Permalink
Fetching contributors…
Cannot retrieve contributors at this time
201 lines (181 sloc) 15.3 KB
CLUSTAL W (1.81) multiple sequence alignment
gi|14150838|gb|AAK54648.1|AF37 --------------------------------------------------
gi|12644515|sp|Q9MBB1|CHSY_EQU MTVLEESADASSRRLAQRANGPATVLAIGTANPANVFEQSSYPDFYFDIT
gi|13774971|gb|AAK39113.1|AF35 ------MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRIT
gi|13774967|gb|AAK39111.1|AF35 ------MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRIT
gi|13774975|gb|AAK39115.1|AF35 ------MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRIT
gi|13774965|gb|AAK39110.1|AF35 ------MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRIT
gi|13774973|gb|AAK39114.1|AF35 ------MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRIT
gi|13774969|gb|AAK39112.1|AF35 ------MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRIT
gi|13919613|gb|AAK33142.1| -----------------------------------------YPDYYFRIT
gi|13919597|gb|AAK33134.1| -----------------------------------------YPDYYFRIT
gi|13925890|gb|AAK49457.1| ------MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRIT
gi|12644514|sp|Q9MB41|CHS2_IPO ------MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRIT
gi|12644512|sp|Q9MB39|CHS4_IPO ------MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRIT
gi|12644509|sp|Q9MB36|CHS8_IPO ------MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRIT
gi|12644511|sp|Q9MB38|CHS6_IPO ------MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRIT
gi|12644510|sp|Q9MB37|CHS7_IPO ------MVTVEEVRKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRIT
gi|12644513|sp|Q9MB40|CHS3_IPO ------MVTVGEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRIT
gi|13936397|dbj|BAB47195.1| ----MTSMTVDQIRRPLRAEGLATILAIGTANPANYITQADYPDYYFRVT
gi|13936395|dbj|BAB47194.1| ----MTSMTVDQIRRPLRAEGLATILAIGTANPANYITQADYPDYYFRVT
gi|13936399|dbj|BAB47196.1| ---MSSSITVDQIRKAQRAEGPATILAIGTATPANFIIQADYPDYYFRVT
gi|14150838|gb|AAK54648.1|AF37 --------------------------------------------------
gi|12644515|sp|Q9MBB1|CHSY_EQU NSQHMTELKLKFSRMCQKSGIKKRYMHLNSEILKANPSLCAYWEKSLDVR
gi|13774971|gb|AAK39113.1|AF35 KSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|13774967|gb|AAK39111.1|AF35 KSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|13774975|gb|AAK39115.1|AF35 KSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|13774965|gb|AAK39110.1|AF35 KSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|13774973|gb|AAK39114.1|AF35 KSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|13774969|gb|AAK39112.1|AF35 NSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|13919613|gb|AAK33142.1| NREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDAR
gi|13919597|gb|AAK33134.1| NSEHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDAR
gi|13925890|gb|AAK49457.1| NSEHKVELKEKFKRMCEKSMIKKRYMHLTEEILKENPNICAYMAPSLDAR
gi|12644514|sp|Q9MB41|CHS2_IPO NSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|12644512|sp|Q9MB39|CHS4_IPO NSEHKTELKERFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|12644509|sp|Q9MB36|CHS8_IPO NSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|12644511|sp|Q9MB38|CHS6_IPO NSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|12644510|sp|Q9MB37|CHS7_IPO NSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|12644513|sp|Q9MB40|CHS3_IPO NSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDAR
gi|13936397|dbj|BAB47195.1| KSEHMTDLKNKFQRMCDRSMIKKRHMYFTEEHLKQNPNMCDYTAPSLDAR
gi|13936395|dbj|BAB47194.1| KSEHMTDLKNKFQRMCDRSMIKKRHMYFTEEHLKQNPNMCDYTAPSLDAR
gi|13936399|dbj|BAB47196.1| KSEHMTNLKKRFQRICDRTMIKKRHLVLSEDHLKENPNMCEFMAPSLDVR
gi|14150838|gb|AAK54648.1|AF37 --------------------------------------------------
gi|12644515|sp|Q9MBB1|CHSY_EQU QDIAVVEVPKLGKEASLKAIKEWGQPKSKITHLVFCTTSGVDMPGADWAL
gi|13774971|gb|AAK39113.1|AF35 QDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQL
gi|13774967|gb|AAK39111.1|AF35 QDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQL
gi|13774975|gb|AAK39115.1|AF35 QDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQL
gi|13774965|gb|AAK39110.1|AF35 QDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQL
gi|13774973|gb|AAK39114.1|AF35 QDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQL
gi|13774969|gb|AAK39112.1|AF35 QDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQL
gi|13919613|gb|AAK33142.1| QDMVVVEIPKLGKEAAVKAIKEWGQ-------------------------
gi|13919597|gb|AAK33134.1| QDMVVVEIPKLGKEAAVKAIKEWGQ-------------------------
gi|13925890|gb|AAK49457.1| QDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQL
gi|12644514|sp|Q9MB41|CHS2_IPO QDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQL
gi|12644512|sp|Q9MB39|CHS4_IPO QDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQL
gi|12644509|sp|Q9MB36|CHS8_IPO QDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQL
gi|12644511|sp|Q9MB38|CHS6_IPO QDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQL
gi|12644510|sp|Q9MB37|CHS7_IPO QDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVFFCTTSGVDMPGADYQL
gi|12644513|sp|Q9MB40|CHS3_IPO QDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVVFCTTSGVDMPGADYQL
gi|13936397|dbj|BAB47195.1| QSILVVEVPKLGKEACIKAIKEWNQPKSKITHFIFTTISGIDMPGADYQC
gi|13936395|dbj|BAB47194.1| QSILVVEVPKLGKEACIKAIKEWNQPKSKITHFIFTTISGIDMPGADYQC
gi|13936399|dbj|BAB47196.1| QDILVVEVPKLGKEACMKAIKEWDQPKSKITHFIFATTSGVDMPGADYQC
gi|14150838|gb|AAK54648.1|AF37 -------------MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEIT
gi|12644515|sp|Q9MBB1|CHSY_EQU TKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDVAENNKGARVLVVCSEIT
gi|13774971|gb|AAK39113.1|AF35 TKLLGLRPSVKRLMMYQQGLFAGGTVLRVAKDLAENNKGARVLVVCSEIT
gi|13774967|gb|AAK39111.1|AF35 TKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEIT
gi|13774975|gb|AAK39115.1|AF35 TKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEIT
gi|13774965|gb|AAK39110.1|AF35 TKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLVENNKGARVLVVCSEIT
gi|13774973|gb|AAK39114.1|AF35 TKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEIT
gi|13774969|gb|AAK39112.1|AF35 TKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLVVCSEIT
gi|13919613|gb|AAK33142.1| --------------------------------------------------
gi|13919597|gb|AAK33134.1| --------------------------------------------------
gi|13925890|gb|AAK49457.1| TKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLVVCSEIT
gi|12644514|sp|Q9MB41|CHS2_IPO TKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEIT
gi|12644512|sp|Q9MB39|CHS4_IPO TKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEIT
gi|12644509|sp|Q9MB36|CHS8_IPO TKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEIT
gi|12644511|sp|Q9MB38|CHS6_IPO TKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEIT
gi|12644510|sp|Q9MB37|CHS7_IPO TKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEIT
gi|12644513|sp|Q9MB40|CHS3_IPO TKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEIT
gi|13936397|dbj|BAB47195.1| SKLLGLNPSVKRVMLYNLGCHASGTILRMAKDIAENNKGARVLAVCSDIM
gi|13936395|dbj|BAB47194.1| SKLLGLNPSVKRVMLYNLGCHASGTILRMAKDIAENNKGARVLAVCSDIM
gi|13936399|dbj|BAB47196.1| AKLLGLSSSVKRVMMYQQGCFAGGTVLRIAKDIAENNKGARVLALCSEIT
gi|14150838|gb|AAK54648.1|AF37 AVTFRGPSETHLDSMVGQALFGDGAGAVIVGSDPDLS-VERPLYELVWTG
gi|12644515|sp|Q9MBB1|CHSY_EQU CVTFRGPSETHLDSLVGQALFGDGAAAVILGSDP-LP-EENPCFELHWSG
gi|13774971|gb|AAK39113.1|AF35 VVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP--VEKALFQLVSAA
gi|13774967|gb|AAK39111.1|AF35 VVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP--VEKPLFQLVSAA
gi|13774975|gb|AAK39115.1|AF35 VVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP--VEKPLFQLVSAA
gi|13774965|gb|AAK39110.1|AF35 VVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP--VEEPLFQLVSAA
gi|13774973|gb|AAK39114.1|AF35 VVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP--VEKPLFQLVSAA
gi|13774969|gb|AAK39112.1|AF35 VVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP--VEKPLFQLVSAA
gi|13919613|gb|AAK33142.1| --------------------------------------------------
gi|13919597|gb|AAK33134.1| --------------------------------------------------
gi|13925890|gb|AAK49457.1| AVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPE-VERPLFELVSAA
gi|12644514|sp|Q9MB41|CHS2_IPO VVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTP--AEKPLFQLVSAA
gi|12644512|sp|Q9MB39|CHS4_IPO VVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTP--AEKPLFQLVSAA
gi|12644509|sp|Q9MB36|CHS8_IPO VVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTP--AEKPLFQLVSAA
gi|12644511|sp|Q9MB38|CHS6_IPO VVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTP--AEKPLFQLVSAA
gi|12644510|sp|Q9MB37|CHS7_IPO VVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTP--AEKPLFQLVSAA
gi|12644513|sp|Q9MB40|CHS3_IPO VVTFRGPSEAHLDSLVGQALFGDGAAAVIVGADPTP--AEKPLFQLVSAA
gi|13936397|dbj|BAB47195.1| TGHFRGPAESHLDSMIGQALFGDGASAIIVGAEPDESAGEQPIFELVSTA
gi|13936395|dbj|BAB47194.1| TGHFRGPAESHLDSMIGQALFGDGASAIIVGAEPDESAGEQPIFELVSTA
gi|13936399|dbj|BAB47196.1| TCMFHGPTESHLDSMVGQALFGDGASAVIVGAEPDESAGERPIYELVSAA
gi|14150838|gb|AAK54648.1|AF37 ATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFTPLG--
gi|12644515|sp|Q9MBB1|CHSY_EQU SNILPDSDGAIDGHLREVGLTFHLMKDVPGIISKNIGKVLNDAFRSAFDE
gi|13774971|gb|AAK39113.1|AF35 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLG--
gi|13774967|gb|AAK39111.1|AF35 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLG--
gi|13774975|gb|AAK39115.1|AF35 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLG--
gi|13774965|gb|AAK39110.1|AF35 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLG--
gi|13774973|gb|AAK39114.1|AF35 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLG--
gi|13774969|gb|AAK39112.1|AF35 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLG--
gi|13919613|gb|AAK33142.1| --------------------------------------------------
gi|13919597|gb|AAK33134.1| --------------------------------------------------
gi|13925890|gb|AAK49457.1| QTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLG--
gi|12644514|sp|Q9MB41|CHS2_IPO QTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLG--
gi|12644512|sp|Q9MB39|CHS4_IPO QNLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLG--
gi|12644509|sp|Q9MB36|CHS8_IPO QTLAPNSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLG--
gi|12644511|sp|Q9MB38|CHS6_IPO QTLAPNSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLG--
gi|12644510|sp|Q9MB37|CHS7_IPO QTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLG--
gi|12644513|sp|Q9MB40|CHS3_IPO QTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLG--
gi|13936397|dbj|BAB47195.1| QTTLPDSDGVARGHLKEAGVVIHLHQSLPGLISTNIEKSLTEAFAPIG--
gi|13936395|dbj|BAB47194.1| QTTLPDSDGVARGHLKEAGVVIHLHQSLPGLISTNIEKSLTEAFAPIG--
gi|13936399|dbj|BAB47196.1| QTILPNSEGAIDGHLMETRLTFHLLKDVPGLISNNIEKSLIEAFTPIG--
gi|14150838|gb|AAK54648.1|AF37 -------ISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEY
gi|12644515|sp|Q9MBB1|CHSY_EQU SGNAEDRPASVNDIFWIAHPGGPAILDQVEEKMKLAPEKMRATRDVLSEY
gi|13774971|gb|AAK39113.1|AF35 -------ISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|13774967|gb|AAK39111.1|AF35 -------ISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|13774975|gb|AAK39115.1|AF35 -------ISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|13774965|gb|AAK39110.1|AF35 -------ISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|13774973|gb|AAK39114.1|AF35 -------ISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|13774969|gb|AAK39112.1|AF35 -------ISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|13919613|gb|AAK33142.1| --------------------------------------------------
gi|13919597|gb|AAK33134.1| --------------------------------------------------
gi|13925890|gb|AAK49457.1| -------ISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLKATRKVLSNY
gi|12644514|sp|Q9MB41|CHS2_IPO -------ISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|12644512|sp|Q9MB39|CHS4_IPO -------ISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|12644509|sp|Q9MB36|CHS8_IPO -------ISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|12644511|sp|Q9MB38|CHS6_IPO -------ISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|12644510|sp|Q9MB37|CHS7_IPO -------ISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|12644513|sp|Q9MB40|CHS3_IPO -------ISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEY
gi|13936397|dbj|BAB47195.1| -------ISDWNSIFWITHPAGRAVLEEIEAKLQLKNEKLADSRHVLSEY
gi|13936395|dbj|BAB47194.1| -------ISDWNSIFWITHPAGRAVLEEIEAKLQLKNEKLADSRHVLSEY
gi|13936399|dbj|BAB47196.1| -------INDWNSIFWVTHPGGPAILDEVEAKLELKKEKLAISRHVLSEY
gi|14150838|gb|AAK54648.1|AF37 GNMSSAC-------------------------------------------
gi|12644515|sp|Q9MBB1|CHSY_EQU GNMSSACVLFIMDHMRRMSAQNKLQTTGEGLDWGVLLGFGPGLTVETVLL
gi|13774971|gb|AAK39113.1|AF35 GNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|13774967|gb|AAK39111.1|AF35 GNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|13774975|gb|AAK39115.1|AF35 GNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|13774965|gb|AAK39110.1|AF35 GNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|13774973|gb|AAK39114.1|AF35 GNMSSACVLFILDEMRKAASNDGLGTTGEGLEWGVLFGLGPGLTIETVAL
gi|13774969|gb|AAK39112.1|AF35 GNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGV---------------
gi|13919613|gb|AAK33142.1| --------------------------------------------------
gi|13919597|gb|AAK33134.1| --------------------------------------------------
gi|13925890|gb|AAK49457.1| GNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLFGFGPGLTVETVVL
gi|12644514|sp|Q9MB41|CHS2_IPO GNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|12644512|sp|Q9MB39|CHS4_IPO GNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|12644509|sp|Q9MB36|CHS8_IPO GNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|12644511|sp|Q9MB38|CHS6_IPO GNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|12644510|sp|Q9MB37|CHS7_IPO GNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|12644513|sp|Q9MB40|CHS3_IPO GNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVL
gi|13936397|dbj|BAB47195.1| GNMSSACVFFIMDKLRKRSLEQRKSTTGDGLEWGVLFGFGPGLTVETVVL
gi|13936395|dbj|BAB47194.1| GNMSSACVFFIMDKLRKRSLEQRKSTTGDGLEWGVLFGFGPGLTVETVVL
gi|13936399|dbj|BAB47196.1| GNMSSASVFFVMDELRKRSLEEGKSTTGDGLDWGVLFGFGPGLTVEMVVL
gi|14150838|gb|AAK54648.1|AF37 -----------
gi|12644515|sp|Q9MBB1|CHSY_EQU KSIRLAC----
gi|13774971|gb|AAK39113.1|AF35 HSVPA------
gi|13774967|gb|AAK39111.1|AF35 HSVPA------
gi|13774975|gb|AAK39115.1|AF35 HSVPA------
gi|13774965|gb|AAK39110.1|AF35 HSVPA------
gi|13774973|gb|AAK39114.1|AF35 HSVPA------
gi|13774969|gb|AAK39112.1|AF35 -----------
gi|13919613|gb|AAK33142.1| -----------
gi|13919597|gb|AAK33134.1| -----------
gi|13925890|gb|AAK49457.1| HSVAT------
gi|12644514|sp|Q9MB41|CHS2_IPO HSVPIKPGPH-
gi|12644512|sp|Q9MB39|CHS4_IPO HSVPIKPGPH-
gi|12644509|sp|Q9MB36|CHS8_IPO HSVPT------
gi|12644511|sp|Q9MB38|CHS6_IPO HSVLIKPGPH-
gi|12644510|sp|Q9MB37|CHS7_IPO HSVPIKPGPH-
gi|12644513|sp|Q9MB40|CHS3_IPO HSVPT------
gi|13936397|dbj|BAB47195.1| HSVANKF----
gi|13936395|dbj|BAB47194.1| HSVANKF----
gi|13936399|dbj|BAB47196.1| HSVENKVKSET