Skip to content
This repository
Fetching contributors…

Octocat-spinner-32-eaf2f5

Cannot retrieve contributors at this time

file 136 lines (121 sloc) 11.83 kb
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135
CLUSTAL format multiple sequence alignment by PROMALS3D


gi_13925890_gb_AAK49457.1 M------VTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSM
gi_13936399_dbj_BAB47196. M---SSSITVDQIRKAQRAEGPATILAIGTATPANFIIQADYPDYYFRVTKSEHMTNLKKRFQRICDRTM
gi_13936397_dbj_BAB47195. M----TSMTVDQIRRPLRAEGLATILAIGTANPANYITQADYPDYYFRVTKSEHMTDLKNKFQRMCDRSM
gi_13936395_dbj_BAB47194. M----TSMTVDQIRRPLRAEGLATILAIGTANPANYITQADYPDYYFRVTKSEHMTDLKNKFQRMCDRSM
gi_12644514_sp_Q9MB41_CHS M------VTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644512_sp_Q9MB39_CHS M------VTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKERFQRMCDKSM
gi_12644509_sp_Q9MB36_CHS M------VTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644511_sp_Q9MB38_CHS M------VTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644510_sp_Q9MB37_CHS M------VTVEEVRKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644513_sp_Q9MB40_CHS M------VTVGEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_13774969_gb_AAK39112.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSM
gi_13774971_gb_AAK39113.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774967_gb_AAK39111.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774975_gb_AAK39115.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774965_gb_AAK39110.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774973_gb_AAK39114.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_14150838_gb_AAK54648.1 ----------------------------------------------------------------------
gi_12644515_sp_Q9MBB1_CHS MTVLEESADASSRRLAQRANGPATVLAIGTANPANVFEQSSYPDFYFDITNSQHMTELKLKFSRMCQKSG
gi_13919613_gb_AAK33142.1 -----------------------------------------YPDYYFRITNREHKAELKEKFQRMCDKSM
gi_13919597_gb_AAK33134.1 -----------------------------------------YPDYYFRITNSEHKAELKEKFQRMCDKSM


gi_13925890_gb_AAK49457.1 IKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG
gi_13936399_dbj_BAB47196. IKKRHLVLSEDHLKENPNMCEFMAPSLDVRQDILVVEVPKLGKEACMKAIKEWDQPKSKITHFIFATTSG
gi_13936397_dbj_BAB47195. IKKRHMYFTEEHLKQNPNMCDYTAPSLDARQSILVVEVPKLGKEACIKAIKEWNQPKSKITHFIFTTISG
gi_13936395_dbj_BAB47194. IKKRHMYFTEEHLKQNPNMCDYTAPSLDARQSILVVEVPKLGKEACIKAIKEWNQPKSKITHFIFTTISG
gi_12644514_sp_Q9MB41_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644512_sp_Q9MB39_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644509_sp_Q9MB36_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644511_sp_Q9MB38_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644510_sp_Q9MB37_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVFFCTTSG
gi_12644513_sp_Q9MB40_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVVFCTTSG
gi_13774969_gb_AAK39112.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774971_gb_AAK39113.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774967_gb_AAK39111.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774975_gb_AAK39115.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774965_gb_AAK39110.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774973_gb_AAK39114.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_14150838_gb_AAK54648.1 ----------------------------------------------------------------------
gi_12644515_sp_Q9MBB1_CHS IKKRYMHLNSEILKANPSLCAYWEKSLDVRQDIAVVEVPKLGKEASLKAIKEWGQPKSKITHLVFCTTSG
gi_13919613_gb_AAK33142.1 IKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQ---------------
gi_13919597_gb_AAK33134.1 IKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQ---------------


gi_13925890_gb_AAK49457.1 VDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVCSEITAVTFRGPNDT
gi_13936399_dbj_BAB47196. VDMPGADYQCAKLLGLSSSVKRVMMYQQGCFAGGTVLRIAKDIAENNKGARVLALCSEITTCMFHGPTES
gi_13936397_dbj_BAB47195. IDMPGADYQCSKLLGLNPSVKRVMLYNLGCHASGTILRMAKDIAENNKGARVLAVCSDIMTGHFRGPAES
gi_13936395_dbj_BAB47194. IDMPGADYQCSKLLGLNPSVKRVMLYNLGCHASGTILRMAKDIAENNKGARVLAVCSDIMTGHFRGPAES
gi_12644514_sp_Q9MB41_CHS VDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644512_sp_Q9MB39_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644509_sp_Q9MB36_CHS IDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644511_sp_Q9MB38_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644510_sp_Q9MB37_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644513_sp_Q9MB40_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSEA
gi_13774969_gb_AAK39112.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774971_gb_AAK39113.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGLFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774967_gb_AAK39111.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774975_gb_AAK39115.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774965_gb_AAK39110.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLVENNKGARVLVVCSEITVVTFRGPNET
gi_13774973_gb_AAK39114.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_14150838_gb_AAK54648.1 -----------------------MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSET
gi_12644515_sp_Q9MBB1_CHS VDMPGADWALTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDVAENNKGARVLVVCSEITCVTFRGPSET
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------------


gi_13925890_gb_AAK49457.1 HLDSLVGQALFGDGAAAVIIGSDPIPEV-ERPLFELVSAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPG
gi_13936399_dbj_BAB47196. HLDSMVGQALFGDGASAVIVGAEPDESAGERPIYELVSAAQTILPNSEGAIDGHLMETRLTFHLLKDVPG
gi_13936397_dbj_BAB47195. HLDSMIGQALFGDGASAIIVGAEPDESAGEQPIFELVSTAQTTLPDSDGVARGHLKEAGVVIHLHQSLPG
gi_13936395_dbj_BAB47194. HLDSMIGQALFGDGASAIIVGAEPDESAGEQPIFELVSTAQTTLPDSDGVARGHLKEAGVVIHLHQSLPG
gi_12644514_sp_Q9MB41_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_12644512_sp_Q9MB39_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQNLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_12644509_sp_Q9MB36_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPNSCGAIDGHLREVGLTFHLLKDVPS
gi_12644511_sp_Q9MB38_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPNSCGAIDGHLREVGLTFHLLKDVPS
gi_12644510_sp_Q9MB37_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_12644513_sp_Q9MB40_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774969_gb_AAK39112.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774971_gb_AAK39113.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKALFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774967_gb_AAK39111.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774975_gb_AAK39115.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774965_gb_AAK39110.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EEPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774973_gb_AAK39114.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_14150838_gb_AAK54648.1 HLDSMVGQALFGDGAGAVIVGSDPDLSV-ERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPG
gi_12644515_sp_Q9MBB1_CHS HLDSLVGQALFGDGAAAVILGSDPLPE--ENPCFELHWSGSNILPDSDGAIDGHLREVGLTFHLMKDVPG
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------------


gi_13925890_gb_AAK49457.1 LISKNIEKSLVEAF------------QPLGISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLKATRKVL
gi_13936399_dbj_BAB47196. LISNNIEKSLIEAF------------TPIGINDWNSIFWVTHPGGPAILDEVEAKLELKKEKLAISRHVL
gi_13936397_dbj_BAB47195. LISTNIEKSLTEAF------------APIGISDWNSIFWITHPAGRAVLEEIEAKLQLKNEKLADSRHVL
gi_13936395_dbj_BAB47194. LISTNIEKSLTEAF------------APIGISDWNSIFWITHPAGRAVLEEIEAKLQLKNEKLADSRHVL
gi_12644514_sp_Q9MB41_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644512_sp_Q9MB39_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644509_sp_Q9MB36_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644511_sp_Q9MB38_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644510_sp_Q9MB37_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644513_sp_Q9MB40_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774969_gb_AAK39112.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774971_gb_AAK39113.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774967_gb_AAK39111.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774975_gb_AAK39115.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774965_gb_AAK39110.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774973_gb_AAK39114.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_14150838_gb_AAK54648.1 LISKNIEKSLKEAF------------TPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVL
gi_12644515_sp_Q9MBB1_CHS IISKNIGKVLNDAFRSAFDESGNAEDRPASVND---IFWIAHPGGPAILDQVEEKMKLAPEKMRATRDVL
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------------


gi_13925890_gb_AAK49457.1 SNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSVAT------
gi_13936399_dbj_BAB47196. SEYGNMSSASVFFVMDELRKRSLEEGKSTTGDGLDWGVLFGFGPGLTVEMVVLHSVENKVKSET
gi_13936397_dbj_BAB47195. SEYGNMSSACVFFIMDKLRKRSLEQRKSTTGDGLEWGVLFGFGPGLTVETVVLHSVANKF----
gi_13936395_dbj_BAB47194. SEYGNMSSACVFFIMDKLRKRSLEQRKSTTGDGLEWGVLFGFGPGLTVETVVLHSVANKF----
gi_12644514_sp_Q9MB41_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIKPGPH-
gi_12644512_sp_Q9MB39_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIKPGPH-
gi_12644509_sp_Q9MB36_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPT------
gi_12644511_sp_Q9MB38_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVLIKPGPH-
gi_12644510_sp_Q9MB37_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIKPGPH-
gi_12644513_sp_Q9MB40_CHS SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPT------
gi_13774969_gb_AAK39112.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGV--------------------------
gi_13774971_gb_AAK39113.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774967_gb_AAK39111.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774975_gb_AAK39115.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774965_gb_AAK39110.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774973_gb_AAK39114.1 SEYGNMSSACVLFILDEMRKAASNDGLGTTGEGLEWGVLFGLGPGLTIETVALHSVPA------
gi_14150838_gb_AAK54648.1 SEYGNMSSAC------------------------------------------------------
gi_12644515_sp_Q9MBB1_CHS SEYGNMSSACVLFIMDHMRRMSAQNKLQTTGEGLDWGVLLGFGPGLTVETVLLKSIRLAC----
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------


Something went wrong with that request. Please try again.