Skip to content

HTTPS clone URL

Subversion checkout URL

You can clone with HTTPS or Subversion.

Download ZIP
Fetching contributors…

Cannot retrieve contributors at this time

609 lines (581 sloc) 31.458 kb
# Copyright 2009 by Eric Talevich. All rights reserved.
# Revisions copyright 2009-2010 by Peter Cock. All rights reserved.
#
# Converted by Eric Talevich from an older unit test copyright 2002
# by Thomas Hamelryck.
#
# This code is part of the Biopython distribution and governed by its
# license. Please see the LICENSE file that should have been included
# as part of this package.
"""Unit tests for the Bio.PDB module."""
import unittest
import warnings
from StringIO import StringIO
try:
from numpy.random import random
except ImportError:
from Bio import MissingExternalDependencyError
raise MissingExternalDependencyError(\
"Install NumPy if you want to use Bio.PDB.")
from Bio.Seq import Seq
from Bio.Alphabet import generic_protein
from Bio.PDB import PDBParser, PPBuilder, CaPPBuilder
from Bio.PDB import HSExposureCA, HSExposureCB, ExposureCN
from Bio.PDB.NeighborSearch import NeighborSearch
from Bio.PDB.PDBExceptions import PDBConstructionException, PDBConstructionWarning
class PDBNeighborTest(unittest.TestCase):
def setUp(self):
warnings.resetwarnings()
def test_neighbor_search(self):
"""NeighborSearch: Find nearby randomly generated coordinates.
Based on the self test in Bio.PDB.NeighborSearch.
"""
class RandomAtom:
def __init__(self):
self.coord = 100 * random(3)
def get_coord(self):
return self.coord
for i in range(0, 20):
atoms = [RandomAtom() for j in range(100)]
ns = NeighborSearch(atoms)
hits = ns.search_all(5.0)
self.assert_(hits >= 0)
class PDBExceptionTest(unittest.TestCase):
def test_strict(self):
"""Check error: Parse a flawed PDB file in strict mode."""
warnings.resetwarnings()
parser = PDBParser(PERMISSIVE=False)
self.assertRaises(PDBConstructionException,
parser.get_structure, "example", "PDB/a_structure.pdb")
#TODO - check get expected warnings, may require Python 2.6+
#See Bug 2820
def test_bad_xyz(self):
"""Check error: Parse an entry with bad x,y,z value."""
data = "ATOM 9 N ASP A 152 21.554 34.953 27.691 1.00 19.26 N\n"
parser = PDBParser(PERMISSIVE=False)
s = parser.get_structure("example", StringIO(data))
data = "ATOM 9 N ASP A 152 21.ish 34.953 27.691 1.00 19.26 N\n"
self.assertRaises(PDBConstructionException,
parser.get_structure, "example", StringIO(data))
class PDBParseTest(unittest.TestCase):
def setUp(self):
warnings.resetwarnings()
warnings.simplefilter('ignore', PDBConstructionWarning)
p = PDBParser(PERMISSIVE=1)
self.structure = p.get_structure("example", "PDB/a_structure.pdb")
def test_c_n(self):
"""Extract polypeptides using C-N."""
ppbuild = PPBuilder()
polypeptides = ppbuild.build_peptides(self.structure[1])
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 2)
self.assertEqual(pp[-1].get_id()[1], 86)
# Check the sequence
s = pp.get_sequence()
self.assert_(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("RCGSQGGGSTCPGLRCCSIWGWCGDSEPYCGRTCENKCWSGER"
"SDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGGNCQYRC",
str(s))
def test_ca_ca(self):
"""Extract polypeptides using CA-CA."""
ppbuild = CaPPBuilder()
polypeptides = ppbuild.build_peptides(self.structure[1])
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 2)
self.assertEqual(pp[-1].get_id()[1], 86)
# Check the sequence
s = pp.get_sequence()
self.assert_(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("RCGSQGGGSTCPGLRCCSIWGWCGDSEPYCGRTCENKCWSGER"
"SDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGGNCQYRC",
str(s))
def test_structure(self):
"""Verify the structure of the parsed example PDB file."""
# Structure contains 2 models
self.assertEquals(len(self.structure), 2)
# --- Checking model 0 ---
m0 = self.structure[0]
# Model 0 contains 1 chain
self.assertEquals(len(m0), 1)
# Chain 'A' contains 1 residue
self.assertEquals(len(m0['A']), 1)
# Residue ('H_PCA', 1, ' ') contains 8 atoms.
residue = m0['A'].get_list()[0]
self.assertEquals(residue.get_id(), ('H_PCA', 1, ' '))
self.assertEquals(len(residue), 8)
# --- Checking model 1 ---
m1 = self.structure[1]
# Model 1 contains 3 chains
self.assertEquals(len(m1), 3)
# Deconstruct this data structure to check each chain
chain_data = [ # chain_id, chain_len, [(residue_id, residue_len), ...]
('A', 86, [ ((' ', 0, ' '), 1 ),
((' ', 2, ' '), 11),
((' ', 3, ' '), 6, 1), # disordered
((' ', 4, ' '), 4 ),
((' ', 5, ' '), 6 ),
((' ', 6, ' '), 9 ),
((' ', 7, ' '), 4 ),
((' ', 8, ' '), 4 ),
((' ', 9, ' '), 4 ),
((' ', 10, ' '), 6, ['GLY', 'SER']), # point mut
((' ', 11, ' '), 7 ),
((' ', 12, ' '), 6 ),
((' ', 13, ' '), 7 ),
((' ', 14, ' '), 4, ['ALA', 'GLY']), # point mut
((' ', 15, ' '), 8, 3), # disordered
((' ', 16, ' '), 11, ['ARG', 'TRP']), # point mut
((' ', 17, ' '), 6 ),
((' ', 18, ' '), 6 ),
((' ', 19, ' '), 6 ),
((' ', 20, ' '), 8 ),
((' ', 21, ' '), 14),
((' ', 22, ' '), 4 ),
((' ', 23, ' '), 14),
((' ', 24, ' '), 6 ),
((' ', 25, ' '), 4 ),
((' ', 26, ' '), 8 ),
((' ', 27, ' '), 6 ),
((' ', 28, ' '), 9, 5), # disordered
((' ', 29, ' '), 7 ),
((' ', 30, ' '), 12),
((' ', 31, ' '), 6 ),
((' ', 32, ' '), 4 ),
((' ', 33, ' '), 11),
((' ', 34, ' '), 7 ),
((' ', 35, ' '), 6 ),
((' ', 36, ' '), 9 ),
((' ', 37, ' '), 8 ),
((' ', 38, ' '), 9 ),
((' ', 39, ' '), 6 ),
((' ', 40, ' '), 14),
((' ', 41, ' '), 6 ),
((' ', 42, ' '), 4 ),
((' ', 43, ' '), 9 ),
((' ', 44, ' '), 11),
((' ', 45, ' '), 6, 1), # disordered
((' ', 46, ' '), 8 ),
((' ', 47, ' '), 10),
((' ', 48, ' '), 11),
((' ', 49, ' '), 6 ),
((' ', 50, ' '), 4 ),
((' ', 51, ' '), 5 ),
((' ', 52, ' '), 5 ),
((' ', 53, ' '), 7 ),
((' ', 54, ' '), 4 ),
((' ', 55, ' '), 8 ),
((' ', 56, ' '), 7 ),
((' ', 57, ' '), 7 ),
((' ', 58, ' '), 6 ),
((' ', 59, ' '), 4 ),
((' ', 60, ' '), 9 ),
((' ', 61, ' '), 8 ),
((' ', 62, ' '), 11),
((' ', 63, ' '), 6 ),
((' ', 64, ' '), 6 ),
((' ', 65, ' '), 6 ),
((' ', 66, ' '), 7 ),
((' ', 67, ' '), 10),
((' ', 68, ' '), 4 ),
((' ', 69, ' '), 14),
((' ', 70, ' '), 6 ),
((' ', 71, ' '), 4 ),
((' ', 72, ' '), 4 ),
((' ', 73, ' '), 4 ),
((' ', 74, ' '), 8, 3), # disordered
((' ', 75, ' '), 8 ),
((' ', 76, ' '), 12),
((' ', 77, ' '), 6 ),
((' ', 78, ' '), 6 ),
((' ', 79, ' '), 4, 4), # disordered
((' ', 80, ' '), 4, ['GLY', 'SER']), # point mut
((' ', 81, ' '), 8, ['ASN', 'LYS']), # point mut
((' ', 82, ' '), 6 ),
((' ', 83, ' '), 9 ),
((' ', 84, ' '), 12),
((' ', 85, ' '), 11),
((' ', 86, ' '), 6 ),
]),
('B', 4, [ (('H_NAG', 1, ' '), 14),
(('H_NAG', 2, ' '), 14),
(('H_NAG', 3, ' '), 14),
(('H_NAG', 4, ' '), 14),
]),
(' ', 76, [ (('W', 1, ' '), 1),
(('W', 2, ' '), 1),
(('W', 3, ' '), 1),
(('W', 4, ' '), 1),
(('W', 5, ' '), 1),
(('W', 6, ' '), 1),
(('W', 7, ' '), 1),
(('W', 8, ' '), 1),
(('W', 9, ' '), 1),
(('W', 10, ' '), 1),
(('W', 11, ' '), 1),
(('W', 12, ' '), 1),
(('W', 13, ' '), 1),
(('W', 14, ' '), 1),
(('W', 15, ' '), 1),
(('W', 16, ' '), 1),
(('W', 17, ' '), 1),
(('W', 18, ' '), 1),
(('W', 19, ' '), 1),
(('W', 20, ' '), 1),
(('W', 21, ' '), 1),
(('W', 22, ' '), 1),
(('W', 23, ' '), 1),
(('W', 24, ' '), 1),
(('W', 25, ' '), 1),
(('W', 26, ' '), 1),
(('W', 27, ' '), 1),
(('W', 28, ' '), 1),
(('W', 29, ' '), 1),
(('W', 30, ' '), 1),
(('W', 31, ' '), 1),
(('W', 32, ' '), 1),
(('W', 33, ' '), 1),
(('W', 34, ' '), 1),
(('W', 35, ' '), 1),
(('W', 36, ' '), 1),
(('W', 37, ' '), 1),
(('W', 38, ' '), 1),
(('W', 39, ' '), 1),
(('W', 40, ' '), 1),
(('W', 41, ' '), 1),
(('W', 42, ' '), 1),
(('W', 43, ' '), 1),
(('W', 44, ' '), 1),
(('W', 45, ' '), 1),
(('W', 46, ' '), 1),
(('W', 47, ' '), 1),
(('W', 48, ' '), 1),
(('W', 49, ' '), 1),
(('W', 50, ' '), 1),
(('W', 51, ' '), 1),
(('W', 52, ' '), 1),
(('W', 53, ' '), 1),
(('W', 54, ' '), 1),
(('W', 55, ' '), 1),
(('W', 56, ' '), 1),
(('W', 57, ' '), 1),
(('W', 58, ' '), 1),
(('W', 59, ' '), 1),
(('W', 60, ' '), 1),
(('W', 61, ' '), 1),
(('W', 62, ' '), 1),
(('W', 63, ' '), 1),
(('W', 64, ' '), 1),
(('W', 65, ' '), 1),
(('W', 66, ' '), 1),
(('W', 67, ' '), 1),
(('W', 68, ' '), 1),
(('W', 69, ' '), 1),
(('W', 70, ' '), 1),
(('W', 71, ' '), 1),
(('W', 72, ' '), 1),
(('W', 73, ' '), 1),
(('W', 74, ' '), 1),
(('W', 75, ' '), 1),
(('W', 77, ' '), 1),
])
]
for c_idx, chn in enumerate(chain_data):
# Check chain ID and length
chain = m1.get_list()[c_idx]
self.assertEquals(chain.get_id(), chn[0])
self.assertEquals(len(chain), chn[1])
for r_idx, res in enumerate(chn[2]):
residue = chain.get_list()[r_idx]
# Check residue ID and atom count
self.assertEquals(residue.get_id(), res[0])
self.assertEquals(len(residue), res[1])
disorder_lvl = residue.is_disordered()
if disorder_lvl == 1:
# Check the number of disordered atoms
disordered_count = sum(1 for atom in residue
if atom.is_disordered())
if disordered_count:
self.assertEquals(disordered_count, res[2])
elif disorder_lvl == 2:
# Point mutation -- check residue names
self.assertEquals(residue.disordered_get_id_list(), res[2])
def test_details(self):
"""Verify details of the parsed example PDB file."""
structure = self.structure
self.assertEqual(len(structure), 2)
#First model
model = structure[0]
self.assertEqual(model.id, 0)
self.assertEqual(model.level, "M")
self.assertEqual(len(model), 1)
chain = model["A"]
self.assertEqual(chain.id, "A")
self.assertEqual(chain.level, "C")
self.assertEqual(len(chain), 1)
self.assertEqual(" ".join(residue.resname for residue in chain), "PCA")
self.assertEqual(" ".join(atom.name for atom in chain.get_atoms()),
"N CA CB CG CD OE C O")
self.assertEqual(" ".join(atom.element for atom in chain.get_atoms()),
"N C C C C O C O")
#Second model
model = structure[1]
self.assertEqual(model.id, 1)
self.assertEqual(model.level, "M")
self.assertEqual(len(model), 3)
chain = model["A"]
self.assertEqual(chain.id, "A")
self.assertEqual(chain.level, "C")
self.assertEqual(len(chain), 86)
self.assertEqual(" ".join(residue.resname for residue in chain),
"CYS ARG CYS GLY SER GLN GLY GLY GLY SER THR CYS "
"PRO GLY LEU ARG CYS CYS SER ILE TRP GLY TRP CYS "
"GLY ASP SER GLU PRO TYR CYS GLY ARG THR CYS GLU "
"ASN LYS CYS TRP SER GLY GLU ARG SER ASP HIS ARG "
"CYS GLY ALA ALA VAL GLY ASN PRO PRO CYS GLY GLN "
"ASP ARG CYS CYS SER VAL HIS GLY TRP CYS GLY GLY "
"GLY ASN ASP TYR CYS SER GLY GLY ASN CYS GLN TYR "
"ARG CYS")
self.assertEqual(" ".join(atom.name for atom in chain.get_atoms()),
"C N CA C O CB CG CD NE CZ NH1 NH2 N CA C O CB SG "
"N CA C O N CA C O CB OG N CA C O CB CG CD OE1 NE2 "
"N CA C O N CA C O N CA C O N CA C O CB OG N CA C "
"O CB OG1 CG2 N CA C O CB SG N CA C O CB CG CD N "
"CA C O N CA C O CB CG CD1 CD2 N CA C O CB CG CD NE "
"CZ NH1 NH2 N CA C O CB SG N CA C O CB SG N CA C O "
"CB OG N CA C O CB CG1 CG2 CD1 N CA C O CB CG CD1 "
"CD2 NE1 CE2 CE3 CZ2 CZ3 CH2 N CA C O N CA C O CB "
"CG CD1 CD2 NE1 CE2 CE3 CZ2 CZ3 CH2 N CA C O CB SG "
"N CA C O N CA C O CB CG OD1 OD2 N CA C O CB OG N "
"CA C O CB CG CD OE1 OE2 N CA C O CB CG CD N CA C O "
"CB CG CD1 CD2 CE1 CE2 CZ OH N CA C O CB SG N CA C "
"O N CA C O CB CG CD NE CZ NH1 NH2 N CA C O CB OG1 "
"CG2 N CA C O CB SG N CA C O CB CG CD OE1 OE2 N CA "
"C O CB CG OD1 ND2 N CA C O CB CG CD CE NZ N CA C O "
"CB SG N CA C O CB CG CD1 CD2 NE1 CE2 CE3 CZ2 CZ3 "
"CH2 N CA C O CB OG N CA C O N CA C O CB CG CD OE1 "
"OE2 N CA C O CB CG CD NE CZ NH1 NH2 N CA C O CB OG "
"N CA C O CB CG OD1 OD2 N CA C O CB CG ND1 CD2 CE1 "
"NE2 N CA C O CB CG CD NE CZ NH1 NH2 N CA C O CB SG "
"N CA C O N CA C O CB N CA C O CB N CA C O CB CG1 "
"CG2 N CA C O N CA C O CB CG OD1 ND2 N CA C O CB CG "
"CD N CA C O CB CG CD N CA C O CB SG N CA C O N CA "
"C O CB CG CD OE1 NE2 N CA C O CB CG OD1 OD2 N CA C "
"O CB CG CD NE CZ NH1 NH2 N CA C O CB SG N CA C O "
"CB SG N CA C O CB OG N CA C O CB CG1 CG2 N CA C O "
"CB CG ND1 CD2 CE1 NE2 N CA C O N CA C O CB CG CD1 "
"CD2 NE1 CE2 CE3 CZ2 CZ3 CH2 N CA C O CB SG N CA C "
"O N CA C O N CA C O N CA C O CB CG OD1 ND2 N CA C O "
"CB CG OD1 OD2 N CA C O CB CG CD1 CD2 CE1 CE2 CZ OH "
"N CA C O CB SG N CA C O CB OG N CA C O N CA C O N "
"CA C O CB CG OD1 ND2 N CA C O CB SG N CA C O CB CG "
"CD OE1 NE2 N CA C O CB CG CD1 CD2 CE1 CE2 CZ OH N "
"CA C O CB CG CD NE CZ NH1 NH2 N CA C O CB SG")
self.assertEqual(" ".join(atom.element for atom in chain.get_atoms()),
"C N C C O C C C N C N N N C C O C S N C C O N C C O "
"C O N C C O C C C O N N C C O N C C O N C C O N C C "
"O C O N C C O C O C N C C O C S N C C O C C C N C C "
"O N C C O C C C C N C C O C C C N C N N N C C O C S "
"N C C O C S N C C O C O N C C O C C C C N C C O C C "
"C C N C C C C C N C C O N C C O C C C C N C C C C C "
"N C C O C S N C C O N C C O C C O O N C C O C O N C "
"C O C C C O O N C C O C C C N C C O C C C C C C C O "
"N C C O C S N C C O N C C O C C C N C N N N C C O C "
"O C N C C O C S N C C O C C C O O N C C O C C O N N "
"C C O C C C C N N C C O C S N C C O C C C C N C C C "
"C C N C C O C O N C C O N C C O C C C O O N C C O C "
"C C N C N N N C C O C O N C C O C C O O N C C O C C "
"N C C N N C C O C C C N C N N N C C O C S N C C O N "
"C C O C N C C O C N C C O C C C N C C O N C C O C C "
"O N N C C O C C C N C C O C C C N C C O C S N C C O "
"N C C O C C C O N N C C O C C O O N C C O C C C N C "
"N N N C C O C S N C C O C S N C C O C O N C C O C C "
"C N C C O C C N C C N N C C O N C C O C C C C N C C "
"C C C N C C O C S N C C O N C C O N C C O N C C O C "
"C O N N C C O C C O O N C C O C C C C C C C O N C C "
"O C S N C C O C O N C C O N C C O N C C O C C O N N "
"C C O C S N C C O C C C O N N C C O C C C C C C C O "
"N C C O C C C N C N N N C C O C S")
class Exposure(unittest.TestCase):
"Testing Bio.PDB.HSExposure."
def setUp(self):
warnings.resetwarnings()
warnings.simplefilter('ignore', PDBConstructionWarning)
pdb_filename = "PDB/a_structure.pdb"
structure=PDBParser(PERMISSIVE=True).get_structure('X', pdb_filename)
self.model=structure[1]
#Look at first chain only
a_residues=list(self.model["A"].child_list)
self.assertEqual(86, len(a_residues))
self.assertEqual(a_residues[0].get_resname(), "CYS")
self.assertEqual(a_residues[1].get_resname(), "ARG")
self.assertEqual(a_residues[2].get_resname(), "CYS")
self.assertEqual(a_residues[3].get_resname(), "GLY")
#...
self.assertEqual(a_residues[-3].get_resname(), "TYR")
self.assertEqual(a_residues[-2].get_resname(), "ARG")
self.assertEqual(a_residues[-1].get_resname(), "CYS")
self.a_residues = a_residues
self.radius = 13.0
def test_HSExposureCA(self):
"""HSExposureCA."""
hse = HSExposureCA(self.model, self.radius)
residues = self.a_residues
self.assertEqual(0, len(residues[0].xtra))
self.assertEqual(0, len(residues[1].xtra))
self.assertEqual(3, len(residues[2].xtra))
self.assertAlmostEqual(0.81250973133184456, residues[2].xtra["EXP_CB_PCB_ANGLE"])
self.assertEqual(14, residues[2].xtra["EXP_HSE_A_D"])
self.assertEqual(14, residues[2].xtra["EXP_HSE_A_U"])
self.assertEqual(3, len(residues[3].xtra))
self.assertAlmostEqual(1.3383737, residues[3].xtra["EXP_CB_PCB_ANGLE"])
self.assertEqual(13, residues[3].xtra["EXP_HSE_A_D"])
self.assertEqual(16, residues[3].xtra["EXP_HSE_A_U"])
#...
self.assertEqual(3, len(residues[-2].xtra))
self.assertAlmostEqual(0.77124014456278489, residues[-2].xtra["EXP_CB_PCB_ANGLE"])
self.assertEqual(24, residues[-2].xtra["EXP_HSE_A_D"])
self.assertEqual(24, residues[-2].xtra["EXP_HSE_A_U"])
self.assertEqual(0, len(residues[-1].xtra))
def test_HSExposureCB(self):
"""HSExposureCB."""
hse = HSExposureCB(self.model, self.radius)
residues = self.a_residues
self.assertEqual(0, len(residues[0].xtra))
self.assertEqual(2, len(residues[1].xtra))
self.assertEqual(20, residues[1].xtra["EXP_HSE_B_D"])
self.assertEqual(5, residues[1].xtra["EXP_HSE_B_U"])
self.assertEqual(2, len(residues[2].xtra))
self.assertEqual(10, residues[2].xtra["EXP_HSE_B_D"])
self.assertEqual(18, residues[2].xtra["EXP_HSE_B_U"])
self.assertEqual(2, len(residues[3].xtra))
self.assertEqual(7, residues[3].xtra["EXP_HSE_B_D"])
self.assertEqual(22, residues[3].xtra["EXP_HSE_B_U"])
#...
self.assertEqual(2, len(residues[-2].xtra))
self.assertEqual(14, residues[-2].xtra["EXP_HSE_B_D"])
self.assertEqual(34, residues[-2].xtra["EXP_HSE_B_U"])
self.assertEqual(2, len(residues[-1].xtra))
self.assertEqual(23, residues[-1].xtra["EXP_HSE_B_D"])
self.assertEqual(15, residues[-1].xtra["EXP_HSE_B_U"])
def test_ExposureCN(self):
"""HSExposureCN."""
hse = ExposureCN(self.model, self.radius)
residues = self.a_residues
self.assertEqual(0, len(residues[0].xtra))
self.assertEqual(1, len(residues[1].xtra))
self.assertEqual(25, residues[1].xtra["EXP_CN"])
self.assertEqual(1, len(residues[2].xtra))
self.assertEqual(28, residues[2].xtra["EXP_CN"])
self.assertEqual(1, len(residues[3].xtra))
self.assertEqual(29, residues[3].xtra["EXP_CN"])
#...
self.assertEqual(1, len(residues[-2].xtra))
self.assertEqual(48, residues[-2].xtra["EXP_CN"])
self.assertEqual(1, len(residues[-1].xtra))
self.assertEqual(38, residues[-1].xtra["EXP_CN"])
class AssortedMisc(unittest.TestCase):
"Testing with real PDB files."
def test_strict(self):
"""Parse 1A8O.pdb file in strict mode."""
warnings.resetwarnings()
parser = PDBParser(PERMISSIVE=False)
structure = parser.get_structure("example", "PDB/1A8O.pdb")
self.assertEqual(len(structure), 1)
model = structure[0]
self.assertEqual(model.id, 0)
self.assertEqual(model.level, "M")
self.assertEqual(len(model), 1)
chain = model["A"]
self.assertEqual(chain.id, "A")
self.assertEqual(chain.level, "C")
self.assertEqual(len(chain), 158)
self.assertEqual(" ".join(residue.resname for residue in chain),
"MSE ASP ILE ARG GLN GLY PRO LYS GLU PRO PHE ARG "
"ASP TYR VAL ASP ARG PHE TYR LYS THR LEU ARG ALA "
"GLU GLN ALA SER GLN GLU VAL LYS ASN TRP MSE THR "
"GLU THR LEU LEU VAL GLN ASN ALA ASN PRO ASP CYS "
"LYS THR ILE LEU LYS ALA LEU GLY PRO GLY ALA THR "
"LEU GLU GLU MSE MSE THR ALA CYS GLN GLY HOH HOH "
"HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH "
"HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH "
"HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH "
"HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH "
"HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH "
"HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH "
"HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH HOH "
"HOH HOH")
self.assertEqual(" ".join(atom.name for atom in chain.get_atoms()),
"N CA C O CB CG SE CE N CA C O CB CG OD1 OD2 N CA "
"C O CB CG1 CG2 CD1 N CA C O CB CG CD NE CZ NH1 "
"NH2 N CA C O CB CG CD OE1 NE2 N CA C O N CA C O "
"CB CG CD N CA C O CB CG CD CE NZ N CA C O CB CG "
"CD OE1 OE2 N CA C O CB CG CD N CA C O CB CG CD1 "
"CD2 CE1 CE2 CZ N CA C O CB CG CD NE CZ NH1 NH2 N "
"CA C O CB CG OD1 OD2 N CA C O CB CG CD1 CD2 CE1 "
"CE2 CZ OH N CA C O CB CG1 CG2 N CA C O CB CG OD1 "
"OD2 N CA C O CB CG CD NE CZ NH1 NH2 N CA C O CB "
"CG CD1 CD2 CE1 CE2 CZ N CA C O CB CG CD1 CD2 CE1 "
"CE2 CZ OH N CA C O CB CG CD CE NZ N CA C O CB "
"OG1 CG2 N CA C O CB CG CD1 CD2 N CA C O CB CG CD "
"NE CZ NH1 NH2 N CA C O CB N CA C O CB CG CD OE1 "
"OE2 N CA C O CB CG CD OE1 NE2 N CA C O CB N CA C "
"O CB OG N CA C O CB CG CD OE1 NE2 N CA C O CB CG "
"CD OE1 OE2 N CA C O CB CG1 CG2 N CA C O CB CG CD "
"CE NZ N CA C O CB CG OD1 ND2 N CA C O CB CG CD1 "
"CD2 NE1 CE2 CE3 CZ2 CZ3 CH2 N CA C O CB CG SE CE "
"N CA C O CB OG1 CG2 N CA C O CB CG CD OE1 OE2 N "
"CA C O CB OG1 CG2 N CA C O CB CG CD1 CD2 N CA C "
"O CB CG CD1 CD2 N CA C O CB CG1 CG2 N CA C O CB "
"CG CD OE1 NE2 N CA C O CB CG OD1 ND2 N CA C O CB "
"N CA C O CB CG OD1 ND2 N CA C O CB CG CD N CA C "
"O CB CG OD1 OD2 N CA C O CB SG N CA C O CB CG CD "
"CE NZ N CA C O CB OG1 CG2 N CA C O CB CG1 CG2 "
"CD1 N CA C O CB CG CD1 CD2 N CA C O CB CG CD CE "
"NZ N CA C O CB N CA C O CB CG CD1 CD2 N CA C O N "
"CA C O CB CG CD N CA C O N CA C O CB N CA C O CB "
"OG1 CG2 N CA C O CB CG CD1 CD2 N CA C O CB CG CD "
"OE1 OE2 N CA C O CB CG CD OE1 OE2 N CA C O CB CG "
"SE CE N CA C O CB CG SE CE N CA C O CB OG1 CG2 N "
"CA C O CB N CA C O CB SG N CA C O CB CG CD OE1 "
"NE2 N CA C O OXT O O O O O O O O O O O O O O O O "
"O O O O O O O O O O O O O O O O O O O O O O O O "
"O O O O O O O O O O O O O O O O O O O O O O O O "
"O O O O O O O O O O O O O O O O O O O O O O O O")
self.assertEqual(" ".join(atom.element for atom in chain.get_atoms()),
"N C C O C C SE C N C C O C C O O N C C O C C C C "
"N C C O C C C N C N N N C C O C C C O N N C C O "
"N C C O C C C N C C O C C C C N N C C O C C C O "
"O N C C O C C C N C C O C C C C C C C N C C O C "
"C C N C N N N C C O C C O O N C C O C C C C C C "
"C O N C C O C C C N C C O C C O O N C C O C C C "
"N C N N N C C O C C C C C C C N C C O C C C C C "
"C C O N C C O C C C C N N C C O C O C N C C O C "
"C C C N C C O C C C N C N N N C C O C N C C O C "
"C C O O N C C O C C C O N N C C O C N C C O C O "
"N C C O C C C O N N C C O C C C O O N C C O C C "
"C N C C O C C C C N N C C O C C O N N C C O C C "
"C C N C C C C C N C C O C C SE C N C C O C O C N "
"C C O C C C O O N C C O C O C N C C O C C C C N "
"C C O C C C C N C C O C C C N C C O C C C O N N "
"C C O C C O N N C C O C N C C O C C O N N C C O "
"C C C N C C O C C O O N C C O C S N C C O C C C "
"C N N C C O C O C N C C O C C C C N C C O C C C "
"C N C C O C C C C N N C C O C N C C O C C C C N "
"C C O N C C O C C C N C C O N C C O C N C C O C "
"O C N C C O C C C C N C C O C C C O O N C C O C "
"C C O O N C C O C C SE C N C C O C C SE C N C C "
"O C O C N C C O C N C C O C S N C C O C C C O N "
"N C C O O O O O O O O O O O O O O O O O O O O O "
"O O O O O O O O O O O O O O O O O O O O O O O O "
"O O O O O O O O O O O O O O O O O O O O O O O O "
"O O O O O O O O O O O O O O O O O O O O O")
# -------------------------------------------------------------
if __name__ == '__main__':
runner = unittest.TextTestRunner(verbosity=2)
unittest.main(testRunner=runner)
Jump to Line
Something went wrong with that request. Please try again.