Skip to content
Fetching contributors…
Cannot retrieve contributors at this time
135 lines (100 sloc) 4.36 KB
BLASTX 2.0.10 [Aug-26-1999]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|1347369|gb|G25137|G25137 human STS EST48004.
(556 letters)
Database: data/swissprot
82,258 sequences; 29,652,561 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gi|1731448|sp|P54103|ZRF1_MOUSE ZUOTIN RELATED FACTOR-1 87 3e-17
gi|465911|sp|P34454|YMA9_CAEEL HYPOTHETICAL 31.6 KD PROTEIN F54... 42 0.001
gi|2494160|sp|Q61712|MTJ1_MOUSE DNAJ PROTEIN HOMOLOG MTJ1 37 0.033
gi|1730688|sp|P53745|YN8X_YEAST HYPOTHETICAL 68.1 KD PROTEIN IN... 29 7.4
>gi|1731448|sp|P54103|ZRF1_MOUSE ZUOTIN RELATED FACTOR-1
Length = 514
Score = 86.6 bits (211), Expect = 3e-17
Identities = 41/47 (87%), Positives = 44/47 (93%)
Frame = +1
Query: 1 DLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAK 141
DLQLLIKAVNLFPAG NSRW+VIANYMNIHSSSGVKRTAKDVI + +
Sbjct: 458 DLQLLIKAVNLFPAGRNSRWDVIANYMNIHSSSGVKRTAKDVISEVR 504
>gi|465911|sp|P34454|YMA9_CAEEL HYPOTHETICAL 31.6 KD PROTEIN F54F2.9
IN CHROMOSOME III
Length = 275
Score = 41.8 bits (96), Expect = 0.001
Identities = 30/122 (24%), Positives = 54/122 (43%)
Frame = +1
Query: 34 FPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKE 213
+PAGT +RWE + +N R+A+DVI A ++++ +++D K ++
Sbjct: 159 YPAGTPNRWEQMGRVLN--------RSAEDVIAMAGKMKQM---KQEDYTKLLMTTIQQS 207
Query: 214 HGVVPQADNATPSERFXGPYTDFTPXTTEXQKLXEQALNTYPVNTXERWXXIAVAVPGRX 393
V ++++ + QK E AL YP T ERW I+ + +
Sbjct: 208 VPVEEKSED---------------DWSQAEQKAFETALQKYPKGTDERWERISEEIGSKT 252
Query: 394 KE 399
K+
Sbjct: 253 KK 254
>gi|2494160|sp|Q61712|MTJ1_MOUSE DNAJ PROTEIN HOMOLOG MTJ1
Length = 552
Score = 36.7 bits (83), Expect = 0.033
Identities = 17/36 (47%), Positives = 19/36 (52%)
Frame = +1
Query: 292 TTEXQKLXEQALNTYPVNTXERWXXIAVAVPGRXKE 399
T QKL E AL YP +RW IA VP + KE
Sbjct: 496 TQSQQKLLELALQQYPKGASDRWDKIAKCVPSKSKE 531
Score = 31.3 bits (69), Expect = 1.5
Identities = 18/50 (36%), Positives = 26/50 (52%)
Frame = +1
Query: 1 DLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQ 150
DL L +++ FP GT RW+ IA+ + R+ DV KAK L+
Sbjct: 332 DLSQLTRSMVKFPGGTPGRWDKIAHELG--------RSVTDVTTKAKELK 373
>gi|1730688|sp|P53745|YN8X_YEAST HYPOTHETICAL 68.1 KD PROTEIN IN
BIO3-FRE4 INTERGENIC REGION
Length = 580
Score = 29.0 bits (63), Expect = 7.4
Identities = 27/99 (27%), Positives = 41/99 (41%)
Frame = +1
Query: 52 SRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQ 231
+RW+ +Y V R+ KDV ++SL LD +QK +A H +
Sbjct: 75 NRWKSFISY--------VTRSRKDVKTVSRSLSNLDLYQKCSKEIRADQDISLLHSI--- 123
Query: 232 ADNATPSERFXGPYTDFTPXTTEXQKLXEQALNTYPVNT 348
E PY +FT + EQ+ N +PV+T
Sbjct: 124 -------ETKLFPYINFTALNS------EQSHNFWPVHT 149
Database: data/swissprot
Posted date: Nov 15, 1999 2:55 PM
Number of letters in database: 29,652,561
Number of sequences in database: 82,258
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.270 0.0470 0.230
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23174157
Number of Sequences: 82258
Number of extensions: 387821
Number of successful extensions: 980
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 973
Number of HSP's gapped (non-prelim): 7
length of query: 185
length of database: 29,652,561
effective HSP length: 49
effective length of query: 135
effective length of database: 25,621,919
effective search space: 3458959065
effective search space used: 3458959065
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 62 (28.6 bits)
Jump to Line
Something went wrong with that request. Please try again.