Skip to content

HTTPS clone URL

Subversion checkout URL

You can clone with HTTPS or Subversion.

Download ZIP
Fetching contributors…

Cannot retrieve contributors at this time

163 lines (116 sloc) 4.414 kb
# Copyright 1999 by Jeffrey Chang. All rights reserved.
# This code is part of the Biopython distribution and governed by its
# license. Please see the LICENSE file that should have been included
# as part of this package.
import string
import sys
from Bio import File
from Bio import ParserSupport
# pyUnit
def pb(b):
if b:
return 1
return 0
### TaggingConsumer
print "Running tests on TaggingConsumer"
class TestHandle:
def write(self, s):
print s
h = TestHandle()
tc = ParserSupport.TaggingConsumer(handle=h, colwidth=5)
tc.start_section() # '***** start_section\n'
tc.test1('myline') # 'test1: myline\n'
tc.end_section() # '***** end_section\n'
### is_blank_line
print "Running tests on is_blank_line"
is_blank_line = lambda *args, **keywds: \
pb(ParserSupport.is_blank_line(*args, **keywds))
print is_blank_line('\n') # 1
print is_blank_line('\r\n') # 1
print is_blank_line('\r') # 1
print is_blank_line('') # 1
print is_blank_line('', allow_spaces=1) # 1
print is_blank_line('', allow_spaces=0) # 1
print is_blank_line(string.whitespace, allow_spaces=1) # 1
print is_blank_line('hello') # 0
print is_blank_line('hello', allow_spaces=1) # 0
print is_blank_line('hello', allow_spaces=0) # 0
print is_blank_line(string.whitespace, allow_spaces=0) # 0
### safe_readline
print "Running tests on safe_readline"
data = """This
file"""
h = File.UndoHandle(File.StringHandle(data))
safe_readline = ParserSupport.safe_readline
print safe_readline(h) # "This"
print safe_readline(h) # "file"
try: safe_readline(h)
except ValueError: print "correctly failed"
else: print "ERROR, should have failed"
### safe_peekline
print "Running tests on safe_peekline"
safe_peekline = ParserSupport.safe_peekline
data = """This
file"""
h = File.UndoHandle(File.StringHandle(data))
print safe_peekline(h) # "This"
h.readline()
print safe_peekline(h) # "file"
h.readline()
try: safe_peekline(h)
except ValueError: print "correctly failed"
else: print "ERROR, should have failed"
h.saveline('hello')
print safe_peekline(h) # 'hello'
### read_and_call
print "Running tests on read_and_call"
data = """>gi|132871|sp|P19947|RL30_BACSU 50S RIBOSOMAL PROTEIN L30 (BL27)
MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVSHLVSVKEQ
>gi|132679|sp|P19946|RL15_BACSU 50S RIBOSOMAL PROTEIN L15
MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGFEGGQMPLFQRLPKRGFTNIN
RKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAG
GTAEVI
"""
h = File.UndoHandle(File.StringHandle(data))
rac = ParserSupport.read_and_call
lines = []
def m(line):
lines.append(line)
rac(h, m)
print lines[-1][:10] # '>gi|132871'
rac(h, m, start='MAKLE', end='KEQ', contains='SVIG')
rac(h, m, blank=0)
# These should be errors. If they're not, then complain.
try: rac(h, m, blank=1)
except ValueError: print "correctly failed"
else: print "ERROR, should have failed"
try: rac(h, m, start='foobar')
except ValueError: print "correctly failed"
else: print "ERROR, should have failed"
try: rac(h, m, end='foobar')
except ValueError: print "correctly failed"
else: print "ERROR, should have failed"
try: rac(h, m, contains='foobar')
except ValueError: print "correctly failed"
else: print "ERROR, should have failed"
try: rac(h, m, blank=0)
except ValueError: print "correctly failed"
else: print "ERROR, should have failed"
### attempt_read_and_call
print "Running tests on attempt_read_and_call"
data = """>gi|132871|sp|P19947|RL30_BACSU 50S RIBOSOMAL PROTEIN L30 (BL27)
MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVSHLVSVKEQ
>gi|132679|sp|P19946|RL15_BACSU 50S RIBOSOMAL PROTEIN L15
MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGFEGGQMPLFQRLPKRGFTNIN
RKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAG
GTAEVI"""
h = File.UndoHandle(File.StringHandle(data))
arac = lambda *args, **keywds: \
pb(ParserSupport.attempt_read_and_call(*args, **keywds))
lines = []
def m(line):
lines.append(line)
print arac(h, m, contains="RIBOSOMAL PROTEIN") # 1
print arac(h, m, start="foobar") # 0
print arac(h, m, blank=1) # 0
print arac(h, m, end="LVSVKEQ") # 1
Jump to Line
Something went wrong with that request. Please try again.