Skip to content

HTTPS clone URL

Subversion checkout URL

You can clone with HTTPS or Subversion.

Download ZIP
Fetching contributors…

Cannot retrieve contributors at this time

66 lines (55 sloc) 4.732 kb
CLUSTAL 2.0.9 multiple sequence alignment
gi|167877390|gb|EDS40773.1| MFNLVSGTGGSSCCHRRNCFANRKKFFTMLLIFLLYMVSQVQSCGPGRGI
gi|167234445|ref|NP_001107837. ---------------------MRSASAAALLLAALLVVQAVRACGPGRGV
gi|74100009|gb|AAZ99217.1| -------------MPQR----SLRHQLGMILVFFLLVTSHSLACGPGRGP
gi|13990994|dbj|BAA33523.2| ------------MSPAR----LRPRLHFCLVLLLLLVVPAAWGCGPGRVV
gi|56122354|gb|AAV74328.1| ----------------------LAADDQGRLLYSDFLTFLDRDDGAKKVF
:: :. *. :
gi|167877390|gb|EDS40773.1| GGPRRT-RKLLPLVFKQHVPNVSENSLGASGMQEGPISRNDSKFRSLETN
gi|167234445|ref|NP_001107837. GRRRGP-RKLTPLVFKQHVPNVPENTLTASGLTEGRIGRNDSRFKDLVPN
gi|74100009|gb|AAZ99217.1| GKRRGP-RKRTPLVFKQHIPNVSENTVGASGIHEGKITKPDPRFKEMVTN
gi|13990994|dbj|BAA33523.2| GSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPN
gi|56122354|gb|AAV74328.1| YVIETREPRERLLLTAAHLLFVAPHNDSATGGPEASSGSGPP--------
. : * . *. :. *:* *.
gi|167877390|gb|EDS40773.1| YNKDIIFKDEEGTGADRVMTQRCKEKLNILAVSVMNQWPGLRLMVTEGWD
gi|167234445|ref|NP_001107837. YNQDIVFKDEEGTGADRLMTQRCKEKLNTLAISVMNQWPGVRLLVTEGWD
gi|74100009|gb|AAZ99217.1| LNPNIVFRDEEENNEDRVMSKRCKDKLNTLAIAVMNEWPGVKLRVTEAWD
gi|13990994|dbj|BAA33523.2| YNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWD
gi|56122354|gb|AAV74328.1| ----------------------SGGALGPRALFASRVRPGQRVYVVAERD
. *. *: . . ** :: *. *
gi|167877390|gb|EDS40773.1| EDHMHARESLHYEGRAVDIMTSDKDRSKIGMLARLAVEAGFDWVFYESRN
gi|167234445|ref|NP_001107837. EEGYHTPESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESRA
gi|74100009|gb|AAZ99217.1| TQGHHAPTSLHYEGRAVDITTSDRVRSRYGMLARLAVEAGFDWVYYESRS
gi|13990994|dbj|BAA33523.2| EDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKA
gi|56122354|gb|AAV74328.1| GDRRLLP------------------------------------------A
:
gi|167877390|gb|EDS40773.1| HIHCSVKSDSSQSNHASGCFTGDSTVQTINGEHRKLSELQIGEKVLSVD-
gi|167234445|ref|NP_001107837. HIHCSVKSESSQAAKYGGCFSGESTVLTSTGLRRNLSSLQIGEKIQALDP
gi|74100009|gb|AAZ99217.1| HIHCSVRSDSLDTTHYGGCFPRTGKVVVRNKGTITLDQLKVGDSVLSVD-
gi|13990994|dbj|BAA33523.2| HVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMG-
gi|56122354|gb|AAV74328.1| AVHSVTLSEEAAGAYAP--LTAQGTILINR--------------------
:*. . *: :. . :
gi|167877390|gb|EDS40773.1| SSGRIVYSEVMMFMDRDTHQSREFVHIETDGG-AHLTVTPAHLVMVWQKE
gi|167234445|ref|NP_001107837. STNELVFSEVLLFLDYNPSQRRQFLHITLASG-RTLTVTPSHLLVLDDRT
gi|74100009|gb|AAZ99217.1| LQGELTYSEVIAFLDTNKDSSGYFHRIETENG-HTIRLTGKHLIYSSYTN
gi|13990994|dbj|BAA33523.2| EDGSPTFSDVLILLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNH
gi|56122354|gb|AAV74328.1| -----VLASCYAVIEEHSWAHRAFAPFRLAHA------------------
. :. .:: . * :
gi|167877390|gb|EDS40773.1| IGESRY---------LFADRIQEGDYVLV--NIDNNLEPRKVLRISAKLS
gi|167234445|ref|NP_001107837. MK--------------YAQKLQPGDFLLVSDNAKNALISEKIVRLEAVWR
gi|74100009|gb|AAZ99217.1| RTRFDLNDNDSEFEATYADQVQIGDYVMTT-DRTAGLFASRVKKIAAVSE
gi|13990994|dbj|BAA33523.2| TEPAAR------FRATFASHVQPGQYVLVA--GAPGLQPARVAAVSTHVA
gi|56122354|gb|AAV74328.1| -----------------------------------LLAALAPARTDRGGD
* .
gi|167877390|gb|EDS40773.1| QGVYAPLTSEGTVLVDSIAASCYALIDSQSVAHLSFLPYRVVQKVMDLFK
gi|167234445|ref|NP_001107837. SGVFAPLTGVGTLVVNDVVASCYATIDSQWLAHWAFAPIRWVAKLWD---
gi|74100009|gb|AAZ99217.1| KGVVAPLTKSGNIIVDGVVVSCYALINSDYIAHASFFFLRGLHQVTSHIP
gi|13990994|dbj|BAA33523.2| LGAYAPLTKHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLFHSLAWG--
gi|56122354|gb|AAV74328.1| SGGGDRGGGGGRVALPAPGAADAPGAG-----------------------
* * : : .: .
gi|167877390|gb|EDS40773.1| FS-SQSHSLGLPRHEGIHWYAKSLYSIKDYVLPTDWLYH--------
gi|167234445|ref|NP_001107837. ------SGLRKP-GVGVFWYARLLYATADFVLPSHLLHE--------
gi|74100009|gb|AAZ99217.1| FVSWAESPLASYAIDGIHWYAKLLYKIAPLFLDRTLLYMND------
gi|13990994|dbj|BAA33523.2| ---------SWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
gi|56122354|gb|AAV74328.1| ------------ATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
*:.**.: ** .* ::
Jump to Line
Something went wrong with that request. Please try again.