEGKHALGEKTIADVCEALIGASLLSGGPENRFDMATKAVTALV--DSPSHRVSCWKE 1231
Query: 1555 FIDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINN---RVTG 1611
+I T P +EE++GY F L A TH S + RV
Sbjct: 1232 YITLYTMPKYQTEKPRGSEDDLA-RHVEEELGYHFTYPRLLASAITHPSLPSTWGYRVP- 1289
Query: 1612 CYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFI 1671
CYQRLEFLGD++LD + LF P LT+ + A+V+N +L+VK F + +
Sbjct: 1290 CYQRLEFLGDSLLDMVCVEDLFRRFPDRDPQWLTEHKMAMVSNKFLGALSVKLGFHRRIM 1349
Query: 1672 AMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESV 1731
A L I +V+ ++ A Y V ++ PK + D+ E+
Sbjct: 1350 AFSNPLQAQITHYVEEIESAQAESR-GAVDYWVVAKDP-----------PKCLPDMVEAY 1397
Query: 1732 AGAIYLDS 1739
GAI++DS
Sbjct: 1398 LGAIFVDS 1405
Score = 87 (35.7 bits), Expect = 1.6e-60, Sum P(6) = 1.6e-60
Identities = 26/74 (35%), Positives = 33/74 (44%)
Links = 1-4-6-5-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQL 1403
G + ER E +GD FLK AT+ LY D E R + N NL+ K I +
Sbjct: 1087 GKNYERLEFLGDCFLKMATSIALYTQNPDDDEFDYHVNRMCLICNKNLFNTAIKKQIYRY 1146
Query: 1404 IVANKFDAHDSWLP 1417
I + F H W P
Sbjct: 1147 IRSRGFSRH-IWYP 1159
Score = 65 (27.9 bits), Expect = 1.6e-60, Sum P(6) = 1.6e-60
Identities = 24/80 (30%), Positives = 36/80 (45%)
Links = 1-(4)-6-5-3-2
Query: 511 AAYCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTA 570
A Y S L + T VP Q+ + + Y E++LP SPI+ + +P K A
Sbjct: 657 ARYASSLQYEKET--VP--QVTYVVGHVSNAYVCEVILPEKSPIRG--LTGSPAIRKAVA 710
Query: 571 QMAVALEACRQLHLEGELDD 590
+ + A + C L LDD
Sbjct: 711 KQSAAFDTCLLLRKHRLLDD 730
Score = 52 (23.4 bits), Expect = 1.6e-60, Sum P(6) = 1.6e-60
Identities = 35/136 (25%), Positives = 48/136 (35%)
Links = 1-4-6-(5)-3-2
Query: 1108 GAWSGSESIVPSGWGDWDGPE--PDNSPMPFQILGGPGGLNVQALMADV--GRVFDPSTA 1163
G SG+ P W DWD +N +PF P L V + D GR F T
Sbjct: 878 GPGSGTN---PRDWTDWDTVSFVHNNDEIPFTRDLNPDSL-VNRFIFDNWDGR-FRYFTV 932
Query: 1164 SSSLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQAKERLEALEMSEDMEKPRRLEDTV 1223
+ ++ T+Q S PP + N L +K D +P + V
Sbjct: 933 A--VADTLQPSDPPPPS--VPRRRHMNNIMNYTLSLSKNSRARFFSGCDWNQPVLQAELV 988
Query: 1224 NLE-DYGDDQENQEDE 1238
L + D QE E
Sbjct: 989 RLRRNLLDKMTTQEKE 1004
Score = 51 (23.0 bits), Expect = 1.6e-60, Sum P(6) = 1.6e-60
Identities = 11/55 (20%), Positives = 31/55 (56%)
Links = 1-4-(6)-5-3-2
Query: 687 LSAKEIPKIPPFPVFLRQGNMKVRLIVAPKK--TTVTAAQLQEIQLFHNYLFTQV 739
L+ +++P+ P F ++L + +++ +++ P K ++ +LQ + F +F +
Sbjct: 801 LTREKLPEFPAFSIYLDE-DVETKVLSYPLKHGLQISVDELQSLTTFTLRIFRDI 854
Score = 46 (21.3 bits), Expect = 5.2e-60, Sum P(6) = 5.2e-60
Identities = 16/48 (33%), Positives = 24/48 (50%)
Links = 1-4-(7)-5-3-2
Query: 824 QPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLEI-YDQNQSL 870
+P+ E LPE+ S + D ET + K+ L+I D+ QSL
Sbjct: 796 RPILLLTREKLPEFPAFSIYLDEDVETKVLSYPLKHGLQISVDELQSL 843
Score = 39 (18.8 bits), Expect = 7.3e-57, Sum P(4) = 7.3e-57
Identities = 17/46 (36%), Positives = 22/46 (47%)
Links = 1-(8)-3-2
Query: 543 CAELLLPIN-SPIKHAIV---LKNPMPNKKTAQMAVALEACRQLHL 584
CAE P+ S I +IV L P + +ALEAC +L L
Sbjct: 1012 CAE---PLRISAIPTSIVSTCLAFPAIISRLDSYLIALEACDELEL 1054
>sp|Q2VF19.1|DCL1_CRYPA RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease DCL-1; Includes: RecName: Full=ATP-dependent
helicase DCL-1
Length = 1548
Score = 465 (168.7 bits), Expect = 4.2e-60, Sum P(4) = 4.2e-60
Identities = 146/501 (29%), Positives = 246/501 (49%)
Links = (1)-4-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKR--AFFVV 69
+PRDYQ+EL ++A ++NTI L TGSGKT IA LLL Q +G R AFF+V
Sbjct: 98 SPRDYQMELFERAKQQNTIAVLDTGSGKTLIAALLLDHTVNQELEDRAKGLPRRIAFFLV 157
Query: 70 EKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLI 129
EKV L QQ +E + + V G++ W +K + + H V+V TA+ L +
Sbjct: 158 EKVALAFQQHAVLECNLAHSVAVFSGESIKNTW-TKGFWETQLADHEVIVCTAEILNQCL 216
Query: 130 RHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPV--PRVLGLTASLIKAK 187
++AY++I+ + +L+FDE HH HPY I+ DY KD+ + PR+ G+TAS + A
Sbjct: 217 QYAYIRIDQINLLVFDEAHHTK-KNHPYARIIKDYYASGKDRGLRLPRIFGMTASPVDAL 275
Query: 188 VAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTV 247
+ + + +LE + S I T +D +L + +P + +I ++ +
Sbjct: 276 I---DVRQAAIELEGLLHSRIATTADPDALRRAVGRPKKEIIY------------KYNPL 320
Query: 248 IEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELG 307
++ + F + P L + + + + A R+LG W R Q++ ++
Sbjct: 321 VKPIQTMLTF-----KLRP-L-IANNKQFSKAFAFSEAAARELGTWFVDRMWQLFLED-E 372
Query: 308 KIIKSQVLPDKTLRFLNMAKTSMITIKR-LLEPEMKKIKSIEALRPYVPQRVIRLFEILE 366
+++K + +++L +MA ++ R + + I+S E +P P + + L
Sbjct: 373 ELLKLEAKTERSLS-KDMAAPEVVEKHRNAVRSARELIRSHEFPKPE-PGLLSSKLKTLS 430
Query: 367 TFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGA- 425
E+ + + I+FV++R+ A L+ +S + P VG+
Sbjct: 431 KLLEEYFTD-------SSIRCIVFVERRWTAK---LLTDFFESHAAEI----PGLKVGSL 476
Query: 426 SGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMR 485
G N SQ + Q + F + NC+ ATSV EEG+D+ CNL+I+FD M
Sbjct: 477 MGANAEGGSSQTSFREQIRTILSFKKGNTNCIFATSVAEEGLDIPDCNLIIRFDICKTMI 536
Query: 486 SYVQSKGRARRAGSRYVITVE 506
Y+QS+GRAR+A S Y+ +E
Sbjct: 537 QYIQSRGRARQADSTYIHLIE 557
Score = 204 (76.9 bits), Expect = 4.2e-60, Sum P(4) = 4.2e-60
Identities = 72/260 (27%), Positives = 111/260 (42%)
Links = 1-4-3-(2)
Query: 1498 LTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFID 1557
+ + ++DKSIAD EALIG +T + + +++ Q P+ ++ D
Sbjct: 1171 MDEHRLADKSIADVCEALIGAAYMTTRKHDDYDLAVRAVTRLVNHKQH-----PMTKWDD 1225
Query: 1558 ---TPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHAS--YINNRVTGC 1612
P N + ++ E GY+FK L AF H S Y+ ++V
Sbjct: 1226 YHAAYVMPGWQ-TMPANAAELDMAQKIHEATGYQFKHPRVLRSAFRHPSRPYVFDKVPH- 1283
Query: 1613 YQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIA 1672
YQRLEFLGDA+ D YLF + P LT+ + A+V+N LAV F K +
Sbjct: 1284 YQRLEFLGDALFDMACVDYLFHIAPDEGPQWLTEHKMAMVSNQFLGCLAVSLGFHKFILH 1343
Query: 1673 MCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVA 1732
+ I ++V +E AE + E + PK + D+ E+
Sbjct: 1344 HHASIGSQIHEYVTEITEARRAAEDAAEAAGKPRSAYSRDYWVEAPQPPKCIPDVLEAYV 1403
Query: 1733 GAIYLDSGRNLDTTWQVIFH 1752
GAI++DS + Q FH
Sbjct: 1404 GAIFVDSKYDYSVVQQ-FFH 1422
Score = 90 (36.7 bits), Expect = 4.2e-60, Sum P(4) = 4.2e-60
Identities = 24/76 (31%), Positives = 39/76 (51%)
Links = 1-4-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKK--LGIP 1401
G + ER E +GDSFLK ATT ++ + ++ E R + N NL+ + K L +
Sbjct: 1080 GANYERLELLGDSFLKMATTIAVFTLIPNKDEFDYHCERMVMICNQNLFGVAKSDDLKLH 1139
Query: 1402 QLIVANKFDAHDSWLP 1417
+ I + F+ +W P
Sbjct: 1140 EYIRSKSFE-RGTWYP 1154
Score = 65 (27.9 bits), Expect = 4.2e-60, Sum P(4) = 4.2e-60
Identities = 28/102 (27%), Positives = 48/102 (47%)
Links = 1-(4)-3-2
Query: 529 NQIIPIEENGVTKYCAELLLPIN-SPIKHAIV-LKNPMPN--KKTAQMAVALEACR--QL 582
N + I E +C +L P+ SP+ +V + +P+ + Q +AL+ACR QL
Sbjct: 981 NFLADINETSKNPFCYFVLEPMRISPLPVDVVAMAYLLPSIIHRIEQNLIALDACRLLQL 1040
Query: 583 HLEGELDDNLLPKGRESIAKLLEHIDE----EPDEYAPGIAA 620
+ +L L K ++ + E +D EP + PG+ A
Sbjct: 1041 DIHPDLALEALTKDSDNQGED-ERMDSIQAFEPVNFQPGMGA 1081
Score = 64 (27.6 bits), Expect = 7.1e-60, Sum P(5) = 7.1e-60
Identities = 18/54 (33%), Positives = 28/54 (51%)
Links = 1-(5)-6-3-2
Query: 542 YCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPK 595
+ E+++P SP+ AI K+ A+ + A E C QL + LDD+L K
Sbjct: 660 FICEVMMPPLSPVTSAI--GKVYSTKQVAKCSAAFELCFQLIQKKFLDDHLRSK 711
Score = 47 (21.6 bits), Expect = 7.1e-60, Sum P(5) = 7.1e-60
Identities = 14/39 (35%), Positives = 20/39 (51%)
Links = 1-5-(6)-3-2
Query: 930 VPELMDIHPISATLWNVIAALPSIFYRVNQ-LLLTDELR 967
V E M I P+ + + LPSI +R+ Q L+ D R
Sbjct: 998 VLEPMRISPLPVDVVAMAYLLPSIIHRIEQNLIALDACR 1036
>sp|Q0UI93.2|DCL1_PHANO RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease DCL1; Includes: RecName: Full=ATP-dependent
helicase DCL1
Length = 1522
Score = 490 (177.5 bits), Expect = 3.8e-59, Sum P(5) = 3.8e-59
Identities = 162/507 (31%), Positives = 253/507 (49%)
Links = (1)-4-5-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQG--GKRAFFVV 69
NPRDYQ+EL +A +NTI L TG+GKT IA LLL+ + +G K AFF+V
Sbjct: 68 NPRDYQMELFLRAKMQNTIAVLDTGTGKTHIATLLLRHVLEEELENRAKGCAHKMAFFLV 127
Query: 70 EKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLI 129
+ VNLV QQA + V + G L+ K+ D+ + V+V TAQ L+D +
Sbjct: 128 DSVNLVFQQANVLRCGLDQGVEGISGAMGQSLFQ-KQTWDKLFAVNMVIVCTAQVLVDCM 186
Query: 130 RHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPV-PRVLGLTASLIKAK- 187
H+++ I M +LIFDE HHA S HPY +M DY + D PR+ +TAS + K
Sbjct: 187 MHSFMSISRMNLLIFDEAHHAK-SNHPYARVMKDYYAHELDTSKRPRIFAMTASPVDVKG 245
Query: 188 VAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTV 247
+ E + E ++LE+ + S I T SD +P E V + + +
Sbjct: 246 QSAEHVREAARELETLLHSRIATTSDSALARNSITRPEEEVAV-------------YTRL 292
Query: 248 IEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAA---WRTAQVWEK 304
F ET ++ D+ P R + T + +LG WA+ W A E+
Sbjct: 293 RNEF-ETPLHQKVKAKYG---DVAPFRKL---FITAKLHASELGRWASDMYWSFAFADEQ 345
Query: 305 ELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVI--RLF 362
I+ ++ +++ R + A+ + RL E ++ E P + ++ + ++
Sbjct: 346 SRKLQIREELKYNRSKRDWSAAELDA-QMARLKEATAF-VQQYEIGAPTLSEQDLSSKVM 403
Query: 363 EILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYV 422
++ N + ER L + I+FV++R+ A L L+ HI P ++ D +
Sbjct: 404 KLQYWLNLYY--ERTTLARC-----IVFVEKRHTAQLLKLIFDHIGG--PN---LHCDVL 451
Query: 423 VGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPL 482
VG + R A ++ L + Q L++F R E+NCL ATSV EEG+D+ QCNLV++FD
Sbjct: 452 VGINNR--AGEENVSL-RSQILTLQKFRRGELNCLFATSVAEEGLDIPQCNLVVRFDLYR 508
Query: 483 DMRSYVQSKGRARRAGSRYVITVEEKD 509
M YVQS+GRAR S+Y+ +E ++
Sbjct: 509 TMIGYVQSRGRARHRNSKYLHMLEAEN 535
Score = 183 (69.5 bits), Expect = 3.8e-59, Sum P(5) = 3.8e-59
Identities = 86/348 (24%), Positives = 140/348 (40%)
Links = 1-4-5-3-(2)
Query: 1502 HISDKSIADAVEALIGVHLLTLGPNPTLKVMNW-MGLKVIQKDQKSD--VPSPLLRFIDT 1558
++ DKS+AD EA IG + +W +K ++ SD + +
Sbjct: 1144 NLGDKSVADVCEAFIGAAFMQHHKGGQWTPNDWDEAVKAVKLFANSDDHLMEKWTDYYAA 1203
Query: 1559 PTNPNASLNFLNNLWQQFQFT-QLEEKIGYRFKERAYLVQAFTHAS--YINNRVTGCYQR 1615
T P Q ++E K YRF+ L AF H S ++ + YQR
Sbjct: 1204 YTKPKYQT--AGATATQLDLAHKIEMKHPYRFRYPRLLRSAFIHPSQPFMWENIPS-YQR 1260
Query: 1616 LEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCP 1675
LEFLGD++LD +LF P LT+ ++ +V+N ++ VK + H
Sbjct: 1261 LEFLGDSLLDMAFIMHLFYKYPDKDPQWLTEHKTPMVSNKFLGAVCVKLGWHTHMKQNTA 1320
Query: 1676 GLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAI 1735
L I +V E + N A Y V+ E PK + D+ E+ AI
Sbjct: 1321 ILSSQIRDYVYEVEEAEREAN-GAVDYWVSVSEP-----------PKCLADVIEAFVAAI 1368
Query: 1736 YLDSGRNLDTTWQVI-FH-------MMRGTIELCCANPPRSPIRELME--FEQSKVRFSK 1785
++DS + + + H M E +N P + + L+ F S+ R
Sbjct: 1369 FVDSEFDFNVVQKFFDLHLKPFFLDMTLDAYENFASNHPTTRLSRLLSINFGCSEWRMGA 1428
Query: 1786 ME-RILESGK---VRVTVEVVNNMRFTGMGRNYRIAKATAAKRALKYL 1829
+E L GK + V + + + F +G++ R A+ A+ AL+ L
Sbjct: 1429 LETETLIPGKGKAIAAMVMIHDKVHFHSLGQSGRYARVRASHAALEKL 1476
Score = 83 (34.3 bits), Expect = 3.8e-59, Sum P(5) = 3.8e-59
Identities = 39/128 (30%), Positives = 59/128 (46%)
Links = 1-4-5-(3)-2
Query: 1308 IRQRSEEYVSHIDS-DI-GLGVSPCLLLTALTTS------------NAADGM--SLERFE 1351
I R E Y+ +D+ D+ L VSP L L ALT N GM + ER E
Sbjct: 995 IIHRFESYLIALDACDVLDLKVSPALALEALTKDSDNSEEHGEEKINFKSGMGPNYERLE 1054
Query: 1352 TIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYR--LGKKLGIPQLIVANKF 1409
+GD FLK AT+ ++ +++E + R + N NL +GKK + + + + F
Sbjct: 1055 FLGDCFLKVATSLSVFVQQPEENEFEFHVRRMLMLCNQNLMETAVGKKK-LYKYVRTDAF 1113
Query: 1410 DAHDSWLP 1417
+ W P
Sbjct: 1114 SRRN-WYP 1120
Score = 59 (25.8 bits), Expect = 3.8e-59, Sum P(5) = 3.8e-59
Identities = 25/115 (21%), Positives = 56/115 (48%)
Links = 1-(4)-5-3-2
Query: 535 EENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKT-AQMAVALEACRQLHLEGELDDNLL 593
+ NG + E++LP + PI I + + ++KT A+ + A + C +L + L++ LL
Sbjct: 638 QRNG---FVCEVILPEHCPI---ISMVGQVYSRKTIAKCSAAFKMCIELRRKDHLNEFLL 691
Query: 594 PKGRESIAKLLEHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADK 648
P + + + + ++ A + + KQ D + +L+ + ++AD+
Sbjct: 692 PTISKYLPAMRNALLAVSEKKKGNYAMVIKPTFWKQDRDT-VPESLHLTIIDADR 745
Score = 46 (21.3 bits), Expect = 3.8e-59, Sum P(5) = 3.8e-59
Identities = 40/219 (18%), Positives = 97/219 (44%)
Links = 1-4-(5)-3-2
Query: 687 LSAKEIPKIPPFPVFL---RQGNMKVRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMC 743
L+ + P++P FP++L R N+ + + P ++T L+ F +F +
Sbjct: 757 LTRRPFPQLPSFPIYLTDCRPSNIVSQSLHIP--ISLTPELLEMFTRFTLRIFEDIYNKV 814
Query: 744 KTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQY 803
++D + ++ ++P+ + + ++ +M EV+ +M+ + ++ + +
Sbjct: 815 ----YDYDVSK---MSYWMLPVIEHR--VASVRSMSNPQEVL-DMDQIRKVYNEPF---W 861
Query: 804 KFNAEDYKDAIVMPWYRN-LEQPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLE 862
K++ + D ++ ++ + + YY + P +P P + N F+K L+
Sbjct: 862 KWSPQSRTDDLIDRYFVDPMNGGRRYYSDRLAPHLKPQDPVP-ANVPRQNHKFMKNI-LD 919
Query: 863 IYDQNQSLLDVDFTSTRLNLLQPRIQNQ--PRRSRTVSN 899
D ++ + D T R + QP +Q + P R ++N
Sbjct: 920 FSD-SKWMKSRDIT--RWHQDQPVLQVEKIPFRRNHLAN 955
Score = 42 (19.8 bits), Expect = 9.7e-59, Sum P(5) = 9.7e-59
Identities = 14/53 (26%), Positives = 28/53 (52%)
Links = 1-4-(6)-3-2
Query: 979 KTKLD-DNVEWNSLAYATEYEEKQTII-VKKIQQLRDLNQKSIEDQERETREN 1029
K LD + +W T + + Q ++ V+KI R+ + ++ED+E++ N
Sbjct: 915 KNILDFSDSKWMKSRDITRWHQDQPVLQVEKIPFRRN-HLANVEDKEKKELAN 966
>sp|Q4WVE3.3|DCL1_ASPFU RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease dcl1; Includes: RecName: Full=ATP-dependent
helicase dcl1
Length = 1537
Score = 466 (169.1 bits), Expect = 4.8e-59, Sum P(6) = 4.8e-59
Identities = 160/515 (31%), Positives = 241/515 (46%)
Links = (1)-4-5-7-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQ--GGKR---AF 66
+PR+YQ+EL ++A +NTI L TGSGKT IAVLLL+ + LD GK +F
Sbjct: 125 DPREYQIELFERAKTQNTIAVLDTGSGKTLIAVLLLRH---TILNELDDRANGKTHRVSF 181
Query: 67 FVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLL 126
F+V+ V L QQA + + V G + LWD K D+ ++R+ V+V TA+ L
Sbjct: 182 FLVDSVTLAYQQAAVLRNNIDQNVAHFFGAMGTDLWD-KRTWDKHLQRNMVIVCTAEILN 240
Query: 127 DLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKA 186
+ ++Y++++ + +LIFDE HHA HPY I+ D + PRV G+TAS I
Sbjct: 241 QCLLNSYVRMDQINLLIFDEAHHAK-KDHPYARIIRDSYFKAQPSQRPRVFGMTASPIDT 299
Query: 187 KVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDT 246
K + E +LE+ +DS I T S + L + ++P E V E P F T
Sbjct: 300 K---GDITEAATRLETFLDSRIATTSKITLLREVVSRPIEKVWAYNRLE------PPFAT 350
Query: 247 VIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKEL 306
E ++T + ++ + ++ + +LG W + R W L
Sbjct: 351 ------ELYKLMDTR---YGNIKV-----LEGVYRFAWNASSELGKWCSDRA---WWHAL 393
Query: 307 GKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILE 366
VLP + +++ T+K K I I V E+
Sbjct: 394 A----DDVLPKLEGNINKLIESN--TMKAEHGAVFKDIIRIREASETVKNYFFTDPELPG 447
Query: 367 TFNPEFQKERMKLEK----AEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYV 422
+P+ Q+ RM+L K I+F +RY A L + + P + P +
Sbjct: 448 ELSPKVQRLRMELSKHFNDTTGTKCIVFTQKRYTAKILNELFTVLNI--PNLR---PGVL 502
Query: 423 VGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPL 482
+G ++ + ++Q L +F EINCL ATSV EEG+D+ CNLVI+FD
Sbjct: 503 IGVRPGDIGGMNIT--FRQQFLALVKFRTGEINCLFATSVAEEGLDIPDCNLVIRFDLYR 560
Query: 483 DMRSYVQSKGRARRAGSRYVITVEEKDTAAYCSKL 517
+ YVQS+GRAR S Y I VE KD A + +L
Sbjct: 561 TLIQYVQSRGRARHCTSTYAIMVE-KDNAEHEGRL 594
Score = 205 (77.2 bits), Expect = 4.8e-59, Sum P(6) = 4.8e-59
Identities = 75/250 (30%), Positives = 111/250 (44%)
Links = 1-4-5-7-3-(2)
Query: 1497 LLTQ-QH-ISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQK--DQKSDVPSPL 1552
LL++ +H + +K+IAD EALIG LL+ GP M K + D S S
Sbjct: 1173 LLSEGKHALGEKTIADVCEALIGASLLSGGPEHRFD----MATKAVSALVDSPSHRVSCW 1228
Query: 1553 LRFIDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINN---RV 1609
+I T P +EE++GY F L A TH S + RV
Sbjct: 1229 KEYITLYTLPKYQTEKHRGSEDDLA-RHVEEELGYHFTYPRLLASAITHPSLPSTWGYRV 1287
Query: 1610 TGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKH 1669
CYQRLEFLGD++LD + LF P L++ + A+V+N +L+VK F +
Sbjct: 1288 P-CYQRLEFLGDSLLDMVCVEDLFRRFPDRDPQWLSEHKMAMVSNKFLGALSVKLGFHRR 1346
Query: 1670 FIAMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFE 1729
+A L I +V+ ++ A Y V ++ PK + D+ E
Sbjct: 1347 IMAFSNPLQAQITHYVEEIETAQAESQ-GAVDYWVVAKDP-----------PKCLPDMVE 1394
Query: 1730 SVAGAIYLDS 1739
+ GAI++DS
Sbjct: 1395 AYLGAIFVDS 1404
Score = 79 (32.9 bits), Expect = 4.8e-59, Sum P(6) = 4.8e-59
Identities = 24/74 (32%), Positives = 33/74 (44%)
Links = 1-4-5-7-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQL 1403
G + ER E +GD FLK AT+ L+ + E R + N NL+ K I +
Sbjct: 1086 GKNYERLEFLGDCFLKMATSIALFSQNPNDDEFDYHVNRMCLICNKNLFNTAIKKQIYRY 1145
Query: 1404 IVANKFDAHDSWLP 1417
I + F H W P
Sbjct: 1146 IRSRGFSRH-IWYP 1158
Score = 65 (27.9 bits), Expect = 4.8e-59, Sum P(6) = 4.8e-59
Identities = 30/113 (26%), Positives = 48/113 (42%)
Links = 1-(4)-5-7-3-2
Query: 483 DMRSYVQSK-GR----ARRAGSRYVITVEEKDTAAYCSKLPSDIFTRLVPH-NQIIPIEE 536
D+ S++Q + GR + G++ A Y S L + T VP ++ I
Sbjct: 623 DLDSFLQEEEGRRTFTVKSTGAKLTYHSAIAILARYASSLQYEKET--VPQVTYVVTIAS 680
Query: 537 NGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELD 589
N Y E++LP SPI+ + +P K A+ + A + C L LD
Sbjct: 681 NA---YVCEVILPEKSPIRG--LTGSPAMRKAVAKRSAAFDTCLLLRKNRLLD 728
Score = 52 (23.4 bits), Expect = 4.8e-59, Sum P(6) = 4.8e-59
Identities = 11/55 (20%), Positives = 32/55 (58%)
Links = 1-4-(5)-7-3-2
Query: 687 LSAKEIPKIPPFPVFLRQGNMKVRLIVAPKK--TTVTAAQLQEIQLFHNYLFTQV 739
L+ +++P+ P F ++L + +++ +++ P K ++ +LQ + +F +F +
Sbjct: 800 LTREKLPEFPAFSIYLDE-DVETKVLSYPLKHGLQISVDKLQSLTVFTLRIFRDI 853
Score = 45 (20.9 bits), Expect = 2.5e-58, Sum P(6) = 2.5e-58
Identities = 16/48 (33%), Positives = 24/48 (50%)
Links = 1-4-(6)-7-3-2
Query: 824 QPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLEI-YDQNQSL 870
+P+ E LPE+ S + D ET + K+ L+I D+ QSL
Sbjct: 795 RPILLLTREKLPEFPAFSIYLDEDVETKVLSYPLKHGLQISVDKLQSL 842
Score = 40 (19.1 bits), Expect = 4.8e-59, Sum P(6) = 4.8e-59
Identities = 10/32 (31%), Positives = 16/32 (50%)
Links = 1-4-5-(7)-3-2
Query: 865 DQNQSLLDVDFTSTRLNLLQPRIQNQPRRSRT 896
D NQ +L + R NLL ++ Q + +T
Sbjct: 976 DWNQPVLQAELVRLRRNLLD-KMTTQEKEMQT 1006
Score = 39 (18.8 bits), Expect = 1.7e-56, Sum P(4) = 1.7e-56
Identities = 14/43 (32%), Positives = 19/43 (44%)
Links = 1-(8)-3-2
Query: 543 CAE-LLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHL 584
CAE L + P + L P + +ALEAC +L L
Sbjct: 1011 CAEPLRISALPPSIVSTCLAFPAIISRLDSYLIALEACDELEL 1053
>sp|Q2U6C4.2|DCL1_ASPOR RecName: Full=Dicer-like protein 1; Includes: RecName:
Full=Endoribonuclease dcl1; Includes: RecName: Full=ATP-dependent
helicase dcl1
Length = 1523
Score = 474 (171.9 bits), Expect = 8.5e-58, Sum P(4) = 8.5e-58
Identities = 196/684 (28%), Positives = 307/684 (44%)
Links = (1)-4-3-2
Query: 12 NPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQG-GKR---AFF 67
+PR+YQVEL ++A +NTI L TGSGKT IAVLLLK +Q +D+ GK +FF
Sbjct: 115 DPREYQVELFERAKSQNTIAVLDTGSGKTLIAVLLLKHI-IQNEL-IDRANGKPPRISFF 172
Query: 68 VVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLD 127
+V+ V L QQA + + V Q G + LW SK+ D + + V+V TA+ L
Sbjct: 173 LVDSVTLAFQQAAVLRNNLDQNVAQFFGAMGTDLW-SKQTWDHQFENNMVIVCTAEILNQ 231
Query: 128 LIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPV-PRVLGLTASLIKA 186
+ ++Y++++ + +LIFDE HH HPY I+ + LK D PR+ G+TAS I
Sbjct: 232 CLLNSYIRMDQINLLIFDEAHHTK-KDHPYARIIRE-SYLKADPTKRPRIFGMTASPIDT 289
Query: 187 KVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDT 246
K ++E KLE +DS I T S L + +P E + +E L P F T
Sbjct: 290 K---GDIIESATKLEVLLDSKIATTSKPNLLREVVRRPIE-----ESWEYDKLD-PPFAT 340
Query: 247 VIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKEL 306
+++ A F D+ +P+ + T +LGP A R W L
Sbjct: 341 --KLYQILQA------RFG---DISSLQPV---FRFTLQASSELGPCCADRA---WAYAL 383
Query: 307 GKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILE 366
VLP L N+ K + + + +K+I I+ V +
Sbjct: 384 A----DDVLPK--LEG-NVRKLAQSISSPIPQCALKEISRIQEASDIVKNHSFNSPNVPG 436
Query: 367 TFNPEFQKERMKLEKA-EH---LSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYV 422
+P+ Q R KL K EH I+F +RY A L + ++ ++ P +
Sbjct: 437 ELSPKVQLLRQKLIKYFEHPTKTKCIVFTQKRYTAKMLFDLFSTLE-----IPYLRPGVL 491
Query: 423 VGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPL 482
+G ++ + ++Q L +F EINCL ATSV EEG+D+ CNLV++FD
Sbjct: 492 IGVRSGDIVGMNVS--FRQQFLALVKFRSGEINCLFATSVAEEGLDIPDCNLVVRFDLYN 549
Query: 483 DMRSYVQSKGRARRAGSRYVITVEE--KDTAAY------CSKLPSDIFTRLVPHNQIIPI 534
+ YVQS+GRAR + S Y +E D AA KL F +P ++I+
Sbjct: 550 TLIQYVQSRGRARHSSSTYASMIERYNADHAARLVEVREAEKLMQS-FCETLPEDRIL-- 606
Query: 535 EENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEA--CRQLHLEGELDDN- 591
+G+ +L K +++ K T A+A+ A L E E
Sbjct: 607 --HGIDSEIDSILQ--GEEEKRTFIIR-ATGAKLTYHSALAILARYASSLQYEKETSAQA 661
Query: 592 ---LLPKGRESIAKLLEHIDEEPDEYAPGI-AAKVGSSKRKQLYDKKIARALNESFVEAD 647
+LP+ + +++ ++ P G+ A+K ++K+ +D + L + + D
Sbjct: 662 TYVVLPQNNSFVCEVILP-EKSPVRGLTGVPASKKSAAKQSAAFDTCVL--LRKHKLLDD 718
Query: 648 KECFIYAFELERFREAELTLNPKR 671
+Y L R A L + R
Sbjct: 719 HFNSVYHRRLPAMRNARLAITSSR 742
Score = 204 (76.9 bits), Expect = 8.5e-58, Sum P(4) = 8.5e-58
Identities = 95/348 (27%), Positives = 153/348 (43%)
Links = 1-4-3-(2)
Query: 1503 ISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPS-PLLRFIDTPTN 1561
+ +K++AD EALIG LL+ G + M +K + D P+ L + D ++
Sbjct: 1169 LREKTVADVCEALIGASLLSGGLHNQFD----MAVKAVTA--VVDSPNHKALCWADYTSS 1222
Query: 1562 ---PNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRV-TGCYQRLE 1617
P + ++ ++EEK+GYRFK L AFTH SY + CYQRLE
Sbjct: 1223 YMLPKYQTQSPDG-YELDLGRKVEEKLGYRFKYPRLLHSAFTHPSYPSTWAKVPCYQRLE 1281
Query: 1618 FLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGL 1677
FLGD++LD + LF P LT+ + A+V+N +LAVK H L
Sbjct: 1282 FLGDSLLDMVCVDDLFYRYPDKDPQWLTEHKMAMVSNKFLGALAVKLGLHTHLRHFSNPL 1341
Query: 1678 YHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYL 1737
I + + ++ + ++VT + PK + D+ E+ GA ++
Sbjct: 1342 QSQITHYAEEIQAAENESQGAVDYWLVTKDP------------PKCLPDMVEAYLGAAFV 1389
Query: 1738 DSG---RNLDTTWQ----VIFHMMRGTIELCCANP-PRSPIRELMEFEQSKVRFS-KMER 1788
DS R ++ +Q FH M TI AN P + ++ + E + K
Sbjct: 1390 DSDFQFRVVEDFFQRHVKSYFHDM--TIYDTFANKHPTTFLQNRLTNEYGCTNYCLKAGE 1447
Query: 1789 I--LESGKVRVTVEVVNN--MRFTGMGRNYRIAKATAAKRALKYLHQI 1832
I ++ G V V V+ + + G + R AK A+++AL L +
Sbjct: 1448 IPVVDGGTVSVLAAVIVHEVVIAEGTASSGRYAKVKASEKALSVLENM 1495
Score = 84 (34.6 bits), Expect = 8.5e-58, Sum P(4) = 8.5e-58
Identities = 24/74 (32%), Positives = 33/74 (44%)
Links = 1-4-(3)-2
Query: 1344 GMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQL 1403
G + ER E +GD FLK AT+ L+ D E R + N NL+ K + Q
Sbjct: 1074 GKNYERLEFLGDCFLKMATSISLFVQNPDDDEFDFHVNRMCLICNKNLFNTALKKELYQY 1133
Query: 1404 IVANKFDAHDSWLP 1417
+ F H +W P
Sbjct: 1134 TRSRGFSRH-TWYP 1146
Score = 39 (18.8 bits), Expect = 8.5e-58, Sum P(4) = 8.5e-58
Identities = 10/50 (20%), Positives = 22/50 (44%)
Links = 1-(4)-3-2
Query: 687 LSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTVTAAQLQEIQLFHNYLF 736
L+ + +P P F +FL +++ ++V QE++ + F
Sbjct: 789 LTRERLPDFPSFTIFL-DDDIET-IVVTESVEEALHISSQELEYLSTFTF 836
>sp|Q2UNX5.1|DCL2_ASPOR RecName: Full=Dicer-like protein 2; Includes: RecName:
Full=Endoribonuclease dcl2; Includes: RecName: Full=ATP-dependent
helicase dcl2
Length = 1377
Score = 396 (144.5 bits), Expect = 1.0e-53, Sum P(5) = 1.0e-53
Identities = 144/525 (27%), Positives = 243/525 (46%)
Links = (1)-5-3-2-4
Query: 11 FNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKR--AFFV 68
+ PR YQ E+ + + K+N IV + TG+GKT IA+L + L+ GG R +F+
Sbjct: 14 YKPRQYQYEMFEASLKENIIVAMDTGTGKTQIALLRIAHQ-------LEGGGPRKLTWFL 66
Query: 69 VEKVNLVEQQAIHIEVHT-SFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLD 127
V L QQ I H + + + G W S+ D+ +K VVV T L +
Sbjct: 67 TPTVALCLQQYEVIRSHLPAVRACTITGLDKVERWKSQYIWDELLKDKQVVVSTHAVLFE 126
Query: 128 LIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDY--KLLKKD--KPVPRVLGLTAS- 182
+ H +++I + +LIFDE HH + +HP IM+D+ L+K VP +LGLTAS
Sbjct: 127 ALTHGFVRISQLGLLIFDEAHHCM-RRHPANMIMLDFYHPTLRKHGRDSVPCILGLTASP 185
Query: 183 LIKAKVAPEKLMEQLKKLESAMDSVIETAS-DLVSLSKYGAKPYEVVIICKDFEIGCLG- 240
++++K +++K LES +DS+ +T L+ Y +P + IICK + G G
Sbjct: 186 VVRSK------SQEMKTLESNLDSICKTPQVHKQELTTYAHRPELLPIICKAIDEGPGGR 239
Query: 241 ----------IPNFDTVIEIFDETVAFVNTTTEFHPDLDLDP--RRPIKDSLKTTRAVFR 288
+ D + + + +N + E+ + IK + +R +F
Sbjct: 240 ALQALEHAWDTADIDGDPDAIPQNGSLLNGSGEYKALMVRKTLCNEQIKRFVDRSRHIFA 299
Query: 289 QLGPWAAWRTAQVWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIE 348
+LG WAA ++L I+ Q L T+ + + + + L + +
Sbjct: 300 ELGEWAADYYICTSVEQLRTTIRDQSL---TMDWEDEERAYLSNFLSKLPVAEVQANLAD 356
Query: 349 ALRPYVPQRVIRLFEILETFN-PEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHI 407
+ ++ L L+ F+ PEF S +IFV QR + S+L + +
Sbjct: 357 PNNFTMSPKLAALINFLDKFDDPEF-------------SGLIFVKQR-VTVSVLARLLSL 402
Query: 408 KSWEPKFKFVNPDYV---VGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLE 464
+ + +F YV VG+ +++ K+Q + F N ++ TSVLE
Sbjct: 403 HP-QTRDRFRCAAYVGMSVGSCRQDMVGDWHNA--KKQRGTMDDFRSGRKNLIVTTSVLE 459
Query: 465 EGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKD 509
EG+DV C +V+ FD+P +++S++Q +GRAR+ S Y I D
Sbjct: 460 EGIDVTACRVVVCFDKPANLKSFIQRRGRARQQKSTYAIMFSTAD 504
Score = 196 (74.1 bits), Expect = 1.0e-53, Sum P(5) = 1.0e-53
Identities = 52/169 (30%), Positives = 88/169 (52%)
Links = 1-5-3-(2)-4
Query: 1500 QQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTP 1559
++ +S K +AD +EALIG L G + ++ L + + Q D+PS + T
Sbjct: 1028 KRQMSAKVLADVIEALIGAAYLD-GGHSKAQICTHCFLPEVNR-QPLDIPSLI-----TQ 1080
Query: 1560 TNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFL 1619
T + + + L+ +GY FK L++A TH S +++ T YQRLEFL
Sbjct: 1081 TEHGRTARHIID-------GDLQRHLGYTFKNEDLLIEALTHPSCQHDQTTQSYQRLEFL 1133
Query: 1620 GDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQK 1668
GDA+LD +I +F+ S + SPG +T ++ A+VN + ++F ++
Sbjct: 1134 GDAILDMVIVPIIFQYSNKISPGDMTLIKHAVVNANLLGFFCMEFSIEQ 1182
Score = 99 (39.9 bits), Expect = 1.0e-53, Sum P(5) = 1.0e-53
Identities = 36/155 (23%), Positives = 64/155 (41%)
Links = 1-5-(3)-2-4
Query: 1264 EIDDNAAKTDVLERENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHIDSDI 1323
E + +AK ++ E+C V + ++ + LI R + I D+
Sbjct: 867 ESEHGSAKVHMVAAESCTVDKLPVSTAIFGLFIPHIVDRLESTLIANR---LCATILCDV 923
Query: 1324 GLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARS 1383
G ++ TA+ +A + +R+E +GDS LK+ + L+ L+ EG L+ R+
Sbjct: 924 GFADIQHVI-TAIMAPSAQGVTNYQRYEFLGDSILKYIVSCQLFFQNLNWPEGFLTEGRT 982
Query: 1384 KEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPP 1418
V N L R G+ I+ W+ P
Sbjct: 983 TIVQNPRLTRAALDAGLDSFIITKALTPR-RWIAP 1016
Score = 65 (27.9 bits), Expect = 1.0e-53, Sum P(5) = 1.0e-53
Identities = 14/22 (63%), Positives = 16/22 (72%)
Links = 1-5-3-2-(4)
Query: 1722 KAMGDIFESVAGAIYLDSGRNL 1743
K DI ESV GAIY+DSG +L
Sbjct: 1257 KFFSDIVESVLGAIYVDSGGDL 1278
Score = 54 (24.1 bits), Expect = 1.0e-53, Sum P(5) = 1.0e-53
Identities = 29/111 (26%), Positives = 52/111 (46%)
Links = 1-(5)-3-2-4
Query: 502 VITVEEKDTAAY--CSKLPSDIFTRLVPHNQIIPIEEN--GVTKYCAELLLP--INSPIK 555
VIT + T Y C+ LP + R V + E++ G+ K ++LP ++ ++
Sbjct: 555 VITPDSVVTHLYHFCAVLPEE---RYVDNRPEFSFEKDRQGLIK--GTVILPSCVHPKVR 609
Query: 556 HAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESIAKLLEH 606
I K +++ A A +A R L+ G L+D+LLP + + +H
Sbjct: 610 R-IQGKLWWKSERAAVKETAFQAYRALYEFGLLNDHLLPLTKNPEMRPTDH 659
Score = 41 (19.5 bits), Expect = 2.2e-52, Sum P(5) = 2.2e-52
Identities = 10/30 (33%), Positives = 14/30 (46%)
Links = 1-(6)-3-2-4
Query: 828 YYVAEILPEWRPSSKFPDTHFETFNEYFIK 857
Y+ +LPE R P+ FE + IK
Sbjct: 566 YHFCAVLPEERYVDNRPEFSFEKDRQGLIK 595
>sp|Q4WA22.2|DCL2_ASPFU RecName: Full=Dicer-like protein 2; Includes: RecName:
Full=Endoribonuclease dcl2; Includes: RecName: Full=ATP-dependent
helicase dcl2
Length = 1388
Score = 369 (135.0 bits), Expect = 1.7e-51, Sum P(5) = 1.7e-51
Identities = 156/536 (29%), Positives = 255/536 (47%)
Links = (1)-5-3-2-4
Query: 7 DLQCFNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAF 66
D + PR+YQ+E+L+ + K+N IV + TGSGKT IAVL +K + + +P K +
Sbjct: 10 DASPYQPRNYQLEMLEASMKENIIVAMDTGSGKTHIAVLRIKAE-LDICSP----DKVVW 64
Query: 67 FVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGL-----WDSKEQCDQFMKRHHVVVIT 121
F+ V L QQ H EV S + V +T +GL W + D + + V+V T
Sbjct: 65 FLAPTVALCIQQ--H-EVIAS-NLPAVRTRTLTGLDKVELWTDQSIWDAVLNGYRVIVST 120
Query: 122 AQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDY--KLLKKDKP--VPRVL 177
L D + H ++K+ + +LIFDE HH +H IM D+ L K P VPR++
Sbjct: 121 HAVLADALSHGFVKMSQLALLIFDEAHHCT-RRHAANKIMQDFYHPTLTKSGPAAVPRIM 179
Query: 178 GLTASLIKAKVAPEKLMEQLKKLESAMDSVIETAS-DLVSLSKYGAKPY--EVVIICKD- 233
GLTAS + E LM +ES +D+V T L K+ +P+ ++ D
Sbjct: 180 GLTASPVVRSNHQELLM-----VESNLDAVCRTPRLHRQELLKFTHRPHLQQIWYTPTDP 234
Query: 234 --FEIGCLGIPNFDTVIEIFD-ETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFR-Q 289
F L + E D ++ + P LD R +K +L T + R Q
Sbjct: 235 AGFRSASLTLGALYHAWENLDIGDDPYIQRLRK-SP---LDDRA-LKKALLTGKTYCREQ 289
Query: 290 LGPWAAWRTAQVWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEA 349
L + R+ ++E ELG+ + + + + S ++ E +K ++
Sbjct: 290 LRRFVD-RSRHIFE-ELGEWAAEYYIYASIKQLRDRVRDSYMSGDW---DEAEKAYLVDF 344
Query: 350 LRPYVPQRVIRLFEILET----FNPEFQKERMKLEKAEH--LSAIIFVDQRYIAYSLLLM 403
L +P I F + + +P+F+ L+ ++ S +IFV QR + S +
Sbjct: 345 LSK-IPTSDIH-FALNDPDGFRISPKFESLLNFLDSSDQREFSGLIFVKQR-VTVSAMTS 401
Query: 404 MRHIKSWEPKFKFVNPDYVVGASGRNLASSDSQG--LHKR-QTEVLRRFHRNEINCLIAT 460
+ + + + +F YV G S + AS D G L+ + Q + L F N +IAT
Sbjct: 402 LLSVHPYTRE-RFRCAAYV-GWSNSS-ASKDILGDLLNMQLQRDTLDDFRSGRKNLIIAT 458
Query: 461 SVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKDTAAYCSK 516
VLEEG+D+ C++V+ +D+P +++S++Q +GRARR S + I DT+A S+
Sbjct: 459 DVLEEGIDLSACSVVVCYDKPPNLKSFIQRRGRARRKQSTFAIMFPTDDTSADVSR 514
Score = 178 (67.7 bits), Expect = 1.7e-51, Sum P(5) = 1.7e-51
Identities = 54/165 (32%), Positives = 86/165 (52%)
Links = 1-5-3-(2)-4
Query: 1500 QQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTP 1559
++ +S K +AD VEALIG + G + T + I++ +P L +DT
Sbjct: 1035 KRQMSTKVLADVVEALIGAAYVD-GGHSTAQAC-------IRRF----LPEINLHAVDTR 1082
Query: 1560 TNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFL 1619
T A+ + + +L++ IGY F++ + LV+A TH S + T YQRLE+L
Sbjct: 1083 T---AARSVAPESARHMMNDRLKDHIGYTFEDESLLVEALTHPSCDYDSTTQSYQRLEYL 1139
Query: 1620 GDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKF 1664
GDAVLD +I +F Q G +T ++ A+VN + A L ++F
Sbjct: 1140 GDAVLDMVIVSAIFNHRIQRPQGDMTKIKHAVVNANLLAFLCMEF 1184
Score = 116 (45.9 bits), Expect = 1.7e-51, Sum P(5) = 1.7e-51
Identities = 45/158 (28%), Positives = 69/158 (43%)
Links = 1-5-(3)-2-4
Query: 1263 QEIDDNAAKTDVLERENCEV--LPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHID 1320
+ I D+AAK ++ E C + LP + S E I LI R + +
Sbjct: 873 EAIPDSAAKNPIVAAEACTIDRLPFTMAIFGLFISAIVEQLEIE--LIATRLRDTILR-- 928
Query: 1321 SDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSF 1380
D+ S ++TA++T A + +R+E +GDS LKF+ + L+ + HEG LS
Sbjct: 929 -DVSFK-STDHIITAISTPLAHRLTNYQRYEFLGDSILKFSVSCQLFFQHPNWHEGYLSE 986
Query: 1381 ARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPP 1418
R V N L + G+ IV + A W P
Sbjct: 987 GRDMIVQNPRLAKAALDTGLDAYIVTKRL-ASRKWSAP 1023
Score = 74 (31.1 bits), Expect = 1.7e-51, Sum P(5) = 1.7e-51
Identities = 35/126 (27%), Positives = 61/126 (48%)
Links = 1-5-3-2-(4)
Query: 1718 IEVPKAMGDIFESVAGAIYLDSGRNLDT----TWQV-IFHMMRGTIELCC-ANPPRSPIR 1771
+ K DI ESV GAI++DSG NL Q+ + +R ++ PRS ++
Sbjct: 1259 LNADKFFSDIIESVLGAIFVDSGGNLAPCEVFVEQIGLMAYLRRILDHGIDVRHPRSVVQ 1318
Query: 1772 ELMEFEQSKVRFSKMERI-LESG--KVRVTVEVVNNMRFTGMG-RNYRIAKATAAKRALK 1827
+L + + ++F ++R+ E G + +V++ F G A+ TAA A+K
Sbjct: 1319 QLAK---TNIQFV-LQRVPTEEGGASYQCSVQMEQAELFVVTGCLTAEEAEVTAAVEAIK 1374
Query: 1828 YLHQIE 1833
+L + E
Sbjct: 1375 FLTRDE 1380
Score = 53 (23.7 bits), Expect = 1.7e-51, Sum P(5) = 1.7e-51
Identities = 30/145 (20%), Positives = 61/145 (42%)
Links = 1-(5)-3-2-4
Query: 513 YCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLP--INSPIKHAIVLKNPMPNKKTA 570
+C+ LP + + P E+G+ K ++LP ++ ++ + ++ A
Sbjct: 571 FCAVLPPQPYVDMRPVFSF-ETNEDGLLK--GTVILPSCVHPKVRRTEG-RRWWRTERAA 626
Query: 571 QMAVALEACRQLHLEGELDDNLLPKGRESIAKL-----LEHIDEEPDEYAPGIAAKVGSS 625
A +A + L+ G ++D+LLP ++ K + I E ++Y P I S
Sbjct: 627 MKETAFQAYKSLYEFGLVNDHLLPLTKKPELKTHDLGSMPSILETSEQYDPWIEWAYSWS 686
Query: 626 KRKQLYDKKIARALNESFVEADKEC 650
++ +I +NE D+ C
Sbjct: 687 S-PDIHQSRIVVKMNEG--RGDELC 708
Parameters:
links
postsw
-i cele_dcr1.fa
-i cele_dcr1.fa
wordmask=seg+xnu
-d /data/databases/BLAST/swissprot
-o celedcr1-vs-swissprot.BLASTP
E=1e-50
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.318 0.134 0.390 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 1845 1845 9.0e-51 566 3 11 22 0.41 34
40 0.45 37
Statistics:
Database: /data/databases/BLAST/swissprot
Title: swissprot
Posted: 9:42:51 AM PST Dec 14, 2008
Created: 9:42:51 AM PST Dec 14, 2008
Format: XDF-1
# of letters in database: 132,868,552
# of sequences in database: 353,658
# of database sequences satisfying E: 19
No. of states in DFA: 634 (134 KB)
Total size of DFA: 1250 KB (2395 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 4
Search cpu time: 109.05u 0.35s 109.40t Elapsed: 00:00:27
Total cpu time: 109.26u 0.35s 109.61t Elapsed: 00:00:27
Start: Sun Dec 14 09:52:50 2008 End: Sun Dec 14 09:53:17 2008