Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Browse files
Browse the repository at this point in the history
Merge branch 'topic/bug-3376'
- Loading branch information
Showing
3 changed files
with
54 additions
and
2 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,38 @@ | ||
hmmpfam - search one or more sequences against HMM database | ||
HMMER 2.3.2 (Oct 2003) | ||
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine | ||
Freely distributed under the GNU General Public License (GPL) | ||
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - | ||
HMM file: testInput.hmm | ||
Sequence file: testInput.fasta | ||
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - | ||
|
||
Query sequence: Test | ||
Accession: [none] | ||
Description: [none] | ||
|
||
Scores for sequence family classification (score includes all domains): | ||
Model Description Score E-value N | ||
-------- ----------- ----- ------- --- | ||
TEST 184.7 2.5e-56 1 | ||
|
||
Parsed for domains: | ||
Model Domain seq-f seq-t hmm-f hmm-t score E-value | ||
-------- ------- ----- ----- ----- ----- ----- ------- | ||
TEST 1/1 8 97 .] 1 95 [] 184.7 2.5e-56 | ||
|
||
Alignments of top-scoring domains: | ||
TEST: domain 1 of 1, from 8 to 97: score 184.7, E = 2.5e-56 | ||
*->svfqqqqssksttgstvtAiAiAigYRYRYRAvtWnsGsLssGvnDn | ||
sv+qqqq+ + +vtAiAiAigYRYRYRAv Wn GsLs G nDn | ||
Test 8 SVYQQQQGGSA----MVTAIAIAIGYRYRYRAVVWNKGSLSTGTNDN 50 | ||
|
||
DnDqqsdgLYtiYYsvtvpssslpsqtviHHHaHkasstkiiikiePr<- | ||
DnDq +d LYtiYYsvtv +ss+p q+v+HHHaH+asstkiiiki P | ||
Test 51 DNDQAAD-LYTIYYSVTVSASSWPGQSVTHHHAHPASSTKIIIKIAPS 97 | ||
|
||
* | ||
|
||
Test - - | ||
|
||
// |