Skip to content

HTTPS clone URL

Subversion checkout URL

You can clone with
or
.
Download ZIP
Fetching contributors…

Cannot retrieve contributors at this time

136 lines (121 sloc) 11.83 kB
CLUSTAL format multiple sequence alignment by PROMALS3D
gi_13925890_gb_AAK49457.1 M------VTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSM
gi_13936399_dbj_BAB47196. M---SSSITVDQIRKAQRAEGPATILAIGTATPANFIIQADYPDYYFRVTKSEHMTNLKKRFQRICDRTM
gi_13936397_dbj_BAB47195. M----TSMTVDQIRRPLRAEGLATILAIGTANPANYITQADYPDYYFRVTKSEHMTDLKNKFQRMCDRSM
gi_13936395_dbj_BAB47194. M----TSMTVDQIRRPLRAEGLATILAIGTANPANYITQADYPDYYFRVTKSEHMTDLKNKFQRMCDRSM
gi_12644514_sp_Q9MB41_CHS M------VTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644512_sp_Q9MB39_CHS M------VTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKERFQRMCDKSM
gi_12644509_sp_Q9MB36_CHS M------VTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644511_sp_Q9MB38_CHS M------VTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644510_sp_Q9MB37_CHS M------VTVEEVRKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_12644513_sp_Q9MB40_CHS M------VTVGEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSM
gi_13774969_gb_AAK39112.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSM
gi_13774971_gb_AAK39113.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774967_gb_AAK39111.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774975_gb_AAK39115.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774965_gb_AAK39110.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_13774973_gb_AAK39114.1 M------VTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSM
gi_14150838_gb_AAK54648.1 ----------------------------------------------------------------------
gi_12644515_sp_Q9MBB1_CHS MTVLEESADASSRRLAQRANGPATVLAIGTANPANVFEQSSYPDFYFDITNSQHMTELKLKFSRMCQKSG
gi_13919613_gb_AAK33142.1 -----------------------------------------YPDYYFRITNREHKAELKEKFQRMCDKSM
gi_13919597_gb_AAK33134.1 -----------------------------------------YPDYYFRITNSEHKAELKEKFQRMCDKSM
gi_13925890_gb_AAK49457.1 IKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSG
gi_13936399_dbj_BAB47196. IKKRHLVLSEDHLKENPNMCEFMAPSLDVRQDILVVEVPKLGKEACMKAIKEWDQPKSKITHFIFATTSG
gi_13936397_dbj_BAB47195. IKKRHMYFTEEHLKQNPNMCDYTAPSLDARQSILVVEVPKLGKEACIKAIKEWNQPKSKITHFIFTTISG
gi_13936395_dbj_BAB47194. IKKRHMYFTEEHLKQNPNMCDYTAPSLDARQSILVVEVPKLGKEACIKAIKEWNQPKSKITHFIFTTISG
gi_12644514_sp_Q9MB41_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644512_sp_Q9MB39_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644509_sp_Q9MB36_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644511_sp_Q9MB38_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSG
gi_12644510_sp_Q9MB37_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVFFCTTSG
gi_12644513_sp_Q9MB40_CHS ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVVFCTTSG
gi_13774969_gb_AAK39112.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774971_gb_AAK39113.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774967_gb_AAK39111.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774975_gb_AAK39115.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774965_gb_AAK39110.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_13774973_gb_AAK39114.1 ITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSG
gi_14150838_gb_AAK54648.1 ----------------------------------------------------------------------
gi_12644515_sp_Q9MBB1_CHS IKKRYMHLNSEILKANPSLCAYWEKSLDVRQDIAVVEVPKLGKEASLKAIKEWGQPKSKITHLVFCTTSG
gi_13919613_gb_AAK33142.1 IKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQ---------------
gi_13919597_gb_AAK33134.1 IKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQ---------------
gi_13925890_gb_AAK49457.1 VDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVCSEITAVTFRGPNDT
gi_13936399_dbj_BAB47196. VDMPGADYQCAKLLGLSSSVKRVMMYQQGCFAGGTVLRIAKDIAENNKGARVLALCSEITTCMFHGPTES
gi_13936397_dbj_BAB47195. IDMPGADYQCSKLLGLNPSVKRVMLYNLGCHASGTILRMAKDIAENNKGARVLAVCSDIMTGHFRGPAES
gi_13936395_dbj_BAB47194. IDMPGADYQCSKLLGLNPSVKRVMLYNLGCHASGTILRMAKDIAENNKGARVLAVCSDIMTGHFRGPAES
gi_12644514_sp_Q9MB41_CHS VDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644512_sp_Q9MB39_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644509_sp_Q9MB36_CHS IDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644511_sp_Q9MB38_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644510_sp_Q9MB37_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSET
gi_12644513_sp_Q9MB40_CHS VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSEA
gi_13774969_gb_AAK39112.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774971_gb_AAK39113.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGLFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774967_gb_AAK39111.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774975_gb_AAK39115.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_13774965_gb_AAK39110.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLVENNKGARVLVVCSEITVVTFRGPNET
gi_13774973_gb_AAK39114.1 VDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEITVVTFRGPNET
gi_14150838_gb_AAK54648.1 -----------------------MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSET
gi_12644515_sp_Q9MBB1_CHS VDMPGADWALTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDVAENNKGARVLVVCSEITCVTFRGPSET
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------------
gi_13925890_gb_AAK49457.1 HLDSLVGQALFGDGAAAVIIGSDPIPEV-ERPLFELVSAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPG
gi_13936399_dbj_BAB47196. HLDSMVGQALFGDGASAVIVGAEPDESAGERPIYELVSAAQTILPNSEGAIDGHLMETRLTFHLLKDVPG
gi_13936397_dbj_BAB47195. HLDSMIGQALFGDGASAIIVGAEPDESAGEQPIFELVSTAQTTLPDSDGVARGHLKEAGVVIHLHQSLPG
gi_13936395_dbj_BAB47194. HLDSMIGQALFGDGASAIIVGAEPDESAGEQPIFELVSTAQTTLPDSDGVARGHLKEAGVVIHLHQSLPG
gi_12644514_sp_Q9MB41_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_12644512_sp_Q9MB39_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQNLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_12644509_sp_Q9MB36_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPNSCGAIDGHLREVGLTFHLLKDVPS
gi_12644511_sp_Q9MB38_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPNSCGAIDGHLREVGLTFHLLKDVPS
gi_12644510_sp_Q9MB37_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_12644513_sp_Q9MB40_CHS HLDSLVGQALFGDGAAAVIVGADPTPA--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774969_gb_AAK39112.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774971_gb_AAK39113.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKALFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774967_gb_AAK39111.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774975_gb_AAK39115.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774965_gb_AAK39110.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EEPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_13774973_gb_AAK39114.1 HLDSLVGQALFGDGAAAIIVGSDPTPV--EKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPS
gi_14150838_gb_AAK54648.1 HLDSMVGQALFGDGAGAVIVGSDPDLSV-ERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPG
gi_12644515_sp_Q9MBB1_CHS HLDSLVGQALFGDGAAAVILGSDPLPE--ENPCFELHWSGSNILPDSDGAIDGHLREVGLTFHLMKDVPG
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------------
gi_13925890_gb_AAK49457.1 LISKNIEKSLVEAF------------QPLGISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLKATRKVL
gi_13936399_dbj_BAB47196. LISNNIEKSLIEAF------------TPIGINDWNSIFWVTHPGGPAILDEVEAKLELKKEKLAISRHVL
gi_13936397_dbj_BAB47195. LISTNIEKSLTEAF------------APIGISDWNSIFWITHPAGRAVLEEIEAKLQLKNEKLADSRHVL
gi_13936395_dbj_BAB47194. LISTNIEKSLTEAF------------APIGISDWNSIFWITHPAGRAVLEEIEAKLQLKNEKLADSRHVL
gi_12644514_sp_Q9MB41_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644512_sp_Q9MB39_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644509_sp_Q9MB36_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644511_sp_Q9MB38_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644510_sp_Q9MB37_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_12644513_sp_Q9MB40_CHS VVSNNIEKCLFEAF------------NPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774969_gb_AAK39112.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774971_gb_AAK39113.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774967_gb_AAK39111.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774975_gb_AAK39115.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774965_gb_AAK39110.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_13774973_gb_AAK39114.1 IVSNNIEKCLSEAF------------NPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVL
gi_14150838_gb_AAK54648.1 LISKNIEKSLKEAF------------TPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVL
gi_12644515_sp_Q9MBB1_CHS IISKNIGKVLNDAFRSAFDESGNAEDRPASVND---IFWIAHPGGPAILDQVEEKMKLAPEKMRATRDVL
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------------
gi_13925890_gb_AAK49457.1 SNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSVAT------
gi_13936399_dbj_BAB47196. SEYGNMSSASVFFVMDELRKRSLEEGKSTTGDGLDWGVLFGFGPGLTVEMVVLHSVENKVKSET
gi_13936397_dbj_BAB47195. SEYGNMSSACVFFIMDKLRKRSLEQRKSTTGDGLEWGVLFGFGPGLTVETVVLHSVANKF----
gi_13936395_dbj_BAB47194. SEYGNMSSACVFFIMDKLRKRSLEQRKSTTGDGLEWGVLFGFGPGLTVETVVLHSVANKF----
gi_12644514_sp_Q9MB41_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIKPGPH-
gi_12644512_sp_Q9MB39_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIKPGPH-
gi_12644509_sp_Q9MB36_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPT------
gi_12644511_sp_Q9MB38_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVLIKPGPH-
gi_12644510_sp_Q9MB37_CHS SEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIKPGPH-
gi_12644513_sp_Q9MB40_CHS SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPT------
gi_13774969_gb_AAK39112.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGV--------------------------
gi_13774971_gb_AAK39113.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774967_gb_AAK39111.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774975_gb_AAK39115.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774965_gb_AAK39110.1 SEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPA------
gi_13774973_gb_AAK39114.1 SEYGNMSSACVLFILDEMRKAASNDGLGTTGEGLEWGVLFGLGPGLTIETVALHSVPA------
gi_14150838_gb_AAK54648.1 SEYGNMSSAC------------------------------------------------------
gi_12644515_sp_Q9MBB1_CHS SEYGNMSSACVLFIMDHMRRMSAQNKLQTTGEGLDWGVLLGFGPGLTVETVLLKSIRLAC----
gi_13919613_gb_AAK33142.1 ----------------------------------------------------------------
gi_13919597_gb_AAK33134.1 ----------------------------------------------------------------
Jump to Line
Something went wrong with that request. Please try again.