Skip to content

HTTPS clone URL

Subversion checkout URL

You can clone with
or
.
Download ZIP
Fetching contributors…

Cannot retrieve contributors at this time

140 lines (121 sloc) 3.222 kB
########################################
# Program: matcher
# Rundate: Tue 8 Dec 2009 12:01:34
# Commandline: matcher
# [-asequence] hba_human.fasta
# [-bsequence] hbb_human.fasta
# [-outfile] matcher_pair.txt
# -alternatives 5
# -aformat pair
# -sprotein
# Align_format: pair
# Report_file: matcher_pair.txt
########################################
#=======================================
#
# Aligned_sequences: 2
# 1: HBA_HUMAN
# 2: HBB_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 14
# Extend_penalty: 4
#
# Length: 145
# Identity: 63/145 (43.4%)
# Similarity: 88/145 (60.7%)
# Gaps: 8/145 ( 5.5%)
# Score: 264
#
#
#=======================================
HBA_HUMAN 3 LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLSH 51
|:|.:|:.|.|.|||| :..|.|.|||.|:.:.:|.|:.:|..| |||.
HBB_HUMAN 4 LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLST 51
HBA_HUMAN 52 -----GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDP 96
|:.:||.|||||..|.::.:||:|::....:.||:||..||.|||
HBB_HUMAN 52 PDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDP 101
HBA_HUMAN 97 VNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 141
.||:||.:.|:..||.|...||||.|.|:..|.:|.|:..|..||
HBB_HUMAN 102 ENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
#=======================================
#
# Aligned_sequences: 2
# 1: HBA_HUMAN
# 2: HBB_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 14
# Extend_penalty: 4
#
# Length: 13
# Identity: 6/13 (46.2%)
# Similarity: 9/13 (69.2%)
# Gaps: 0/13 ( 0.0%)
# Score: 32
#
#
#=======================================
HBA_HUMAN 61 KKVADALTNAVAH 73
:||...:.||:||
HBB_HUMAN 132 QKVVAGVANALAH 144
#=======================================
#
# Aligned_sequences: 2
# 1: HBA_HUMAN
# 2: HBB_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 14
# Extend_penalty: 4
#
# Length: 18
# Identity: 7/18 (38.9%)
# Similarity: 10/18 (55.6%)
# Gaps: 0/18 ( 0.0%)
# Score: 28
#
#
#=======================================
HBA_HUMAN 91 KLRVDPVNFKLLSHCLLV 108
|:.||.|..:.|...|:|
HBB_HUMAN 18 KVNVDEVGGEALGRLLVV 35
#=======================================
#
# Aligned_sequences: 2
# 1: HBA_HUMAN
# 2: HBB_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 14
# Extend_penalty: 4
#
# Length: 10
# Identity: 6/10 (60.0%)
# Similarity: 6/10 (60.0%)
# Gaps: 0/10 ( 0.0%)
# Score: 23
#
#
#=======================================
HBA_HUMAN 81 LSALSDLHAH 90
|.|.||..||
HBB_HUMAN 69 LGAFSDGLAH 78
#=======================================
#
# Aligned_sequences: 2
# 1: HBA_HUMAN
# 2: HBB_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 14
# Extend_penalty: 4
#
# Length: 10
# Identity: 6/10 (60.0%)
# Similarity: 8/10 (80.0%)
# Gaps: 0/10 ( 0.0%)
# Score: 23
#
#
#=======================================
HBA_HUMAN 11 VKAAWGKVGA 20
|:||:.||.|
HBB_HUMAN 127 VQAAYQKVVA 136
#---------------------------------------
#---------------------------------------
Jump to Line
Something went wrong with that request. Please try again.