Skip to content

HTTPS clone URL

Subversion checkout URL

You can clone with
or
.
Download ZIP
Browse files

fixing bug 3375 and adding tests

  • Loading branch information...
commit 6733b269a20baf836ef413595105805518fff41e 1 parent fac6f33
@pcantalupo pcantalupo authored
View
30 Bio/SeqIO/genbank.pm
@@ -587,20 +587,30 @@ sub next_seq {
-version => $version,
-database => $db || 'GenBank',
-tagname => 'dblink'));
- } elsif ( $dbsource =~ /(\S+)([\.:])\s*(\d+)/ ) {
- my ($id, $db, $version);
+ } elsif ( $dbsource =~ /(\S+)([\.:])\s*(\S+)/ ) {
+ my ($db, $version);
+ my @ids = ();
if ($2 eq ':') {
- ($db, $id) = ($1, $3);
+ $db = $1;
+ # Genbank 192 release notes say this: "The second field can consist of
+ # multiple comma-separated identifiers, if a sequence record has
+ # multiple DBLINK cross-references of a given type."
+ # For example: DBLINK Project:100,200,300"
+ @ids = split (/,/, $3);
} else {
- ($db, $id, $version) = ('GenBank', $1, $3);
+ ($db, $version) = ('GenBank', $3);
+ $ids[0] = $1;
}
- $annotation->add_Annotation('dblink',
- Bio::Annotation::DBLink->new(
- -primary_id => $id,
- -version => $version,
- -database => $db,
- -tagname => 'dblink')
+
+ foreach my $id (@ids) {
+ $annotation->add_Annotation('dblink',
+ Bio::Annotation::DBLink->new(
+ -primary_id => $id,
+ -version => $version,
+ -database => $db,
+ -tagname => 'dblink')
);
+ }
} else {
$self->warn("Unrecognized DBSOURCE data: $dbsource\n");
}
View
21 t/SeqIO/genbank.t
@@ -7,7 +7,7 @@ BEGIN {
use lib '.';
use Bio::Root::Test;
- test_begin(-tests => 274 );
+ test_begin(-tests => 283 );
use_ok('Bio::SeqIO::genbank');
}
@@ -601,3 +601,22 @@ $as = $ast->next_seq;
($cds) = grep { $_->primary_tag eq 'CDS' } $as->get_SeqFeatures();
@notes = $cds->get_tag_values('note');
is(scalar @notes, 2);
+
+
+#bug 3375
+my $in = Bio::SeqIO->new(-format => 'genbank',
+ -file => test_input_file('NC_002058_multDBLINK_bug3375.gb'));
+my $seq = $in->next_seq(); # should not throw a warning now
+my @dblinks = $seq->annotation->get_Annotations('dblink'); # contains 5 dblink references
+is($dblinks[0]->database, 'BioProject', 'bug3375 database is BioProject');
+is($dblinks[0]->primary_id, 'PRJNA15288', 'bug3375 primary_id is PRJNA15288');
+
+is($dblinks[1]->database, 'Project');
+is($dblinks[1]->primary_id, '100');
+is($dblinks[3]->database, 'Project');
+is($dblinks[3]->primary_id, '300');
+
+is($dblinks[4]->database, 'GenBank');
+is($dblinks[4]->primary_id, 'NC_002058');
+is($dblinks[4]->version, '3');
+
View
479 t/data/NC_002058_multDBLINK_bug3375.gb
@@ -0,0 +1,479 @@
+LOCUS NC_002058 7440 bp ss-RNA linear VRL 08-DEC-2008
+DEFINITION Poliovirus, complete genome.
+ACCESSION NC_002058
+VERSION NC_002058.3 GI:12408699
+DBLINK BioProject: PRJNA15288
+DBLINK Project:100,200,300
+DBLINK NC_002058.3
+KEYWORDS coat protein; complementary DNA; genome; polyprotein.
+SOURCE Human enterovirus C
+ ORGANISM Human enterovirus C
+ Viruses; ssRNA positive-strand viruses, no DNA stage;
+ Picornavirales; Picornaviridae; Enterovirus.
+REFERENCE 1 (sites)
+ AUTHORS Dorner,A.J., Dorner,L.F., Larsen,G.R., Wimmer,E. and Anderson,C.W.
+ TITLE Identification of the initiation site of poliovirus polyprotein
+ synthesis
+ JOURNAL J. Virol. 42 (3), 1017-1028 (1982)
+ PUBMED 6284987
+REFERENCE 2 (sites)
+ AUTHORS Emini,E.A., Elzinga,M. and Wimmer,E.
+ TITLE Carboxy-terminal analysis of poliovirus proteins: termination of
+ poliovirus RNA translation and location of unique poliovirus
+ polyprotein cleavage sites
+ JOURNAL J. Virol. 42 (1), 194-199 (1982)
+ PUBMED 6283138
+REFERENCE 3 (bases 1 to 7440)
+ AUTHORS Racaniello,V.R. and Baltimore,D.
+ TITLE Molecular cloning of poliovirus cDNA and determination of the
+ complete nucleotide sequence of the viral genome
+ JOURNAL Proc. Natl. Acad. Sci. U.S.A. 78 (8), 4887-4891 (1981)
+ PUBMED 6272282
+REFERENCE 4 (bases 1 to 7440)
+ AUTHORS Kitamura,N., Semler,B.L., Rothberg,P.G., Larsen,G.R., Adler,C.J.,
+ Dorner,A.J., Emini,E.A., Hanecak,R., Lee,J.J., van der Werf,S.,
+ Anderson,C.W. and Wimmer,E.
+ TITLE Primary structure, gene organization and polypeptide expression of
+ poliovirus RNA
+ JOURNAL Nature 291 (5816), 547-553 (1981)
+ PUBMED 6264310
+REFERENCE 5 (bases 5360 to 5527)
+ AUTHORS Kitamura,N., Adler,C.J., Rothberg,P.G., Martinko,J., Nathenson,S.G.
+ and Wimmer,E.
+ TITLE The genome-linked protein of picornaviruses. VII. Genetic mapping
+ of poliovirus VPg by protein and RNA sequence studies
+ JOURNAL Cell 21 (1), 295-302 (1980)
+ PUBMED 6250717
+REFERENCE 6 (bases 6383 to 7440)
+ AUTHORS Kitamura,N. and Wimmer,E.
+ TITLE Sequence of 1060 3'-terminal nucleotides of poliovirus RNA as
+ determined by a modification of the dideoxynucleotide method
+ JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (6), 3196-3200 (1980)
+ PUBMED 6158042
+REFERENCE 7 (bases 1 to 7440)
+ CONSRTM NCBI Genome Project
+ TITLE Direct Submission
+ JOURNAL Submitted (01-AUG-2000) National Center for Biotechnology
+ Information, NIH, Bethesda, MD 20894, USA
+COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
+ reference sequence was derived from V01149.
+ On Jan 24, 2001 this sequence version replaced gi:12331600.
+ See also entries V01148 (POLIO1A, for another version of this
+ genome) and V01150 (POLIOS1, for the genome of the Sabin 1 strain).
+ See the entry V01148 (POLIO1A) for the sequence reported in [3].
+ Mature peptides were added to the annotation by NCBI RefSeq Genomes
+ staff.
+ COMPLETENESS: full length.
+FEATURES Location/Qualifiers
+ source 1..7440
+ /organism="Human enterovirus C"
+ /mol_type="genomic RNA"
+ /strain="Human poliovirus 1 Mahoney"
+ /db_xref="taxon:138950"
+ conflict 284..288
+ /note="CGCUC is GUU in [3]"
+ /citation=[4]
+ conflict 352
+ /note="G is U in [3]"
+ /citation=[4]
+ conflict 387
+ /note="GC is C in [3]"
+ /citation=[4]
+ conflict 488
+ /note="G is GU in [3]"
+ /citation=[4]
+ gene 743..7372
+ /locus_tag="PVgp1"
+ /db_xref="GeneID:919920"
+ CDS 743..7372
+ /locus_tag="PVgp1"
+ /codon_start=1
+ /product="polyprotein"
+ /protein_id="NP_041277.1"
+ /db_xref="GI:9627037"
+ /db_xref="GOA:P03300"
+ /db_xref="UniProtKB/Swiss-Prot:P03300"
+ /db_xref="GeneID:919920"
+ /translation="MGAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQ
+ DFSQDPSKFTEPIKDVLIKTAPMLNSPNIEACGYSDRVLQLTLGNSTITTQEAANSVV
+ AYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGL
+ FGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNAN
+ PGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCAT
+ LVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRN
+ ITLPRLQGLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDT
+ MIPFDLSATKKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTH
+ WAGSLKFTFLFCGFMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMV
+ VPWISNTTYRQTIDDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLL
+ RDTTHIEQKALAQGLGQMLESMIDNTVRETVGAATSRDALPNTEASGPTHSKEIPALT
+ AVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDK
+ LFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVP
+ PGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKD
+ QSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAV
+ AYYGPGVDYKDGTLTPLSTKDLTTYGFGHQNKAVYTAGYKICNYHLATQDDLQNAVNV
+ MWSRDLLVTESRAQGTDSIARCNCNAGVYYCESRRKYYPVSFVGPTFQYMEANNYYPA
+ RYQSHMLIGHGFASPGDCGGILRCHHGVIGIITAGGEGLVAFSDIRDLYAYEEEAMEQ
+ GITNYIESLGAAFGSGFTQQISDKITELTNMVTSTITEKLLKNLIKIISSLVIITRNY
+ EDTTTVLATLALLGCDASPWQWLRKKACDVLEIPYVIKQGDSWLKKFTEACNAAKGLE
+ WVSNKISKFIDWLKEKIIPQARDKLEFVTKLRQLEMLENQISTIHQSCPSQEHQEILF
+ NNVRWLSIQSKRFAPLYAVEAKRIQKLEHTINNYIQFKSKHRIEPVCLLVHGSPGTGK
+ SVATNLIARAIAERENTSTYSLPPDPSHFDGYKQQGVVIMDDLNQNPDGADMKLFCQM
+ VSTVEFIPPMASLEEKGILFTSNYVLASTNSSRISPPTVAHSDALARRFAFDMDIQVM
+ NEYSRDGKLNMAMATEMCKNCHQPANFKRCCPLVCGKAIQLMDKSSRVRYSIDQITTM
+ IINERNRRSNIGNCMEALFQGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCE
+ KKGWIVNITSQVQTERNINRAMTILQAVTTFAAVAGVVYVMYKLFAGHQGAYTGLPNK
+ KPNVPTIRTAKVQGPGFDYAVAMAKRNIVTATTSKGEFTMLGVHDNVAILPTHASPGE
+ SIVIDGKEVEILDAKALEDQAGTNLEITIITLKRNEKFRDIRPHIPTQITETNDGVLI
+ VNTSKYPNMYVPVGAVTEQGYLNLGGRQTARTLMYNFPTRAGQCGGVITCTGKVIGMH
+ VGGNGSHGFAAALKRSYFTQSQGEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEG
+ VKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQ
+ MCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINL
+ PLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAV
+ GCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYL
+ NHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAY
+ GDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKY
+ PFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIG
+ RALLLPEYSTLYRRWLDSF"
+ mat_peptide 746..949
+ /locus_tag="PVgp1"
+ /product="coat protein VP4"
+ /protein_id="NP_740468.1"
+ /db_xref="GI:25121840"
+ mat_peptide 950..1765
+ /locus_tag="PVgp1"
+ /product="coat protein VP2"
+ /protein_id="NP_740469.1"
+ /db_xref="GI:25121841"
+ mat_peptide 1766..2479
+ /locus_tag="PVgp1"
+ /product="coat protein VP3"
+ /protein_id="NP_740470.1"
+ /db_xref="GI:25121842"
+ mat_peptide 2480..3385
+ /locus_tag="PVgp1"
+ /product="coat protein VP1"
+ /protein_id="NP_740471.1"
+ /db_xref="GI:25121843"
+ mat_peptide 3386..3832
+ /locus_tag="PVgp1"
+ /product="Picornain 2A"
+ /note="Small chymotrypsin-like cysteine proteinase"
+ /protein_id="NP_740477.1"
+ /db_xref="GI:25121849"
+ mat_peptide 3833..4123
+ /locus_tag="PVgp1"
+ /product="protein 2B"
+ /protein_id="NP_740472.1"
+ /db_xref="GI:25121844"
+ mat_peptide 4124..5110
+ /locus_tag="PVgp1"
+ /product="protein 2C (NTPase)"
+ /note="Involved in initiation and elongation of RNA
+ synthesis, RNA encapsidation, virus uncoating and
+ guanidine resistance (Asn179-Gly mutation). Putative
+ helicase III."
+ /protein_id="NP_740473.1"
+ /db_xref="GI:25121845"
+ mat_peptide 5111..5371
+ /locus_tag="PVgp1"
+ /product="protein 3A"
+ /protein_id="NP_740474.1"
+ /db_xref="GI:25121846"
+ mat_peptide 5372..5437
+ /locus_tag="PVgp1"
+ /product="genome linked protein VPg"
+ /protein_id="NP_740475.1"
+ /db_xref="GI:25121847"
+ mat_peptide 5438..5986
+ /locus_tag="PVgp1"
+ /product="Picornain 3C"
+ /note="Chymotrypsin-like cystein proteinase 3C"
+ /protein_id="NP_740476.2"
+ /db_xref="GI:62871476"
+ mat_peptide 5987..7369
+ /locus_tag="PVgp1"
+ /product="RNA-directed RNA-polymerase 3D"
+ /protein_id="NP_740478.2"
+ /db_xref="GI:62871477"
+ conflict 1467..1468
+ /locus_tag="PVgp1"
+ /note="GG is G in [3]"
+ /citation=[4]
+ conflict 1529..1530
+ /locus_tag="PVgp1"
+ /note="CC is C in [3]"
+ /citation=[4]
+ conflict 1534..1535
+ /locus_tag="PVgp1"
+ /note="CC is C in [3]"
+ /citation=[4]
+ conflict 1547
+ /locus_tag="PVgp1"
+ /note="C is U in [3]"
+ /citation=[4]
+ conflict 1579
+ /locus_tag="PVgp1"
+ /note="C is A in [3]"
+ /citation=[4]
+ conflict 1601
+ /locus_tag="PVgp1"
+ /note="A is C in [3]"
+ /citation=[4]
+ conflict 1668
+ /locus_tag="PVgp1"
+ /note="C is U in [3]"
+ /citation=[4]
+ conflict 2001
+ /locus_tag="PVgp1"
+ /note="A is C in [3]"
+ /citation=[4]
+ conflict 2004..2006
+ /locus_tag="PVgp1"
+ /note="AUC is CCU in [3]"
+ /citation=[4]
+ conflict 2035
+ /locus_tag="PVgp1"
+ /note="U is C in [3]"
+ /citation=[4]
+ conflict 2133
+ /locus_tag="PVgp1"
+ /note="U is C in [3]"
+ /citation=[4]
+ conflict 2286
+ /locus_tag="PVgp1"
+ /note="C is G in [3]"
+ /citation=[4]
+ conflict 2983
+ /locus_tag="PVgp1"
+ /note="G is A in [3]"
+ /citation=[4]
+ conflict 3043
+ /locus_tag="PVgp1"
+ /note="A is G in [3]"
+ /citation=[4]
+ conflict 3303..3304
+ /locus_tag="PVgp1"
+ /note="GG is G in [3]"
+ /citation=[4]
+ conflict 3308
+ /locus_tag="PVgp1"
+ /note="G is GC in [3]"
+ /citation=[4]
+ conflict 3657
+ /locus_tag="PVgp1"
+ /note="C is U in [3]"
+ /citation=[4]
+ conflict 3696
+ /locus_tag="PVgp1"
+ /note="C is A in [3]"
+ /citation=[4]
+ conflict 3766
+ /locus_tag="PVgp1"
+ /note="C is A in [3]"
+ /citation=[4]
+ conflict 4158
+ /locus_tag="PVgp1"
+ /note="C is CC in [3]"
+ /citation=[4]
+ conflict 4163..4164
+ /locus_tag="PVgp1"
+ /note="GC is G in [3]"
+ /citation=[4]
+ conflict 4174
+ /locus_tag="PVgp1"
+ /note="A is C in [3]"
+ /citation=[4]
+ conflict 5113
+ /locus_tag="PVgp1"
+ /note="A is C in [3]"
+ /citation=[4]
+ conflict 5598
+ /locus_tag="PVgp1"
+ /note="U is C in [3]"
+ /citation=[4]
+ conflict 5619..5623
+ /locus_tag="PVgp1"
+ /note="CGCUC is UGUUU in [3]"
+ /citation=[4]
+ conflict 5645
+ /locus_tag="PVgp1"
+ /note="C is U in [3]"
+ /citation=[4]
+ conflict 5786
+ /locus_tag="PVgp1"
+ /note="G is C in [3]"
+ /citation=[4]
+ conflict 5903..5905
+ /locus_tag="PVgp1"
+ /note="AAA is AA in [3]"
+ /citation=[4]
+ conflict 5927..5931
+ /locus_tag="PVgp1"
+ /note="GGGAA is GGA in [3]"
+ /citation=[4]
+ conflict 5970..5971
+ /locus_tag="PVgp1"
+ /note="AC is UA in [3]"
+ /citation=[4]
+ conflict 5997
+ /locus_tag="PVgp1"
+ /note="A is C in [3]"
+ /citation=[4]
+ conflict 6019
+ /locus_tag="PVgp1"
+ /note="A is C in [3]"
+ /citation=[4]
+ conflict 6021
+ /locus_tag="PVgp1"
+ /note="U is C in [3]"
+ /citation=[4]
+ conflict 6261
+ /locus_tag="PVgp1"
+ /note="C is U in [3]"
+ /citation=[4]
+ conflict 6845..6847
+ /locus_tag="PVgp1"
+ /note="CCA is CA in [2]"
+ /citation=[5]
+ conflict 6978..6979
+ /locus_tag="PVgp1"
+ /note="UU is UUU in [2]"
+ /citation=[5]
+ conflict 7258
+ /locus_tag="PVgp1"
+ /note="U is UU in [2]"
+ /citation=[5]
+ conflict 7410
+ /note="U is C in [3] and [2]"
+ /citation=[4]
+ /citation=[5]
+ conflict 7440
+ /note="G is GG in [3] and [2]"
+ /citation=[4]
+ /citation=[5]
+ORIGIN
+ 1 ttaaaacagc tctggggttg tacccacccc agaggcccac gtggcggcta gtactccggt
+ 61 attgcggtac ccttgtacgc ctgttttata ctcccttccc gtaacttaga cgcacaaaac
+ 121 caagttcaat agaagggggt acaaaccagt accaccacga acaagcactt ctgtttcccc
+ 181 ggtgatgtcg tatagactgc ttgcgtggtt gaaagcgacg gatccgttat ccgcttatgt
+ 241 acttcgagaa gcccagtacc acctcggaat cttcgatgcg ttgcgctcag cactcaaccc
+ 301 cagagtgtag cttaggctga tgagtctgga catccctcac cggtgacggt ggtccaggct
+ 361 gcgttggcgg cctacctatg gctaacgcca tgggacgcta gttgtgaaca aggtgtgaag
+ 421 agcctattga gctacataag aatcctccgg cccctgaatg cggctaatcc caacctcgga
+ 481 gcaggtggtc acaaaccagt gattggcctg tcgtaacgcg caagtccgtg gcggaaccga
+ 541 ctactttggg tgtccgtgtt tccttttatt ttattgtggc tgcttatggt gacaatcaca
+ 601 gattgttatc ataaagcgaa ttggattggc catccggtga aagtgagact cattatctat
+ 661 ctgtttgctg gatccgctcc attgagtgtg tttactctaa gtacaatttc aacagttatt
+ 721 tcaatcagac aattgtatca taatgggtgc tcaggtttca tcacagaaag tgggcgcaca
+ 781 tgaaaactca aatagagcgt atggtggttc taccattaat tacaccacca ttaattatta
+ 841 tagagattca gctagtaacg cggcttcgaa acaggacttc tctcaagacc cttccaagtt
+ 901 caccgagccc atcaaggatg tcctgataaa aacagcccca atgctaaact cgccaaacat
+ 961 agaggcttgc gggtatagcg atagagtact gcaattaaca ctgggaaact ccactataac
+ 1021 cacacaggag gcggctaatt cagtagtcgc ttatgggcgt tggcctgaat atctgaggga
+ 1081 cagcgaagcc aatccagtgg accagccgac agaaccagac gtcgctgcat gcaggtttta
+ 1141 tacgctagac accgtgtctt ggacgaaaga gtcgcgaggg tggtggtgga agttgcctga
+ 1201 tgcactgagg gacatgggac tctttgggca aaatatgtac taccactacc taggtaggtc
+ 1261 cgggtacacc gtgcatgtac agtgtaacgc ctccaaattc caccaggggg cactaggggt
+ 1321 attcgccgta ccagagatgt gtctggccgg ggatagcaac accactacca tgcacaccag
+ 1381 ctatcaaaat gccaatcctg gcgagaaagg aggcactttc acgggtacgt tcactcctga
+ 1441 caacaaccag acatcacctg cccgcaggtt ctgcccggtg gattacctcc ttggaaatgg
+ 1501 cacgttgttg gggaatgcct ttgtgttccc gcaccagata ataaacctac ggaccaacaa
+ 1561 ctgtgctaca ctggtactcc cttacgtgaa ctccctctcg atagatagta tggtaaagca
+ 1621 caataattgg ggaattgcaa tattaccatt ggccccatta aattttgcta gtgagtcctc
+ 1681 cccagagatt ccaatcacct tgaccatagc ccctatgtgc tgtgagttca atggattaag
+ 1741 aaacatcacc ctgccacgct tacagggcct gccggtcatg aacacccctg gtagcaatca
+ 1801 atatcttact gcagacaact tccagtcacc gtgtgcgctg cctgaatttg atgtgacccc
+ 1861 acctattgac atacccggtg aagtaaagaa catgatggaa ttggcagaaa tcgacaccat
+ 1921 gattcccttt gacttaagtg ccacaaaaaa gaacaccatg gaaatgtata gggttcggtt
+ 1981 aagtgacaaa ccacatacag acgatcccat actctgcctg tcactctctc cagcttcaga
+ 2041 tcctaggttg tcacatacta tgcttggaga aatcctaaat tactacacac actgggcagg
+ 2101 atccctgaag ttcacgtttc tgttctgtgg attcatgatg gcaactggca aactgttggt
+ 2161 gtcatacgcg cctcctggag ccgacccacc aaagaagcgt aaggaggcga tgttgggaac
+ 2221 acatgtgatc tgggacatag gactgcagtc ctcatgtact atggtagtgc catggattag
+ 2281 caacaccacg tatcggcaaa ccatagatga tagtttcacc gaaggcggat acatcagcgt
+ 2341 cttctaccaa actagaatag tcgtccctct ttcgacaccc agagagatgg acatccttgg
+ 2401 ttttgtgtca gcgtgtaatg acttcagcgt gcgcttgttg cgagatacca cacatataga
+ 2461 gcaaaaagcg ctagcacagg ggttaggtca gatgcttgaa agcatgattg acaacacagt
+ 2521 ccgtgaaacg gtgggggcgg caacatctag agacgctctc ccaaacactg aagccagtgg
+ 2581 accaacacac tccaaggaaa ttccggcact caccgcagtg gaaactgggg ccacaaatcc
+ 2641 actagtccct tctgatacag tgcaaaccag acatgttgta caacataggt caaggtcaga
+ 2701 gtctagcata gagtctttct tcgcgcgggg tgcatgcgtg accattatga ccgtggataa
+ 2761 cccagcttcc accacgaata aggataagct atttgcagtg tggaagatca cttataaaga
+ 2821 tactgtccag ttacggagga aattggagtt cttcacctat tctagatttg atatggaact
+ 2881 tacctttgtg gttactgcaa atttcactga gactaacaat gggcatgcct taaatcaagt
+ 2941 gtaccaaatt atgtacgtac caccaggcgc tccagtgccc gagaaatggg acgactacac
+ 3001 atggcaaacc tcatcaaatc catcaatctt ttacacctac ggaacagctc cagcccggat
+ 3061 ctcggtaccg tatgttggta tttcgaacgc ctattcacac ttttacgacg gtttttccaa
+ 3121 agtaccactg aaggaccagt cggcagcact aggtgactcc ctttatggtg cagcatctct
+ 3181 aaatgacttc ggtattttgg ctgttagagt agtcaatgat cacaacccga ccaaggtcac
+ 3241 ctccaaaatc agagtgtatc taaaacccaa acacatcaga gtctggtgcc cgcgtccacc
+ 3301 gagggcagtg gcgtactacg gccctggagt ggattacaag gatggtacgc ttacacccct
+ 3361 ctccaccaag gatctgacca catatggatt cggacaccaa aacaaagcgg tgtacactgc
+ 3421 aggttacaaa atttgcaact accacttggc cactcaggat gatttgcaaa acgcagtgaa
+ 3481 cgtcatgtgg agtagagacc tcttagtcac agaatcaaga gcccagggca ccgattcaat
+ 3541 cgcaaggtgc aattgcaacg caggggtgta ctactgcgag tctagaagga aatactaccc
+ 3601 agtatccttc gttggcccaa cgttccagta catggaggct aataactatt acccagctag
+ 3661 gtaccagtcc catatgctca ttggccatgg attcgcatct ccaggggatt gtggtggcat
+ 3721 actcagatgt caccacgggg tgatagggat cattactgct ggtggcgaag ggttggttgc
+ 3781 attttcagac attagagact tgtatgccta cgaagaagaa gccatggaac aaggcatcac
+ 3841 caattacata gagtcacttg gggccgcatt tggaagtgga tttactcagc agattagcga
+ 3901 caaaataaca gagttgacca atatggtgac cagtaccatc actgaaaagc tacttaagaa
+ 3961 cttgatcaag atcatatcct cactagttat tataactagg aactatgaag acaccacaac
+ 4021 agtgctcgct accctggccc ttcttgggtg tgatgcttca ccatggcagt ggcttagaaa
+ 4081 gaaagcatgc gatgttctgg agatacctta tgtcatcaag caaggtgaca gttggttgaa
+ 4141 gaagtttact gaagcatgca acgcagctaa gggactggag tgggtgtcaa acaaaatctc
+ 4201 aaaattcatt gattggctca aggagaaaat tatcccacaa gctagagata agttggaatt
+ 4261 tgtaacaaaa cttagacaac tagaaatgct ggaaaaccaa atctcaacta tacaccaatc
+ 4321 atgccctagt caggaacacc aggaaattct attcaataat gtcagatggt tatccatcca
+ 4381 gtctaagagg tttgcccctc tttacgcagt ggaagccaaa agaatacaga aactagagca
+ 4441 tactattaac aactacatac agttcaagag caaacaccgt attgaaccag tatgtttgct
+ 4501 agtacatggc agccccggaa caggtaaatc tgtagcaacc aacctgattg ctagagccat
+ 4561 agctgaaaga gaaaacacgt ccacgtactc gctacccccg gatccatcac acttcgacgg
+ 4621 atacaaacaa cagggagtgg tgattatgga cgacctgaat caaaacccag atggtgcgga
+ 4681 catgaagctg ttctgtcaga tggtatcaac agtggagttt ataccaccca tggcatccct
+ 4741 ggaggagaaa ggaatcctgt ttacttcaaa ttacgttcta gcatccacaa actcaagcag
+ 4801 aatttccccc cccactgtgg cacacagtga tgcattagcc aggcgctttg cgttcgacat
+ 4861 ggacattcag gtcatgaatg agtattctag agatgggaaa ttgaacatgg ccatggctac
+ 4921 tgaaatgtgt aagaactgtc accaaccagc aaactttaag agatgctgtc ctttagtgtg
+ 4981 tggtaaggca attcaattaa tggacaaatc ttccagagtt agatacagta ttgaccagat
+ 5041 cactacaatg attatcaatg agagaaacag aagatccaac attggcaatt gtatggaggc
+ 5101 tttgtttcaa ggaccactcc agtataaaga cttgaaaatt gacatcaaga cgagtccccc
+ 5161 tcctgaatgt atcaatgact tgctccaagc agttgactcc caggaggtga gagattactg
+ 5221 tgagaagaag ggttggatag tcaacatcac cagccaggtt caaacagaaa ggaacatcaa
+ 5281 cagggcaatg acaattctac aagcggtgac aaccttcgcc gcagtggctg gagttgtcta
+ 5341 tgtcatgtat aaactgtttg ctggacacca gggagcatac actggtttac caaacaaaaa
+ 5401 acccaacgtg cccaccattc ggacagcaaa ggtacaagga ccagggttcg attacgcagt
+ 5461 ggctatggct aaaagaaaca ttgttacagc aactactagc aagggagagt tcactatgtt
+ 5521 aggagtccac gacaacgtgg ctattttacc aacccacgct tcacctggtg aaagcattgt
+ 5581 gatcgatggc aaagaagtgg agatcttgga tgccaaagcg ctcgaagatc aagcaggaac
+ 5641 caatcttgaa atcactataa tcactctaaa gagaaatgaa aagttcagag acattagacc
+ 5701 acatatacct actcaaatca ctgagacaaa tgatggagtc ttgatcgtga acactagcaa
+ 5761 gtaccccaat atgtatgttc ctgtcggtgc tgtgactgaa cagggatatc taaatctcgg
+ 5821 tgggcgccaa actgctcgta ctctaatgta caactttcca accagagcag gacagtgtgg
+ 5881 tggagtcatc acatgtactg ggaaagtcat cgggatgcat gttggtggga acggttcaca
+ 5941 cgggtttgca gcggccctga agcgatcata cttcactcag agtcaaggtg aaatccagtg
+ 6001 gatgagacct tcgaaggaag tgggatatcc aatcataaat gccccgtcca aaaccaagct
+ 6061 tgaacccagt gctttccact atgtgtttga aggggtgaag gaaccagcag tcctcactaa
+ 6121 aaacgatccc aggcttaaga cagactttga ggaggcaatt ttctccaagt acgtgggtaa
+ 6181 caaaattact gaagtggatg agtacatgaa agaggcagta gaccactatg ctggccagct
+ 6241 catgtcacta gacatcaaca cagaacaaat gtgcttggag gatgccatgt atggcactga
+ 6301 tggtctagaa gcacttgatt tgtccaccag tgctggctac ccttatgtag caatgggaaa
+ 6361 gaagaagaga gacatcttga acaaacaaac cagagacact aaggaaatgc aaaaactgct
+ 6421 cgacacatat ggaatcaacc tcccactggt gacttatgta aaggatgaac ttagatccaa
+ 6481 aacaaaggtt gagcagggga aatccagatt aattgaagct tctagtttga atgactcagt
+ 6541 ggcaatgaga atggcttttg ggaacctata tgctgctttt cacaaaaacc caggagtgat
+ 6601 aacaggttca gcagtggggt gcgatccaga tttgttttgg agcaaaattc cggtattgat
+ 6661 ggaagagaag ctgtttgctt ttgactacac agggtatgat gcatctctca gccctgcttg
+ 6721 gttcgaggca ctaaagatgg tgcttgagaa aatcggattc ggagacagag ttgactacat
+ 6781 cgactaccta aaccactcac accacctgta caagaataaa acatactgtg tcaagggcgg
+ 6841 tatgccatct ggctgctcag gcacttcaat ttttaactca atgattaaca acttgattat
+ 6901 caggacactc ttactgaaaa cctacaaggg catagattta gaccacctaa aaatgattgc
+ 6961 ctatggtgat gatgtaattg cttcctaccc ccatgaagtt gacgctagtc tcctagccca
+ 7021 atcaggaaaa gactatggac taactatgac tccagctgac aaatcagcta catttgaaac
+ 7081 agtcacatgg gagaatgtaa cattcttgaa gagattcttc agggcagacg agaaataccc
+ 7141 atttcttatt catccagtaa tgccaatgaa ggaaattcat gaatcaatta gatggactaa
+ 7201 agatcctagg aacactcagg atcacgttcg ctctctgtgc cttttagctt ggcacaatgg
+ 7261 cgaagaagaa tataacaaat tcctagctaa aatcaggagt gtgccaattg gaagagcttt
+ 7321 attgctccca gagtactcaa cattgtaccg ccgttggctt gactcatttt agtaacccta
+ 7381 cctcagtcga attggattgg gtcatactgt tgtaggggta aatttttctt taattcggag
+//
+

0 comments on commit 6733b26

Please sign in to comment.
Something went wrong with that request. Please try again.