Permalink
Fetching contributors…
Cannot retrieve contributors at this time
1656 lines (1655 sloc) 96.6 KB
data_1A8O
#
_entry.id 1A8O
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 4.007
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
_database_2.database_id PDB
_database_2.database_code 1A8O
#
loop_
_database_PDB_rev.num
_database_PDB_rev.date
_database_PDB_rev.date_original
_database_PDB_rev.status
_database_PDB_rev.replaces
_database_PDB_rev.mod_type
1 1998-10-14 1998-03-27 ? 1A8O 0
2 1998-10-28 ? ? 1A8O 1
3 2003-04-01 ? ? 1A8O 1
4 2009-02-24 ? ? 1A8O 1
5 2009-11-03 ? ? 1A8O 1
#
loop_
_database_PDB_rev_record.rev_num
_database_PDB_rev_record.type
_database_PDB_rev_record.details
2 REMARK ?
3 JRNL ?
4 VERSN ?
5 SEQADV ?
#
_pdbx_database_PDB_obs_spr.id SPRSDE
_pdbx_database_PDB_obs_spr.date 1998-10-14
_pdbx_database_PDB_obs_spr.pdb_id 1A8O
_pdbx_database_PDB_obs_spr.replace_pdb_id 1AM3
#
_pdbx_database_status.status_code REL
_pdbx_database_status.entry_id 1A8O
_pdbx_database_status.deposit_site ?
_pdbx_database_status.process_site ?
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.SG_entry ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Gamble, T.R.' 1
'Yoo, S.' 2
'Vajdos, F.F.' 3
'Von Schwedler, U.K.' 4
'Worthylake, D.K.' 5
'Wang, H.' 6
'Mccutcheon, J.P.' 7
'Sundquist, W.I.' 8
'Hill, C.P.' 9
#
_citation.id primary
_citation.title 'Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.'
_citation.journal_abbrev Science
_citation.journal_volume 278
_citation.page_first 849
_citation.page_last 853
_citation.year 1997
_citation.journal_id_ASTM SCIEAS
_citation.country US
_citation.journal_id_ISSN 0036-8075
_citation.journal_id_CSD 0038
_citation.book_publisher ?
_citation.pdbx_database_id_PubMed 9346481
_citation.pdbx_database_id_DOI 10.1126/science.278.5339.849
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Gamble, T.R.' 1
primary 'Yoo, S.' 2
primary 'Vajdos, F.F.' 3
primary 'von Schwedler, U.K.' 4
primary 'Worthylake, D.K.' 5
primary 'Wang, H.' 6
primary 'McCutcheon, J.P.' 7
primary 'Sundquist, W.I.' 8
primary 'Hill, C.P.' 9
#
_cell.entry_id 1A8O
_cell.length_a 41.980
_cell.length_b 41.980
_cell.length_c 88.920
_cell.angle_alpha 90.00
_cell.angle_beta 90.00
_cell.angle_gamma 90.00
_cell.Z_PDB 8
_cell.pdbx_unique_axis ?
_cell.length_a_esd ?
_cell.length_b_esd ?
_cell.length_c_esd ?
_cell.angle_alpha_esd ?
_cell.angle_beta_esd ?
_cell.angle_gamma_esd ?
#
_symmetry.entry_id 1A8O
_symmetry.space_group_name_H-M 'P 43 21 2'
_symmetry.pdbx_full_space_group_name_H-M ?
_symmetry.cell_setting ?
_symmetry.Int_Tables_number ?
_symmetry.space_group_name_Hall ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.pdbx_ec
1 polymer man 'HIV CAPSID' 8175.795 1 ? 'SELENOMETHIONINE SUBSTITUTIONS, L151MSE, M185MSE, M214MSE, M215MSE'
'C-TERMINAL DOMAIN, RESIDUES 151 - 231' ?
2 water nat water 18.015 88 ? ? ? ?
#
loop_
_entity_keywords.entity_id
_entity_keywords.text
1 ?
2 ?
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer yes
_entity_poly.pdbx_seq_one_letter_code
;(MSE)DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW(MSE)TETLLVQNANPDCKTILKALGPGATLEE(MSE)
(MSE)TACQG
;
_entity_poly.pdbx_seq_one_letter_code_can MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
_entity_poly.pdbx_strand_id A
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MSE n
1 2 ASP n
1 3 ILE n
1 4 ARG n
1 5 GLN n
1 6 GLY n
1 7 PRO n
1 8 LYS n
1 9 GLU n
1 10 PRO n
1 11 PHE n
1 12 ARG n
1 13 ASP n
1 14 TYR n
1 15 VAL n
1 16 ASP n
1 17 ARG n
1 18 PHE n
1 19 TYR n
1 20 LYS n
1 21 THR n
1 22 LEU n
1 23 ARG n
1 24 ALA n
1 25 GLU n
1 26 GLN n
1 27 ALA n
1 28 SER n
1 29 GLN n
1 30 GLU n
1 31 VAL n
1 32 LYS n
1 33 ASN n
1 34 TRP n
1 35 MSE n
1 36 THR n
1 37 GLU n
1 38 THR n
1 39 LEU n
1 40 LEU n
1 41 VAL n
1 42 GLN n
1 43 ASN n
1 44 ALA n
1 45 ASN n
1 46 PRO n
1 47 ASP n
1 48 CYS n
1 49 LYS n
1 50 THR n
1 51 ILE n
1 52 LEU n
1 53 LYS n
1 54 ALA n
1 55 LEU n
1 56 GLY n
1 57 PRO n
1 58 GLY n
1 59 ALA n
1 60 THR n
1 61 LEU n
1 62 GLU n
1 63 GLU n
1 64 MSE n
1 65 MSE n
1 66 THR n
1 67 ALA n
1 68 CYS n
1 69 GLN n
1 70 GLY n
#
_entity_src_gen.entity_id 1
_entity_src_gen.gene_src_common_name ?
_entity_src_gen.gene_src_genus Lentivirus
_entity_src_gen.pdbx_gene_src_gene ?
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line BL21
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008
_entity_src_gen.host_org_genus Escherichia
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species 'Escherichia coli'
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)'
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector PET11A
_entity_src_gen.plasmid_name WISP97-7
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code POL_HV1N5
_struct_ref.entity_id 1
_struct_ref.pdbx_db_accession P12497
_struct_ref.pdbx_align_begin 1
_struct_ref.pdbx_seq_one_letter_code
;GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT
IAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEE
KAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTS
TLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETL
LVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEGHI
AKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQKQEPIDK
ELYPLASLRSLFGSDPSSQ
;
_struct_ref.biol_id .
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 1A8O
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 2
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 70
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession P12497
_struct_ref_seq.db_align_beg 283
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 351
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 152
_struct_ref_seq.pdbx_auth_seq_align_end 220
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 SE' 196.107
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.104
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.174
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.210
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.146
GLY 'PEPTIDE LINKING' y GLYCINE ? 'C2 H5 N O2' 75.067
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.132
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.197
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.130
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.191
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.191
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.147
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.120
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.174
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.094
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.228
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.154
HOH NON-POLYMER . WATER ? 'H2 O' 18.015
#
_exptl.entry_id 1A8O
_exptl.method 'X-RAY DIFFRACTION'
_exptl.crystals_number 1
#
_exptl_crystal.id 1
_exptl_crystal.density_meas ?
_exptl_crystal.density_Matthews 2.21
_exptl_crystal.density_percent_sol 43.8
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.preparation ?
#
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.method 'vapor diffusion - sitting drop'
_exptl_crystal_grow.temp 277
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.pH 8.0
_exptl_crystal_grow.pdbx_pH_range ?
_exptl_crystal_grow.pdbx_details
;CRYSTALS OF CA(151-231) WERE GROWN AT 4C IN 4 MICROLITER SITTING DROPS CONTAINING A 1:1 MIXTURE OF PROTEIN SOLUTION (2.1 MM CA(151-231) IN 10MM TRIS (PH 8.0) AND 2 MM 2-MERCAPTOETHANOL) AND RESERVOIR SOLUTION (2.0 M AMMONIUM SULFATE), vapor diffusion - sitting drop, temperature 277K
;
#
_diffrn.id 1
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.crystal_id 1
#
_diffrn_detector.diffrn_id 1
_diffrn_detector.detector 'IMAGE PLATE'
_diffrn_detector.type MARRESEARCH
_diffrn_detector.pdbx_collection_date 1996-12
_diffrn_detector.details COLLIMATOR
#
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.monochromator 'SI(111)'
_diffrn_radiation.pdbx_diffrn_protocol ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 1.24
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.diffrn_id 1
_diffrn_source.source SYNCHROTRON
_diffrn_source.type 'SSRL BEAMLINE BL1-5'
_diffrn_source.pdbx_synchrotron_site SSRL
_diffrn_source.pdbx_synchrotron_beamline BL1-5
_diffrn_source.pdbx_wavelength 1.24
_diffrn_source.pdbx_wavelength_list ?
#
_reflns.entry_id 1A8O
_reflns.observed_criterion_sigma_I -2.0
_reflns.observed_criterion_sigma_F ?
_reflns.d_resolution_low 25.0
_reflns.d_resolution_high 1.7
_reflns.number_obs 9307
_reflns.number_all ?
_reflns.percent_possible_obs 99.6
_reflns.pdbx_Rmerge_I_obs ?
_reflns.pdbx_Rsym_value 0.036
_reflns.pdbx_netI_over_sigmaI 15.0
_reflns.B_iso_Wilson_estimate 21.1
_reflns.pdbx_redundancy ?
_reflns.R_free_details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_ordinal 1
_reflns.pdbx_diffrn_id 1
#
_reflns_shell.d_res_high 1.7
_reflns_shell.d_res_low 1.73
_reflns_shell.percent_possible_all 98.6
_reflns_shell.Rmerge_I_obs ?
_reflns_shell.pdbx_Rsym_value 0.232
_reflns_shell.meanI_over_sigI_obs 5.0
_reflns_shell.pdbx_redundancy ?
_reflns_shell.percent_possible_obs ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_unique_obs ?
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
#
_computing.entry_id 1A8O
_computing.pdbx_data_reduction_ii DENZO
_computing.pdbx_data_reduction_ds SCALEPACK
_computing.data_collection ?
_computing.structure_solution 'X-PLOR 3.843'
_computing.structure_refinement 'X-PLOR 3.843'
_computing.pdbx_structure_refinement_method ?
#
_refine.entry_id 1A8O
_refine.ls_number_reflns_obs 9254
_refine.ls_number_reflns_all ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F -2.0
_refine.pdbx_data_cutoff_high_absF 10000000.00
_refine.pdbx_data_cutoff_low_absF 0.00100
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.ls_d_res_low 25.00
_refine.ls_d_res_high 1.70
_refine.ls_percent_reflns_obs 99.5
_refine.ls_R_factor_obs 0.215
_refine.ls_R_factor_all ?
_refine.ls_R_factor_R_work 0.215
_refine.ls_R_factor_R_free 0.253
_refine.ls_R_factor_R_free_error 0.008
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_percent_reflns_R_free 10.5
_refine.ls_number_reflns_R_free 969
_refine.ls_number_parameters ?
_refine.ls_number_restraints ?
_refine.occupancy_min ?
_refine.occupancy_max ?
_refine.B_iso_mean 22.6
_refine.aniso_B[1][1] 1.85
_refine.aniso_B[2][2] 1.85
_refine.aniso_B[3][3] -3.69
_refine.aniso_B[1][2] 0.00
_refine.aniso_B[1][3] 0.00
_refine.aniso_B[2][3] 0.00
_refine.solvent_model_details ?
_refine.solvent_model_param_ksol ?
_refine.solvent_model_param_bsol ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.details 'BULK SOLVENT MODEL USED'
_refine.pdbx_starting_model ?
_refine.pdbx_method_to_determine_struct 'MULTI-WAVELENGTH ANOMALOUS DISPERSION'
_refine.pdbx_isotropic_thermal_model RESTRAINED
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.overall_SU_ML ?
_refine.overall_SU_B ?
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_redundancy_reflns_obs ?
_refine.pdbx_overall_phase_error ?
_refine.B_iso_min ?
_refine.B_iso_max ?
_refine.correlation_coeff_Fo_to_Fc ?
_refine.correlation_coeff_Fo_to_Fc_free ?
_refine.pdbx_solvent_vdw_probe_radii ?
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii ?
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_diffrn_id 1
#
_refine_analyze.entry_id 1A8O
_refine_analyze.Luzzati_coordinate_error_obs 0.21
_refine_analyze.Luzzati_sigma_a_obs 0.19
_refine_analyze.Luzzati_d_res_low_obs 5.00
_refine_analyze.Luzzati_coordinate_error_free 0.23
_refine_analyze.Luzzati_sigma_a_free 0.19
_refine_analyze.Luzzati_d_res_low_free ?
_refine_analyze.number_disordered_residues ?
_refine_analyze.occupancy_sum_hydrogen ?
_refine_analyze.occupancy_sum_non_hydrogen ?
_refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION'
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id LAST
_refine_hist.pdbx_number_atoms_protein 556
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 0
_refine_hist.number_atoms_solvent 88
_refine_hist.number_atoms_total 644
_refine_hist.d_res_high 1.70
_refine_hist.d_res_low 25.00
#
loop_
_refine_ls_restr.type
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.weight
_refine_ls_restr.number
_refine_ls_restr.pdbx_refine_id
x_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION'
x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION'
x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION'
x_angle_d ? ? ? ? 'X-RAY DIFFRACTION'
x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION'
x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION'
x_angle_deg 1.1 ? ? ? 'X-RAY DIFFRACTION'
x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION'
x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION'
x_dihedral_angle_d 20.4 ? ? ? 'X-RAY DIFFRACTION'
x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION'
x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION'
x_improper_angle_d 1.01 ? ? ? 'X-RAY DIFFRACTION'
x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION'
x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION'
x_mcbond_it 1.31 1.50 ? ? 'X-RAY DIFFRACTION'
x_mcangle_it 2.12 2.00 ? ? 'X-RAY DIFFRACTION'
x_scbond_it 2.41 2.00 ? ? 'X-RAY DIFFRACTION'
x_scangle_it 3.92 2.50 ? ? 'X-RAY DIFFRACTION'
#
_refine_ls_shell.pdbx_total_number_of_bins_used 6
_refine_ls_shell.d_res_high 1.70
_refine_ls_shell.d_res_low 1.81
_refine_ls_shell.number_reflns_R_work 1320
_refine_ls_shell.R_factor_R_work 0.276
_refine_ls_shell.percent_reflns_obs 99.1
_refine_ls_shell.R_factor_R_free 0.328
_refine_ls_shell.R_factor_R_free_error 0.027
_refine_ls_shell.percent_reflns_R_free 10.4
_refine_ls_shell.number_reflns_R_free 153
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.number_reflns_all ?
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.R_factor_all ?
#
loop_
_pdbx_xplor_file.serial_no
_pdbx_xplor_file.param_file
_pdbx_xplor_file.topol_file
_pdbx_xplor_file.pdbx_refine_id
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION'
2 TIP3P.PARAMETER TIP3P.TOPOLOGY 'X-RAY DIFFRACTION'
#
_struct.entry_id 1A8O
_struct.title 'HIV CAPSID C-TERMINAL DOMAIN'
_struct.pdbx_descriptor 'HIV CAPSID'
_struct.pdbx_model_details ?
_struct.pdbx_CASP_flag ?
_struct.pdbx_model_type_details ?
#
_struct_keywords.entry_id 1A8O
_struct_keywords.pdbx_keywords 'Viral protein'
_struct_keywords.text 'CAPSID, CORE PROTEIN, HIV, C-TERMINAL DOMAIN, Viral protein'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
#
_struct_biol.id 1
_struct_biol.details ?
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 1 PHE A 11 ? GLU A 25 ? PHE A 161 GLU A 175 1 ? 15
HELX_P HELX_P2 2 GLN A 29 ? GLU A 37 ? GLN A 179 GLU A 187 1 ? 9
HELX_P HELX_P3 3 LEU A 39 ? GLN A 42 ? LEU A 189 GLN A 192 1 ? 4
HELX_P HELX_P4 4 PRO A 46 ? LEU A 55 ? PRO A 196 LEU A 205 1 ? 10
HELX_P HELX_P5 5 LEU A 61 ? ALA A 67 ? LEU A 211 ALA A 217 1 ? 7
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
disulf1 disulf ? A CYS 48 SG ? ? ? 1_555 A CYS 68 SG ? ? A CYS 198 A CYS 218 1_555 ? ? ? ? ? ? ? 2.037 ?
covale1 covale ? A MSE 1 C ? ? ? 1_555 A ASP 2 N ? ? A MSE 151 A ASP 152 1_555 ? ? ? ? ? ? ? 1.326 ?
covale2 covale ? A MSE 35 N ? ? ? 1_555 A TRP 34 C ? ? A MSE 185 A TRP 184 1_555 ? ? ? ? ? ? ? 1.330 ?
covale3 covale ? A MSE 35 C ? ? ? 1_555 A THR 36 N ? ? A MSE 185 A THR 186 1_555 ? ? ? ? ? ? ? 1.333 ?
covale4 covale ? A MSE 64 N ? ? ? 1_555 A GLU 63 C ? ? A MSE 214 A GLU 213 1_555 ? ? ? ? ? ? ? 1.334 ?
covale5 covale ? A MSE 64 C ? ? ? 1_555 A MSE 65 N ? ? A MSE 214 A MSE 215 1_555 ? ? ? ? ? ? ? 1.332 ?
covale6 covale ? A MSE 65 C ? ? ? 1_555 A THR 66 N ? ? A MSE 215 A THR 216 1_555 ? ? ? ? ? ? ? 1.330 ?
#
loop_
_struct_conn_type.id
_struct_conn_type.criteria
_struct_conn_type.reference
disulf ? ?
covale ? ?
#
_database_PDB_matrix.entry_id 1A8O
_database_PDB_matrix.origx[1][1] 1.000000
_database_PDB_matrix.origx[1][2] 0.000000
_database_PDB_matrix.origx[1][3] 0.000000
_database_PDB_matrix.origx[2][1] 0.000000
_database_PDB_matrix.origx[2][2] 1.000000
_database_PDB_matrix.origx[2][3] 0.000000
_database_PDB_matrix.origx[3][1] 0.000000
_database_PDB_matrix.origx[3][2] 0.000000
_database_PDB_matrix.origx[3][3] 1.000000
_database_PDB_matrix.origx_vector[1] 0.00000
_database_PDB_matrix.origx_vector[2] 0.00000
_database_PDB_matrix.origx_vector[3] 0.00000
#
_atom_sites.entry_id 1A8O
_atom_sites.Cartn_transform_axes ?
_atom_sites.fract_transf_matrix[1][1] 0.023821
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.023821
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.011246
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
#
loop_
_atom_type.symbol
N
C
O
SE
S
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_asym_id
_atom_site.label_entity_id
_atom_site.label_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.B_iso_or_equiv
_atom_site.Cartn_x_esd
_atom_site.Cartn_y_esd
_atom_site.Cartn_z_esd
_atom_site.occupancy_esd
_atom_site.B_iso_or_equiv_esd
_atom_site.pdbx_formal_charge
_atom_site.auth_seq_id
_atom_site.auth_comp_id
_atom_site.auth_asym_id
_atom_site.auth_atom_id
_atom_site.pdbx_PDB_model_num
ATOM 1 N N . MSE A 1 1 ? 19.594 32.367 28.012 1.00 18.03 ? ? ? ? ? ? 151 MSE A N 1
ATOM 2 C CA . MSE A 1 1 ? 20.255 33.101 26.891 1.00 18.64 ? ? ? ? ? ? 151 MSE A CA 1
ATOM 3 C C . MSE A 1 1 ? 20.351 34.558 27.296 1.00 18.46 ? ? ? ? ? ? 151 MSE A C 1
ATOM 4 O O . MSE A 1 1 ? 19.362 35.291 27.282 1.00 19.71 ? ? ? ? ? ? 151 MSE A O 1
ATOM 5 C CB . MSE A 1 1 ? 19.457 32.943 25.591 1.00 16.30 ? ? ? ? ? ? 151 MSE A CB 1
ATOM 6 C CG . MSE A 1 1 ? 20.022 33.700 24.387 1.00 17.46 ? ? ? ? ? ? 151 MSE A CG 1
ATOM 7 SE SE . MSE A 1 1 ? 21.718 33.262 23.918 1.00 19.31 ? ? ? ? ? ? 151 MSE A SE 1
ATOM 8 C CE . MSE A 1 1 ? 21.424 31.798 22.897 1.00 18.23 ? ? ? ? ? ? 151 MSE A CE 1
ATOM 9 N N . ASP A 1 2 ? 21.554 34.953 27.691 1.00 19.26 ? ? ? ? ? ? 152 ASP A N 1
ATOM 10 C CA . ASP A 1 2 ? 21.835 36.306 28.144 1.00 20.88 ? ? ? ? ? ? 152 ASP A CA 1
ATOM 11 C C . ASP A 1 2 ? 21.947 37.322 27.000 1.00 19.01 ? ? ? ? ? ? 152 ASP A C 1
ATOM 12 O O . ASP A 1 2 ? 21.678 38.510 27.187 1.00 18.04 ? ? ? ? ? ? 152 ASP A O 1
ATOM 13 C CB . ASP A 1 2 ? 23.126 36.292 28.966 1.00 23.68 ? ? ? ? ? ? 152 ASP A CB 1
ATOM 14 C CG . ASP A 1 2 ? 23.098 37.275 30.112 1.00 28.51 ? ? ? ? ? ? 152 ASP A CG 1
ATOM 15 O OD1 . ASP A 1 2 ? 23.433 38.456 29.884 1.00 31.95 ? ? ? ? ? ? 152 ASP A OD1 1
ATOM 16 O OD2 . ASP A 1 2 ? 22.749 36.865 31.241 1.00 28.49 ? ? ? ? ? ? 152 ASP A OD2 1
ATOM 17 N N . ILE A 1 3 ? 22.322 36.838 25.818 1.00 16.79 ? ? ? ? ? ? 153 ILE A N 1
ATOM 18 C CA . ILE A 1 3 ? 22.498 37.681 24.632 1.00 15.93 ? ? ? ? ? ? 153 ILE A CA 1
ATOM 19 C C . ILE A 1 3 ? 21.220 38.389 24.164 1.00 14.17 ? ? ? ? ? ? 153 ILE A C 1
ATOM 20 O O . ILE A 1 3 ? 20.214 37.743 23.876 1.00 12.57 ? ? ? ? ? ? 153 ILE A O 1
ATOM 21 C CB . ILE A 1 3 ? 23.062 36.854 23.441 1.00 16.32 ? ? ? ? ? ? 153 ILE A CB 1
ATOM 22 C CG1 . ILE A 1 3 ? 24.282 36.029 23.879 1.00 17.00 ? ? ? ? ? ? 153 ILE A CG1 1
ATOM 23 C CG2 . ILE A 1 3 ? 23.423 37.769 22.280 1.00 15.06 ? ? ? ? ? ? 153 ILE A CG2 1
ATOM 24 C CD1 . ILE A 1 3 ? 25.429 36.840 24.455 1.00 15.40 ? ? ? ? ? ? 153 ILE A CD1 1
ATOM 25 N N . ARG A 1 4 ? 21.280 39.719 24.101 1.00 13.09 ? ? ? ? ? ? 154 ARG A N 1
ATOM 26 C CA . ARG A 1 4 ? 20.173 40.563 23.646 1.00 11.56 ? ? ? ? ? ? 154 ARG A CA 1
ATOM 27 C C . ARG A 1 4 ? 20.766 41.644 22.751 1.00 12.66 ? ? ? ? ? ? 154 ARG A C 1
ATOM 28 O O . ARG A 1 4 ? 21.804 42.216 23.075 1.00 12.82 ? ? ? ? ? ? 154 ARG A O 1
ATOM 29 C CB . ARG A 1 4 ? 19.444 41.206 24.830 1.00 12.01 ? ? ? ? ? ? 154 ARG A CB 1
ATOM 30 C CG . ARG A 1 4 ? 18.724 40.196 25.695 1.00 13.52 ? ? ? ? ? ? 154 ARG A CG 1
ATOM 31 C CD . ARG A 1 4 ? 18.011 40.824 26.869 1.00 14.47 ? ? ? ? ? ? 154 ARG A CD 1
ATOM 32 N NE . ARG A 1 4 ? 17.416 39.777 27.690 1.00 16.22 ? ? ? ? ? ? 154 ARG A NE 1
ATOM 33 C CZ . ARG A 1 4 ? 16.221 39.234 27.476 1.00 17.81 ? ? ? ? ? ? 154 ARG A CZ 1
ATOM 34 N NH1 . ARG A 1 4 ? 15.459 39.650 26.470 1.00 18.16 ? ? ? ? ? ? 154 ARG A NH1 1
ATOM 35 N NH2 . ARG A 1 4 ? 15.824 38.211 28.222 1.00 19.78 ? ? ? ? ? ? 154 ARG A NH2 1
ATOM 36 N N . GLN A 1 5 ? 20.116 41.917 21.623 1.00 13.22 ? ? ? ? ? ? 155 GLN A N 1
ATOM 37 C CA . GLN A 1 5 ? 20.613 42.918 20.680 1.00 13.79 ? ? ? ? ? ? 155 GLN A CA 1
ATOM 38 C C . GLN A 1 5 ? 20.546 44.344 21.203 1.00 15.08 ? ? ? ? ? ? 155 GLN A C 1
ATOM 39 O O . GLN A 1 5 ? 19.488 44.804 21.635 1.00 14.99 ? ? ? ? ? ? 155 GLN A O 1
ATOM 40 C CB . GLN A 1 5 ? 19.837 42.841 19.368 1.00 13.29 ? ? ? ? ? ? 155 GLN A CB 1
ATOM 41 C CG . GLN A 1 5 ? 20.385 43.751 18.271 1.00 13.01 ? ? ? ? ? ? 155 GLN A CG 1
ATOM 42 C CD . GLN A 1 5 ? 19.526 43.736 17.022 1.00 14.60 ? ? ? ? ? ? 155 GLN A CD 1
ATOM 43 O OE1 . GLN A 1 5 ? 18.365 43.322 17.058 1.00 14.77 ? ? ? ? ? ? 155 GLN A OE1 1
ATOM 44 N NE2 . GLN A 1 5 ? 20.090 44.190 15.909 1.00 14.24 ? ? ? ? ? ? 155 GLN A NE2 1
ATOM 45 N N . GLY A 1 6 ? 21.675 45.045 21.155 1.00 16.52 ? ? ? ? ? ? 156 GLY A N 1
ATOM 46 C CA . GLY A 1 6 ? 21.698 46.427 21.598 1.00 18.25 ? ? ? ? ? ? 156 GLY A CA 1
ATOM 47 C C . GLY A 1 6 ? 20.859 47.278 20.654 1.00 20.82 ? ? ? ? ? ? 156 GLY A C 1
ATOM 48 O O . GLY A 1 6 ? 20.729 46.935 19.475 1.00 20.23 ? ? ? ? ? ? 156 GLY A O 1
ATOM 49 N N . PRO A 1 7 ? 20.260 48.380 21.137 1.00 22.32 ? ? ? ? ? ? 157 PRO A N 1
ATOM 50 C CA . PRO A 1 7 ? 19.435 49.249 20.287 1.00 22.62 ? ? ? ? ? ? 157 PRO A CA 1
ATOM 51 C C . PRO A 1 7 ? 20.158 49.801 19.054 1.00 22.59 ? ? ? ? ? ? 157 PRO A C 1
ATOM 52 O O . PRO A 1 7 ? 19.512 50.154 18.068 1.00 24.55 ? ? ? ? ? ? 157 PRO A O 1
ATOM 53 C CB . PRO A 1 7 ? 18.993 50.357 21.249 1.00 22.00 ? ? ? ? ? ? 157 PRO A CB 1
ATOM 54 C CG . PRO A 1 7 ? 20.056 50.358 22.317 1.00 24.33 ? ? ? ? ? ? 157 PRO A CG 1
ATOM 55 C CD . PRO A 1 7 ? 20.300 48.887 22.519 1.00 24.26 ? ? ? ? ? ? 157 PRO A CD 1
ATOM 56 N N . LYS A 1 8 ? 21.486 49.867 19.109 1.00 21.24 ? ? ? ? ? ? 158 LYS A N 1
ATOM 57 C CA . LYS A 1 8 ? 22.285 50.358 17.985 1.00 22.20 ? ? ? ? ? ? 158 LYS A CA 1
ATOM 58 C C . LYS A 1 8 ? 23.286 49.318 17.478 1.00 20.51 ? ? ? ? ? ? 158 LYS A C 1
ATOM 59 O O . LYS A 1 8 ? 24.155 49.627 16.659 1.00 19.41 ? ? ? ? ? ? 158 LYS A O 1
ATOM 60 C CB . LYS A 1 8 ? 23.025 51.649 18.358 1.00 23.18 ? ? ? ? ? ? 158 LYS A CB 1
ATOM 61 C CG . LYS A 1 8 ? 22.117 52.841 18.584 1.00 26.02 ? ? ? ? ? ? 158 LYS A CG 1
ATOM 62 C CD . LYS A 1 8 ? 21.236 53.111 17.369 1.00 30.06 ? ? ? ? ? ? 158 LYS A CD 1
ATOM 63 C CE . LYS A 1 8 ? 20.159 54.136 17.694 1.00 32.44 ? ? ? ? ? ? 158 LYS A CE 1
ATOM 64 N NZ . LYS A 1 8 ? 19.231 54.379 16.560 1.00 35.60 ? ? ? ? ? ? 158 LYS A NZ 1
ATOM 65 N N . GLU A 1 9 ? 23.152 48.085 17.961 1.00 19.34 ? ? ? ? ? ? 159 GLU A N 1
ATOM 66 C CA . GLU A 1 9 ? 24.037 46.996 17.561 1.00 17.36 ? ? ? ? ? ? 159 GLU A CA 1
ATOM 67 C C . GLU A 1 9 ? 23.563 46.364 16.255 1.00 16.62 ? ? ? ? ? ? 159 GLU A C 1
ATOM 68 O O . GLU A 1 9 ? 22.398 45.994 16.132 1.00 16.13 ? ? ? ? ? ? 159 GLU A O 1
ATOM 69 C CB . GLU A 1 9 ? 24.086 45.924 18.653 1.00 16.25 ? ? ? ? ? ? 159 GLU A CB 1
ATOM 70 C CG . GLU A 1 9 ? 25.003 44.744 18.321 1.00 15.36 ? ? ? ? ? ? 159 GLU A CG 1
ATOM 71 C CD . GLU A 1 9 ? 24.858 43.575 19.284 1.00 16.29 ? ? ? ? ? ? 159 GLU A CD 1
ATOM 72 O OE1 . GLU A 1 9 ? 23.861 43.516 20.039 1.00 15.50 ? ? ? ? ? ? 159 GLU A OE1 1
ATOM 73 O OE2 . GLU A 1 9 ? 25.748 42.701 19.277 1.00 15.09 ? ? ? ? ? ? 159 GLU A OE2 1
ATOM 74 N N . PRO A 1 10 ? 24.459 46.247 15.256 1.00 17.27 ? ? ? ? ? ? 160 PRO A N 1
ATOM 75 C CA . PRO A 1 10 ? 24.089 45.645 13.969 1.00 16.68 ? ? ? ? ? ? 160 PRO A CA 1
ATOM 76 C C . PRO A 1 10 ? 23.580 44.224 14.212 1.00 15.39 ? ? ? ? ? ? 160 PRO A C 1
ATOM 77 O O . PRO A 1 10 ? 24.111 43.515 15.070 1.00 14.31 ? ? ? ? ? ? 160 PRO A O 1
ATOM 78 C CB . PRO A 1 10 ? 25.415 45.639 13.207 1.00 16.98 ? ? ? ? ? ? 160 PRO A CB 1
ATOM 79 C CG . PRO A 1 10 ? 26.116 46.856 13.749 1.00 17.40 ? ? ? ? ? ? 160 PRO A CG 1
ATOM 80 C CD . PRO A 1 10 ? 25.852 46.732 15.231 1.00 17.24 ? ? ? ? ? ? 160 PRO A CD 1
ATOM 81 N N . PHE A 1 11 ? 22.544 43.824 13.480 1.00 13.37 ? ? ? ? ? ? 161 PHE A N 1
ATOM 82 C CA . PHE A 1 11 ? 21.960 42.494 13.639 1.00 12.78 ? ? ? ? ? ? 161 PHE A CA 1
ATOM 83 C C . PHE A 1 11 ? 22.965 41.346 13.502 1.00 12.00 ? ? ? ? ? ? 161 PHE A C 1
ATOM 84 O O . PHE A 1 11 ? 22.928 40.397 14.283 1.00 10.69 ? ? ? ? ? ? 161 PHE A O 1
ATOM 85 C CB . PHE A 1 11 ? 20.793 42.292 12.666 1.00 11.13 ? ? ? ? ? ? 161 PHE A CB 1
ATOM 86 C CG . PHE A 1 11 ? 19.999 41.042 12.927 1.00 10.56 ? ? ? ? ? ? 161 PHE A CG 1
ATOM 87 C CD1 . PHE A 1 11 ? 19.234 40.918 14.085 1.00 13.40 ? ? ? ? ? ? 161 PHE A CD1 1
ATOM 88 C CD2 . PHE A 1 11 ? 20.019 39.985 12.021 1.00 11.57 ? ? ? ? ? ? 161 PHE A CD2 1
ATOM 89 C CE1 . PHE A 1 11 ? 18.495 39.758 14.340 1.00 11.25 ? ? ? ? ? ? 161 PHE A CE1 1
ATOM 90 C CE2 . PHE A 1 11 ? 19.286 38.821 12.263 1.00 11.84 ? ? ? ? ? ? 161 PHE A CE2 1
ATOM 91 C CZ . PHE A 1 11 ? 18.523 38.708 13.427 1.00 12.92 ? ? ? ? ? ? 161 PHE A CZ 1
ATOM 92 N N . ARG A 1 12 ? 23.861 41.443 12.522 1.00 11.87 ? ? ? ? ? ? 162 ARG A N 1
ATOM 93 C CA . ARG A 1 12 ? 24.870 40.411 12.294 1.00 12.70 ? ? ? ? ? ? 162 ARG A CA 1
ATOM 94 C C . ARG A 1 12 ? 25.788 40.216 13.509 1.00 13.20 ? ? ? ? ? ? 162 ARG A C 1
ATOM 95 O O . ARG A 1 12 ? 26.158 39.090 13.835 1.00 13.83 ? ? ? ? ? ? 162 ARG A O 1
ATOM 96 C CB . ARG A 1 12 ? 25.684 40.732 11.032 1.00 13.94 ? ? ? ? ? ? 162 ARG A CB 1
ATOM 97 C CG . ARG A 1 12 ? 26.777 39.725 10.715 1.00 18.61 ? ? ? ? ? ? 162 ARG A CG 1
ATOM 98 C CD . ARG A 1 12 ? 26.215 38.321 10.515 1.00 22.34 ? ? ? ? ? ? 162 ARG A CD 1
ATOM 99 N NE . ARG A 1 12 ? 27.235 37.297 10.736 1.00 25.22 ? ? ? ? ? ? 162 ARG A NE 1
ATOM 100 C CZ . ARG A 1 12 ? 28.136 36.918 9.833 1.00 26.94 ? ? ? ? ? ? 162 ARG A CZ 1
ATOM 101 N NH1 . ARG A 1 12 ? 28.155 37.473 8.628 1.00 24.70 ? ? ? ? ? ? 162 ARG A NH1 1
ATOM 102 N NH2 . ARG A 1 12 ? 29.030 35.992 10.145 1.00 27.37 ? ? ? ? ? ? 162 ARG A NH2 1
ATOM 103 N N . ASP A 1 13 ? 26.137 41.309 14.185 1.00 13.70 ? ? ? ? ? ? 163 ASP A N 1
ATOM 104 C CA . ASP A 1 13 ? 26.994 41.247 15.373 1.00 14.57 ? ? ? ? ? ? 163 ASP A CA 1
ATOM 105 C C . ASP A 1 13 ? 26.279 40.526 16.517 1.00 13.66 ? ? ? ? ? ? 163 ASP A C 1
ATOM 106 O O . ASP A 1 13 ? 26.880 39.735 17.245 1.00 11.59 ? ? ? ? ? ? 163 ASP A O 1
ATOM 107 C CB . ASP A 1 13 ? 27.408 42.658 15.805 1.00 17.17 ? ? ? ? ? ? 163 ASP A CB 1
ATOM 108 C CG . ASP A 1 13 ? 28.345 43.328 14.804 1.00 20.18 ? ? ? ? ? ? 163 ASP A CG 1
ATOM 109 O OD1 . ASP A 1 13 ? 28.814 42.655 13.859 1.00 22.06 ? ? ? ? ? ? 163 ASP A OD1 1
ATOM 110 O OD2 . ASP A 1 13 ? 28.620 44.532 14.968 1.00 22.56 ? ? ? ? ? ? 163 ASP A OD2 1
ATOM 111 N N . TYR A 1 14 ? 24.992 40.818 16.662 1.00 12.63 ? ? ? ? ? ? 164 TYR A N 1
ATOM 112 C CA . TYR A 1 14 ? 24.151 40.196 17.672 1.00 11.74 ? ? ? ? ? ? 164 TYR A CA 1
ATOM 113 C C . TYR A 1 14 ? 24.025 38.704 17.350 1.00 11.75 ? ? ? ? ? ? 164 TYR A C 1
ATOM 114 O O . TYR A 1 14 ? 24.139 37.861 18.238 1.00 9.99 ? ? ? ? ? ? 164 TYR A O 1
ATOM 115 C CB . TYR A 1 14 ? 22.787 40.897 17.684 1.00 11.53 ? ? ? ? ? ? 164 TYR A CB 1
ATOM 116 C CG . TYR A 1 14 ? 21.629 40.095 18.244 1.00 11.87 ? ? ? ? ? ? 164 TYR A CG 1
ATOM 117 C CD1 . TYR A 1 14 ? 21.657 39.583 19.543 1.00 11.82 ? ? ? ? ? ? 164 TYR A CD1 1
ATOM 118 C CD2 . TYR A 1 14 ? 20.489 39.874 17.474 1.00 11.91 ? ? ? ? ? ? 164 TYR A CD2 1
ATOM 119 C CE1 . TYR A 1 14 ? 20.571 38.872 20.056 1.00 12.21 ? ? ? ? ? ? 164 TYR A CE1 1
ATOM 120 C CE2 . TYR A 1 14 ? 19.408 39.171 17.972 1.00 11.96 ? ? ? ? ? ? 164 TYR A CE2 1
ATOM 121 C CZ . TYR A 1 14 ? 19.450 38.673 19.258 1.00 13.17 ? ? ? ? ? ? 164 TYR A CZ 1
ATOM 122 O OH . TYR A 1 14 ? 18.365 37.977 19.732 1.00 13.72 ? ? ? ? ? ? 164 TYR A OH 1
ATOM 123 N N . VAL A 1 15 ? 23.839 38.388 16.069 1.00 11.70 ? ? ? ? ? ? 165 VAL A N 1
ATOM 124 C CA . VAL A 1 15 ? 23.720 37.002 15.614 1.00 11.32 ? ? ? ? ? ? 165 VAL A CA 1
ATOM 125 C C . VAL A 1 15 ? 24.962 36.204 15.999 1.00 10.85 ? ? ? ? ? ? 165 VAL A C 1
ATOM 126 O O . VAL A 1 15 ? 24.853 35.084 16.498 1.00 10.90 ? ? ? ? ? ? 165 VAL A O 1
ATOM 127 C CB . VAL A 1 15 ? 23.502 36.931 14.077 1.00 12.32 ? ? ? ? ? ? 165 VAL A CB 1
ATOM 128 C CG1 . VAL A 1 15 ? 23.661 35.501 13.570 1.00 13.01 ? ? ? ? ? ? 165 VAL A CG1 1
ATOM 129 C CG2 . VAL A 1 15 ? 22.120 37.444 13.733 1.00 11.97 ? ? ? ? ? ? 165 VAL A CG2 1
ATOM 130 N N . ASP A 1 16 ? 26.137 36.796 15.797 1.00 10.27 ? ? ? ? ? ? 166 ASP A N 1
ATOM 131 C CA . ASP A 1 16 ? 27.387 36.126 16.139 1.00 13.05 ? ? ? ? ? ? 166 ASP A CA 1
ATOM 132 C C . ASP A 1 16 ? 27.511 35.879 17.644 1.00 11.81 ? ? ? ? ? ? 166 ASP A C 1
ATOM 133 O O . ASP A 1 16 ? 27.925 34.804 18.060 1.00 13.34 ? ? ? ? ? ? 166 ASP A O 1
ATOM 134 C CB . ASP A 1 16 ? 28.595 36.912 15.612 1.00 14.35 ? ? ? ? ? ? 166 ASP A CB 1
ATOM 135 C CG . ASP A 1 16 ? 28.723 36.860 14.085 1.00 18.81 ? ? ? ? ? ? 166 ASP A CG 1
ATOM 136 O OD1 . ASP A 1 16 ? 28.016 36.066 13.422 1.00 18.59 ? ? ? ? ? ? 166 ASP A OD1 1
ATOM 137 O OD2 . ASP A 1 16 ? 29.545 37.627 13.543 1.00 21.71 ? ? ? ? ? ? 166 ASP A OD2 1
ATOM 138 N N . ARG A 1 17 ? 27.136 36.859 18.461 1.00 13.13 ? ? ? ? ? ? 167 ARG A N 1
ATOM 139 C CA . ARG A 1 17 ? 27.202 36.685 19.913 1.00 13.19 ? ? ? ? ? ? 167 ARG A CA 1
ATOM 140 C C . ARG A 1 17 ? 26.238 35.580 20.335 1.00 12.86 ? ? ? ? ? ? 167 ARG A C 1
ATOM 141 O O . ARG A 1 17 ? 26.585 34.701 21.120 1.00 14.45 ? ? ? ? ? ? 167 ARG A O 1
ATOM 142 C CB . ARG A 1 17 ? 26.850 37.988 20.638 1.00 13.10 ? ? ? ? ? ? 167 ARG A CB 1
ATOM 143 C CG . ARG A 1 17 ? 27.835 39.118 20.394 1.00 13.78 ? ? ? ? ? ? 167 ARG A CG 1
ATOM 144 C CD . ARG A 1 17 ? 27.667 40.246 21.404 1.00 15.46 ? ? ? ? ? ? 167 ARG A CD 1
ATOM 145 N NE . ARG A 1 17 ? 26.352 40.877 21.333 1.00 14.76 ? ? ? ? ? ? 167 ARG A NE 1
ATOM 146 C CZ . ARG A 1 17 ? 25.494 40.940 22.345 1.00 15.93 ? ? ? ? ? ? 167 ARG A CZ 1
ATOM 147 N NH1 . ARG A 1 17 ? 25.797 40.401 23.519 1.00 14.48 ? ? ? ? ? ? 167 ARG A NH1 1
ATOM 148 N NH2 . ARG A 1 17 ? 24.325 41.539 22.181 1.00 15.85 ? ? ? ? ? ? 167 ARG A NH2 1
ATOM 149 N N . PHE A 1 18 ? 25.037 35.622 19.769 1.00 13.51 ? ? ? ? ? ? 168 PHE A N 1
ATOM 150 C CA . PHE A 1 18 ? 23.984 34.649 20.039 1.00 13.57 ? ? ? ? ? ? 168 PHE A CA 1
ATOM 151 C C . PHE A 1 18 ? 24.456 33.232 19.729 1.00 14.50 ? ? ? ? ? ? 168 PHE A C 1
ATOM 152 O O . PHE A 1 18 ? 24.305 32.327 20.552 1.00 15.31 ? ? ? ? ? ? 168 PHE A O 1
ATOM 153 C CB . PHE A 1 18 ? 22.761 34.993 19.186 1.00 12.14 ? ? ? ? ? ? 168 PHE A CB 1
ATOM 154 C CG . PHE A 1 18 ? 21.538 34.184 19.504 1.00 12.42 ? ? ? ? ? ? 168 PHE A CG 1
ATOM 155 C CD1 . PHE A 1 18 ? 21.301 32.973 18.859 1.00 12.95 ? ? ? ? ? ? 168 PHE A CD1 1
ATOM 156 C CD2 . PHE A 1 18 ? 20.586 34.664 20.397 1.00 12.93 ? ? ? ? ? ? 168 PHE A CD2 1
ATOM 157 C CE1 . PHE A 1 18 ? 20.130 32.254 19.094 1.00 13.37 ? ? ? ? ? ? 168 PHE A CE1 1
ATOM 158 C CE2 . PHE A 1 18 ? 19.415 33.954 20.639 1.00 12.70 ? ? ? ? ? ? 168 PHE A CE2 1
ATOM 159 C CZ . PHE A 1 18 ? 19.186 32.747 19.985 1.00 12.32 ? ? ? ? ? ? 168 PHE A CZ 1
ATOM 160 N N . TYR A 1 19 ? 25.033 33.048 18.544 1.00 14.29 ? ? ? ? ? ? 169 TYR A N 1
ATOM 161 C CA . TYR A 1 19 ? 25.526 31.738 18.123 1.00 17.50 ? ? ? ? ? ? 169 TYR A CA 1
ATOM 162 C C . TYR A 1 19 ? 26.755 31.256 18.875 1.00 16.74 ? ? ? ? ? ? 169 TYR A C 1
ATOM 163 O O . TYR A 1 19 ? 27.015 30.057 18.949 1.00 17.31 ? ? ? ? ? ? 169 TYR A O 1
ATOM 164 C CB . TYR A 1 19 ? 25.771 31.709 16.616 1.00 19.50 ? ? ? ? ? ? 169 TYR A CB 1
ATOM 165 C CG . TYR A 1 19 ? 24.608 31.119 15.869 1.00 24.71 ? ? ? ? ? ? 169 TYR A CG 1
ATOM 166 C CD1 . TYR A 1 19 ? 23.508 31.900 15.519 1.00 26.54 ? ? ? ? ? ? 169 TYR A CD1 1
ATOM 167 C CD2 . TYR A 1 19 ? 24.583 29.762 15.555 1.00 29.22 ? ? ? ? ? ? 169 TYR A CD2 1
ATOM 168 C CE1 . TYR A 1 19 ? 22.406 31.340 14.877 1.00 31.38 ? ? ? ? ? ? 169 TYR A CE1 1
ATOM 169 C CE2 . TYR A 1 19 ? 23.490 29.193 14.913 1.00 32.18 ? ? ? ? ? ? 169 TYR A CE2 1
ATOM 170 C CZ . TYR A 1 19 ? 22.406 29.985 14.577 1.00 33.14 ? ? ? ? ? ? 169 TYR A CZ 1
ATOM 171 O OH . TYR A 1 19 ? 21.326 29.415 13.941 1.00 38.62 ? ? ? ? ? ? 169 TYR A OH 1
ATOM 172 N N . LYS A 1 20 ? 27.508 32.195 19.432 1.00 18.09 ? ? ? ? ? ? 170 LYS A N 1
ATOM 173 C CA . LYS A 1 20 ? 28.691 31.859 20.208 1.00 19.24 ? ? ? ? ? ? 170 LYS A CA 1
ATOM 174 C C . LYS A 1 20 ? 28.183 31.155 21.468 1.00 19.06 ? ? ? ? ? ? 170 LYS A C 1
ATOM 175 O O . LYS A 1 20 ? 28.705 30.117 21.859 1.00 18.62 ? ? ? ? ? ? 170 LYS A O 1
ATOM 176 C CB . LYS A 1 20 ? 29.455 33.137 20.556 1.00 21.47 ? ? ? ? ? ? 170 LYS A CB 1
ATOM 177 C CG . LYS A 1 20 ? 30.787 32.942 21.242 1.00 24.27 ? ? ? ? ? ? 170 LYS A CG 1
ATOM 178 C CD . LYS A 1 20 ? 31.428 34.297 21.496 1.00 28.25 ? ? ? ? ? ? 170 LYS A CD 1
ATOM 179 C CE . LYS A 1 20 ? 32.618 34.194 22.436 1.00 33.51 ? ? ? ? ? ? 170 LYS A CE 1
ATOM 180 N NZ . LYS A 1 20 ? 33.153 35.536 22.820 1.00 36.47 ? ? ? ? ? ? 170 LYS A NZ 1
ATOM 181 N N . THR A 1 21 ? 27.116 31.695 22.055 1.00 17.19 ? ? ? ? ? ? 171 THR A N 1
ATOM 182 C CA . THR A 1 21 ? 26.508 31.110 23.247 1.00 17.79 ? ? ? ? ? ? 171 THR A CA 1
ATOM 183 C C . THR A 1 21 ? 25.826 29.789 22.889 1.00 18.09 ? ? ? ? ? ? 171 THR A C 1
ATOM 184 O O . THR A 1 21 ? 25.827 28.840 23.676 1.00 18.81 ? ? ? ? ? ? 171 THR A O 1
ATOM 185 C CB . THR A 1 21 ? 25.475 32.075 23.876 1.00 18.09 ? ? ? ? ? ? 171 THR A CB 1
ATOM 186 O OG1 . THR A 1 21 ? 26.150 33.240 24.357 1.00 19.60 ? ? ? ? ? ? 171 THR A OG1 1
ATOM 187 C CG2 . THR A 1 21 ? 24.741 31.417 25.045 1.00 19.92 ? ? ? ? ? ? 171 THR A CG2 1
ATOM 188 N N . LEU A 1 22 ? 25.264 29.727 21.687 1.00 18.22 ? ? ? ? ? ? 172 LEU A N 1
ATOM 189 C CA . LEU A 1 22 ? 24.587 28.528 21.224 1.00 19.39 ? ? ? ? ? ? 172 LEU A CA 1
ATOM 190 C C . LEU A 1 22 ? 25.587 27.392 20.984 1.00 20.30 ? ? ? ? ? ? 172 LEU A C 1
ATOM 191 O O . LEU A 1 22 ? 25.302 26.236 21.301 1.00 18.88 ? ? ? ? ? ? 172 LEU A O 1
ATOM 192 C CB . LEU A 1 22 ? 23.789 28.840 19.955 1.00 22.45 ? ? ? ? ? ? 172 LEU A CB 1
ATOM 193 C CG . LEU A 1 22 ? 22.707 27.854 19.514 1.00 24.91 ? ? ? ? ? ? 172 LEU A CG 1
ATOM 194 C CD1 . LEU A 1 22 ? 21.787 27.515 20.682 1.00 27.47 ? ? ? ? ? ? 172 LEU A CD1 1
ATOM 195 C CD2 . LEU A 1 22 ? 21.910 28.464 18.375 1.00 24.64 ? ? ? ? ? ? 172 LEU A CD2 1
ATOM 196 N N . ARG A 1 23 ? 26.767 27.727 20.462 1.00 19.95 ? ? ? ? ? ? 173 ARG A N 1
ATOM 197 C CA . ARG A 1 23 ? 27.806 26.728 20.202 1.00 21.05 ? ? ? ? ? ? 173 ARG A CA 1
ATOM 198 C C . ARG A 1 23 ? 28.299 26.044 21.468 1.00 22.39 ? ? ? ? ? ? 173 ARG A C 1
ATOM 199 O O . ARG A 1 23 ? 28.656 24.864 21.443 1.00 23.74 ? ? ? ? ? ? 173 ARG A O 1
ATOM 200 C CB . ARG A 1 23 ? 29.006 27.352 19.492 1.00 22.58 ? ? ? ? ? ? 173 ARG A CB 1
ATOM 201 C CG . ARG A 1 23 ? 28.944 27.266 17.984 1.00 26.30 ? ? ? ? ? ? 173 ARG A CG 1
ATOM 202 C CD . ARG A 1 23 ? 30.295 27.583 17.356 1.00 24.43 ? ? ? ? ? ? 173 ARG A CD 1
ATOM 203 N NE . ARG A 1 23 ? 30.744 28.937 17.662 1.00 23.96 ? ? ? ? ? ? 173 ARG A NE 1
ATOM 204 C CZ . ARG A 1 23 ? 30.326 30.032 17.033 1.00 23.32 ? ? ? ? ? ? 173 ARG A CZ 1
ATOM 205 N NH1 . ARG A 1 23 ? 29.441 29.954 16.046 1.00 22.16 ? ? ? ? ? ? 173 ARG A NH1 1
ATOM 206 N NH2 . ARG A 1 23 ? 30.787 31.215 17.406 1.00 25.21 ? ? ? ? ? ? 173 ARG A NH2 1
ATOM 207 N N . ALA A 1 24 ? 28.332 26.793 22.568 1.00 22.48 ? ? ? ? ? ? 174 ALA A N 1
ATOM 208 C CA . ALA A 1 24 ? 28.789 26.276 23.854 1.00 24.01 ? ? ? ? ? ? 174 ALA A CA 1
ATOM 209 C C . ALA A 1 24 ? 27.943 25.109 24.350 1.00 26.01 ? ? ? ? ? ? 174 ALA A C 1
ATOM 210 O O . ALA A 1 24 ? 28.374 24.348 25.215 1.00 28.50 ? ? ? ? ? ? 174 ALA A O 1
ATOM 211 C CB . ALA A 1 24 ? 28.803 27.388 24.888 1.00 22.70 ? ? ? ? ? ? 174 ALA A CB 1
ATOM 212 N N . GLU A 1 25 ? 26.740 24.973 23.801 1.00 26.88 ? ? ? ? ? ? 175 GLU A N 1
ATOM 213 C CA . GLU A 1 25 ? 25.833 23.899 24.186 1.00 27.42 ? ? ? ? ? ? 175 GLU A CA 1
ATOM 214 C C . GLU A 1 25 ? 25.775 22.791 23.139 1.00 28.42 ? ? ? ? ? ? 175 GLU A C 1
ATOM 215 O O . GLU A 1 25 ? 24.998 21.847 23.280 1.00 28.81 ? ? ? ? ? ? 175 GLU A O 1
ATOM 216 C CB . GLU A 1 25 ? 24.425 24.456 24.418 1.00 28.40 ? ? ? ? ? ? 175 GLU A CB 1
ATOM 217 C CG . GLU A 1 25 ? 24.354 25.596 25.435 1.00 29.60 ? ? ? ? ? ? 175 GLU A CG 1
ATOM 218 C CD . GLU A 1 25 ? 24.816 25.190 26.824 1.00 30.43 ? ? ? ? ? ? 175 GLU A CD 1
ATOM 219 O OE1 . GLU A 1 25 ? 24.535 24.049 27.243 1.00 31.07 ? ? ? ? ? ? 175 GLU A OE1 1
ATOM 220 O OE2 . GLU A 1 25 ? 25.454 26.018 27.506 1.00 31.11 ? ? ? ? ? ? 175 GLU A OE2 1
ATOM 221 N N . GLN A 1 26 ? 26.601 22.907 22.098 1.00 28.06 ? ? ? ? ? ? 176 GLN A N 1
ATOM 222 C CA . GLN A 1 26 ? 26.645 21.930 21.007 1.00 30.02 ? ? ? ? ? ? 176 GLN A CA 1
ATOM 223 C C . GLN A 1 26 ? 25.240 21.583 20.533 1.00 29.96 ? ? ? ? ? ? 176 GLN A C 1
ATOM 224 O O . GLN A 1 26 ? 24.885 20.411 20.389 1.00 31.12 ? ? ? ? ? ? 176 GLN A O 1
ATOM 225 C CB . GLN A 1 26 ? 27.391 20.655 21.422 1.00 32.57 ? ? ? ? ? ? 176 GLN A CB 1
ATOM 226 C CG . GLN A 1 26 ? 28.884 20.833 21.646 1.00 37.21 ? ? ? ? ? ? 176 GLN A CG 1
ATOM 227 C CD . GLN A 1 26 ? 29.200 21.479 22.977 1.00 41.10 ? ? ? ? ? ? 176 GLN A CD 1
ATOM 228 O OE1 . GLN A 1 26 ? 28.729 21.028 24.025 1.00 40.39 ? ? ? ? ? ? 176 GLN A OE1 1
ATOM 229 N NE2 . GLN A 1 26 ? 29.998 22.543 22.947 1.00 42.54 ? ? ? ? ? ? 176 GLN A NE2 1
ATOM 230 N N . ALA A 1 27 ? 24.438 22.619 20.314 1.00 29.23 ? ? ? ? ? ? 177 ALA A N 1
ATOM 231 C CA . ALA A 1 27 ? 23.066 22.454 19.863 1.00 27.71 ? ? ? ? ? ? 177 ALA A CA 1
ATOM 232 C C . ALA A 1 27 ? 23.001 21.782 18.498 1.00 27.26 ? ? ? ? ? ? 177 ALA A C 1
ATOM 233 O O . ALA A 1 27 ? 23.824 22.046 17.620 1.00 28.56 ? ? ? ? ? ? 177 ALA A O 1
ATOM 234 C CB . ALA A 1 27 ? 22.370 23.806 19.817 1.00 27.54 ? ? ? ? ? ? 177 ALA A CB 1
ATOM 235 N N . SER A 1 28 ? 22.035 20.886 18.339 1.00 26.47 ? ? ? ? ? ? 178 SER A N 1
ATOM 236 C CA . SER A 1 28 ? 21.831 20.180 17.080 1.00 26.14 ? ? ? ? ? ? 178 SER A CA 1
ATOM 237 C C . SER A 1 28 ? 21.174 21.137 16.090 1.00 25.34 ? ? ? ? ? ? 178 SER A C 1
ATOM 238 O O . SER A 1 28 ? 20.852 22.271 16.441 1.00 25.46 ? ? ? ? ? ? 178 SER A O 1
ATOM 239 C CB . SER A 1 28 ? 20.917 18.979 17.305 1.00 27.21 ? ? ? ? ? ? 178 SER A CB 1
ATOM 240 O OG . SER A 1 28 ? 19.638 19.408 17.741 1.00 28.73 ? ? ? ? ? ? 178 SER A OG 1
ATOM 241 N N . GLN A 1 29 ? 20.949 20.675 14.865 1.00 25.33 ? ? ? ? ? ? 179 GLN A N 1
ATOM 242 C CA . GLN A 1 29 ? 20.315 21.512 13.851 1.00 26.54 ? ? ? ? ? ? 179 GLN A CA 1
ATOM 243 C C . GLN A 1 29 ? 18.908 21.923 14.284 1.00 26.22 ? ? ? ? ? ? 179 GLN A C 1
ATOM 244 O O . GLN A 1 29 ? 18.539 23.095 14.184 1.00 25.82 ? ? ? ? ? ? 179 GLN A O 1
ATOM 245 C CB . GLN A 1 29 ? 20.262 20.791 12.500 1.00 27.45 ? ? ? ? ? ? 179 GLN A CB 1
ATOM 246 C CG . GLN A 1 29 ? 19.688 21.641 11.372 1.00 30.82 ? ? ? ? ? ? 179 GLN A CG 1
ATOM 247 C CD . GLN A 1 29 ? 20.414 22.968 11.212 1.00 32.89 ? ? ? ? ? ? 179 GLN A CD 1
ATOM 248 O OE1 . GLN A 1 29 ? 21.592 23.004 10.860 1.00 35.57 ? ? ? ? ? ? 179 GLN A OE1 1
ATOM 249 N NE2 . GLN A 1 29 ? 19.714 24.065 11.484 1.00 33.41 ? ? ? ? ? ? 179 GLN A NE2 1
ATOM 250 N N . GLU A 1 30 ? 18.136 20.955 14.773 1.00 25.12 ? ? ? ? ? ? 180 GLU A N 1
ATOM 251 C CA . GLU A 1 30 ? 16.775 21.211 15.233 1.00 23.89 ? ? ? ? ? ? 180 GLU A CA 1
ATOM 252 C C . GLU A 1 30 ? 16.738 22.240 16.354 1.00 21.11 ? ? ? ? ? ? 180 GLU A C 1
ATOM 253 O O . GLU A 1 30 ? 15.875 23.117 16.360 1.00 21.41 ? ? ? ? ? ? 180 GLU A O 1
ATOM 254 C CB . GLU A 1 30 ? 16.101 19.916 15.692 1.00 25.74 ? ? ? ? ? ? 180 GLU A CB 1
ATOM 255 C CG . GLU A 1 30 ? 15.478 19.100 14.569 1.00 28.45 ? ? ? ? ? ? 180 GLU A CG 1
ATOM 256 C CD . GLU A 1 30 ? 14.341 19.832 13.879 1.00 30.92 ? ? ? ? ? ? 180 GLU A CD 1
ATOM 257 O OE1 . GLU A 1 30 ? 13.247 19.935 14.473 1.00 30.77 ? ? ? ? ? ? 180 GLU A OE1 1
ATOM 258 O OE2 . GLU A 1 30 ? 14.542 20.307 12.743 1.00 33.92 ? ? ? ? ? ? 180 GLU A OE2 1
ATOM 259 N N . VAL A 1 31 ? 17.668 22.133 17.300 1.00 18.60 ? ? ? ? ? ? 181 VAL A N 1
ATOM 260 C CA . VAL A 1 31 ? 17.730 23.079 18.412 1.00 16.77 ? ? ? ? ? ? 181 VAL A CA 1
ATOM 261 C C . VAL A 1 31 ? 18.064 24.477 17.897 1.00 15.69 ? ? ? ? ? ? 181 VAL A C 1
ATOM 262 O O . VAL A 1 31 ? 17.491 25.467 18.352 1.00 14.15 ? ? ? ? ? ? 181 VAL A O 1
ATOM 263 C CB . VAL A 1 31 ? 18.754 22.639 19.484 1.00 17.20 ? ? ? ? ? ? 181 VAL A CB 1
ATOM 264 C CG1 . VAL A 1 31 ? 18.932 23.733 20.530 1.00 16.13 ? ? ? ? ? ? 181 VAL A CG1 1
ATOM 265 C CG2 . VAL A 1 31 ? 18.279 21.357 20.158 1.00 16.46 ? ? ? ? ? ? 181 VAL A CG2 1
ATOM 266 N N . LYS A 1 32 ? 18.971 24.552 16.929 1.00 16.09 ? ? ? ? ? ? 182 LYS A N 1
ATOM 267 C CA . LYS A 1 32 ? 19.343 25.835 16.344 1.00 18.00 ? ? ? ? ? ? 182 LYS A CA 1
ATOM 268 C C . LYS A 1 32 ? 18.126 26.477 15.685 1.00 17.05 ? ? ? ? ? ? 182 LYS A C 1
ATOM 269 O O . LYS A 1 32 ? 17.905 27.680 15.830 1.00 17.50 ? ? ? ? ? ? 182 LYS A O 1
ATOM 270 C CB . LYS A 1 32 ? 20.444 25.660 15.306 1.00 21.64 ? ? ? ? ? ? 182 LYS A CB 1
ATOM 271 C CG . LYS A 1 32 ? 21.777 25.239 15.874 1.00 26.20 ? ? ? ? ? ? 182 LYS A CG 1
ATOM 272 C CD . LYS A 1 32 ? 22.756 25.055 14.742 1.00 30.03 ? ? ? ? ? ? 182 LYS A CD 1
ATOM 273 C CE . LYS A 1 32 ? 24.069 24.517 15.226 1.00 32.54 ? ? ? ? ? ? 182 LYS A CE 1
ATOM 274 N NZ . LYS A 1 32 ? 24.913 24.222 14.047 1.00 35.96 ? ? ? ? ? ? 182 LYS A NZ 1
ATOM 275 N N . ASN A 1 33 ? 17.344 25.672 14.964 1.00 15.76 ? ? ? ? ? ? 183 ASN A N 1
ATOM 276 C CA . ASN A 1 33 ? 16.136 26.161 14.297 1.00 14.77 ? ? ? ? ? ? 183 ASN A CA 1
ATOM 277 C C . ASN A 1 33 ? 15.146 26.712 15.308 1.00 13.22 ? ? ? ? ? ? 183 ASN A C 1
ATOM 278 O O . ASN A 1 33 ? 14.599 27.791 15.108 1.00 12.70 ? ? ? ? ? ? 183 ASN A O 1
ATOM 279 C CB . ASN A 1 33 ? 15.468 25.055 13.475 1.00 17.37 ? ? ? ? ? ? 183 ASN A CB 1
ATOM 280 C CG . ASN A 1 33 ? 16.242 24.712 12.220 1.00 19.82 ? ? ? ? ? ? 183 ASN A CG 1
ATOM 281 O OD1 . ASN A 1 33 ? 17.164 25.430 11.828 1.00 21.79 ? ? ? ? ? ? 183 ASN A OD1 1
ATOM 282 N ND2 . ASN A 1 33 ? 15.865 23.613 11.576 1.00 21.82 ? ? ? ? ? ? 183 ASN A ND2 1
ATOM 283 N N . TRP A 1 34 ? 14.932 25.976 16.397 1.00 12.62 ? ? ? ? ? ? 184 TRP A N 1
ATOM 284 C CA . TRP A 1 34 ? 14.017 26.406 17.450 1.00 13.10 ? ? ? ? ? ? 184 TRP A CA 1
ATOM 285 C C . TRP A 1 34 ? 14.495 27.713 18.072 1.00 13.00 ? ? ? ? ? ? 184 TRP A C 1
ATOM 286 O O . TRP A 1 34 ? 13.700 28.624 18.299 1.00 13.80 ? ? ? ? ? ? 184 TRP A O 1
ATOM 287 C CB . TRP A 1 34 ? 13.904 25.342 18.545 1.00 14.02 ? ? ? ? ? ? 184 TRP A CB 1
ATOM 288 C CG . TRP A 1 34 ? 13.254 24.076 18.112 1.00 13.76 ? ? ? ? ? ? 184 TRP A CG 1
ATOM 289 C CD1 . TRP A 1 34 ? 12.332 23.924 17.121 1.00 16.29 ? ? ? ? ? ? 184 TRP A CD1 1
ATOM 290 C CD2 . TRP A 1 34 ? 13.484 22.772 18.655 1.00 13.62 ? ? ? ? ? ? 184 TRP A CD2 1
ATOM 291 N NE1 . TRP A 1 34 ? 11.975 22.601 17.007 1.00 16.57 ? ? ? ? ? ? 184 TRP A NE1 1
ATOM 292 C CE2 . TRP A 1 34 ? 12.666 21.873 17.937 1.00 14.79 ? ? ? ? ? ? 184 TRP A CE2 1
ATOM 293 C CE3 . TRP A 1 34 ? 14.303 22.276 19.678 1.00 15.00 ? ? ? ? ? ? 184 TRP A CE3 1
ATOM 294 C CZ2 . TRP A 1 34 ? 12.641 20.502 18.209 1.00 14.50 ? ? ? ? ? ? 184 TRP A CZ2 1
ATOM 295 C CZ3 . TRP A 1 34 ? 14.280 20.914 19.948 1.00 16.52 ? ? ? ? ? ? 184 TRP A CZ3 1
ATOM 296 C CH2 . TRP A 1 34 ? 13.452 20.042 19.213 1.00 15.43 ? ? ? ? ? ? 184 TRP A CH2 1
ATOM 297 N N . MSE A 1 35 ? 15.793 27.798 18.350 1.00 11.90 ? ? ? ? ? ? 185 MSE A N 1
ATOM 298 C CA . MSE A 1 35 ? 16.368 28.998 18.950 1.00 13.97 ? ? ? ? ? ? 185 MSE A CA 1
ATOM 299 C C . MSE A 1 35 ? 16.285 30.209 18.017 1.00 13.93 ? ? ? ? ? ? 185 MSE A C 1
ATOM 300 O O . MSE A 1 35 ? 16.053 31.336 18.468 1.00 14.45 ? ? ? ? ? ? 185 MSE A O 1
ATOM 301 C CB . MSE A 1 35 ? 17.815 28.731 19.367 1.00 16.20 ? ? ? ? ? ? 185 MSE A CB 1
ATOM 302 C CG . MSE A 1 35 ? 17.939 27.794 20.569 1.00 19.32 ? ? ? ? ? ? 185 MSE A CG 1
ATOM 303 SE SE . MSE A 1 35 ? 17.221 28.490 22.080 1.00 26.24 ? ? ? ? ? ? 185 MSE A SE 1
ATOM 304 C CE . MSE A 1 35 ? 18.427 29.800 22.392 1.00 27.06 ? ? ? ? ? ? 185 MSE A CE 1
ATOM 305 N N . THR A 1 36 ? 16.438 29.964 16.716 1.00 15.55 ? ? ? ? ? ? 186 THR A N 1
ATOM 306 C CA . THR A 1 36 ? 16.375 31.015 15.695 1.00 15.76 ? ? ? ? ? ? 186 THR A CA 1
ATOM 307 C C . THR A 1 36 ? 14.950 31.585 15.557 1.00 16.57 ? ? ? ? ? ? 186 THR A C 1
ATOM 308 O O . THR A 1 36 ? 14.778 32.797 15.378 1.00 16.24 ? ? ? ? ? ? 186 THR A O 1
ATOM 309 C CB . THR A 1 36 ? 16.869 30.474 14.331 1.00 15.03 ? ? ? ? ? ? 186 THR A CB 1
ATOM 310 O OG1 . THR A 1 36 ? 18.228 30.039 14.461 1.00 17.64 ? ? ? ? ? ? 186 THR A OG1 1
ATOM 311 C CG2 . THR A 1 36 ? 16.791 31.544 13.245 1.00 16.57 ? ? ? ? ? ? 186 THR A CG2 1
ATOM 312 N N . GLU A 1 37 ? 13.947 30.705 15.643 1.00 17.15 ? ? ? ? ? ? 187 GLU A N 1
ATOM 313 C CA . GLU A 1 37 ? 12.529 31.082 15.544 1.00 19.70 ? ? ? ? ? ? 187 GLU A CA 1
ATOM 314 C C . GLU A 1 37 ? 12.045 31.815 16.785 1.00 18.61 ? ? ? ? ? ? 187 GLU A C 1
ATOM 315 O O . GLU A 1 37 ? 11.151 32.654 16.700 1.00 22.06 ? ? ? ? ? ? 187 GLU A O 1
ATOM 316 C CB . GLU A 1 37 ? 11.625 29.849 15.408 1.00 22.78 ? ? ? ? ? ? 187 GLU A CB 1
ATOM 317 C CG . GLU A 1 37 ? 11.950 28.866 14.305 1.00 32.63 ? ? ? ? ? ? 187 GLU A CG 1
ATOM 318 C CD . GLU A 1 37 ? 11.054 27.634 14.345 1.00 36.18 ? ? ? ? ? ? 187 GLU A CD 1
ATOM 319 O OE1 . GLU A 1 37 ? 11.086 26.907 15.364 1.00 38.51 ? ? ? ? ? ? 187 GLU A OE1 1
ATOM 320 O OE2 . GLU A 1 37 ? 10.326 27.392 13.357 1.00 39.37 ? ? ? ? ? ? 187 GLU A OE2 1
ATOM 321 N N . THR A 1 38 ? 12.589 31.444 17.942 1.00 15.74 ? ? ? ? ? ? 188 THR A N 1
ATOM 322 C CA . THR A 1 38 ? 12.177 32.030 19.212 1.00 17.24 ? ? ? ? ? ? 188 THR A CA 1
ATOM 323 C C . THR A 1 38 ? 13.076 33.117 19.787 1.00 17.41 ? ? ? ? ? ? 188 THR A C 1
ATOM 324 O O . THR A 1 38 ? 12.888 34.301 19.504 1.00 18.17 ? ? ? ? ? ? 188 THR A O 1
ATOM 325 C CB . THR A 1 38 ? 11.978 30.936 20.287 1.00 17.93 ? ? ? ? ? ? 188 THR A CB 1
ATOM 326 O OG1 . THR A 1 38 ? 13.202 30.210 20.469 1.00 17.34 ? ? ? ? ? ? 188 THR A OG1 1
ATOM 327 C CG2 . THR A 1 38 ? 10.883 29.970 19.861 1.00 20.73 ? ? ? ? ? ? 188 THR A CG2 1
ATOM 328 N N . LEU A 1 39 ? 14.054 32.705 20.590 1.00 16.74 ? ? ? ? ? ? 189 LEU A N 1
ATOM 329 C CA . LEU A 1 39 ? 14.963 33.627 21.252 1.00 16.48 ? ? ? ? ? ? 189 LEU A CA 1
ATOM 330 C C . LEU A 1 39 ? 15.702 34.645 20.392 1.00 16.57 ? ? ? ? ? ? 189 LEU A C 1
ATOM 331 O O . LEU A 1 39 ? 15.846 35.795 20.805 1.00 17.08 ? ? ? ? ? ? 189 LEU A O 1
ATOM 332 C CB . LEU A 1 39 ? 15.935 32.864 22.153 1.00 17.33 ? ? ? ? ? ? 189 LEU A CB 1
ATOM 333 C CG . LEU A 1 39 ? 15.286 32.289 23.417 1.00 19.91 ? ? ? ? ? ? 189 LEU A CG 1
ATOM 334 C CD1 . LEU A 1 39 ? 16.327 31.647 24.304 1.00 20.68 ? ? ? ? ? ? 189 LEU A CD1 1
ATOM 335 C CD2 . LEU A 1 39 ? 14.580 33.396 24.183 1.00 21.69 ? ? ? ? ? ? 189 LEU A CD2 1
ATOM 336 N N . LEU A 1 40 ? 16.162 34.254 19.205 1.00 14.50 ? ? ? ? ? ? 190 LEU A N 1
ATOM 337 C CA . LEU A 1 40 ? 16.876 35.211 18.356 1.00 13.80 ? ? ? ? ? ? 190 LEU A CA 1
ATOM 338 C C . LEU A 1 40 ? 15.961 36.378 17.999 1.00 12.88 ? ? ? ? ? ? 190 LEU A C 1
ATOM 339 O O . LEU A 1 40 ? 16.391 37.528 17.968 1.00 13.57 ? ? ? ? ? ? 190 LEU A O 1
ATOM 340 C CB . LEU A 1 40 ? 17.402 34.552 17.078 1.00 12.31 ? ? ? ? ? ? 190 LEU A CB 1
ATOM 341 C CG . LEU A 1 40 ? 18.238 35.486 16.188 1.00 13.96 ? ? ? ? ? ? 190 LEU A CG 1
ATOM 342 C CD1 . LEU A 1 40 ? 19.553 35.825 16.881 1.00 10.69 ? ? ? ? ? ? 190 LEU A CD1 1
ATOM 343 C CD2 . LEU A 1 40 ? 18.506 34.834 14.842 1.00 13.74 ? ? ? ? ? ? 190 LEU A CD2 1
ATOM 344 N N . VAL A 1 41 ? 14.695 36.068 17.738 1.00 14.32 ? ? ? ? ? ? 191 VAL A N 1
ATOM 345 C CA . VAL A 1 41 ? 13.703 37.080 17.395 1.00 15.94 ? ? ? ? ? ? 191 VAL A CA 1
ATOM 346 C C . VAL A 1 41 ? 13.270 37.854 18.643 1.00 17.45 ? ? ? ? ? ? 191 VAL A C 1
ATOM 347 O O . VAL A 1 41 ? 13.262 39.086 18.649 1.00 17.31 ? ? ? ? ? ? 191 VAL A O 1
ATOM 348 C CB . VAL A 1 41 ? 12.460 36.438 16.718 1.00 14.52 ? ? ? ? ? ? 191 VAL A CB 1
ATOM 349 C CG1 . VAL A 1 41 ? 11.372 37.479 16.491 1.00 16.03 ? ? ? ? ? ? 191 VAL A CG1 1
ATOM 350 C CG2 . VAL A 1 41 ? 12.854 35.806 15.394 1.00 12.15 ? ? ? ? ? ? 191 VAL A CG2 1
ATOM 351 N N . GLN A 1 42 ? 12.954 37.119 19.706 1.00 18.93 ? ? ? ? ? ? 192 GLN A N 1
ATOM 352 C CA . GLN A 1 42 ? 12.503 37.705 20.967 1.00 20.68 ? ? ? ? ? ? 192 GLN A CA 1
ATOM 353 C C . GLN A 1 42 ? 13.541 38.565 21.682 1.00 19.53 ? ? ? ? ? ? 192 GLN A C 1
ATOM 354 O O . GLN A 1 42 ? 13.184 39.453 22.453 1.00 20.37 ? ? ? ? ? ? 192 GLN A O 1
ATOM 355 C CB . GLN A 1 42 ? 12.008 36.602 21.902 1.00 24.30 ? ? ? ? ? ? 192 GLN A CB 1
ATOM 356 C CG . GLN A 1 42 ? 10.830 35.818 21.343 1.00 31.13 ? ? ? ? ? ? 192 GLN A CG 1
ATOM 357 C CD . GLN A 1 42 ? 10.505 34.578 22.155 1.00 34.16 ? ? ? ? ? ? 192 GLN A CD 1
ATOM 358 O OE1 . GLN A 1 42 ? 10.626 34.568 23.385 1.00 36.09 ? ? ? ? ? ? 192 GLN A OE1 1
ATOM 359 N NE2 . GLN A 1 42 ? 10.093 33.520 21.466 1.00 35.17 ? ? ? ? ? ? 192 GLN A NE2 1
ATOM 360 N N . ASN A 1 43 ? 14.820 38.291 21.445 1.00 18.18 ? ? ? ? ? ? 193 ASN A N 1
ATOM 361 C CA . ASN A 1 43 ? 15.887 39.056 22.080 1.00 15.97 ? ? ? ? ? ? 193 ASN A CA 1
ATOM 362 C C . ASN A 1 43 ? 16.443 40.164 21.189 1.00 16.56 ? ? ? ? ? ? 193 ASN A C 1
ATOM 363 O O . ASN A 1 43 ? 17.416 40.823 21.548 1.00 14.79 ? ? ? ? ? ? 193 ASN A O 1
ATOM 364 C CB . ASN A 1 43 ? 17.014 38.130 22.538 1.00 15.75 ? ? ? ? ? ? 193 ASN A CB 1
ATOM 365 C CG . ASN A 1 43 ? 16.627 37.286 23.738 1.00 16.38 ? ? ? ? ? ? 193 ASN A CG 1
ATOM 366 O OD1 . ASN A 1 43 ? 15.451 37.192 24.094 1.00 16.52 ? ? ? ? ? ? 193 ASN A OD1 1
ATOM 367 N ND2 . ASN A 1 43 ? 17.619 36.681 24.378 1.00 15.95 ? ? ? ? ? ? 193 ASN A ND2 1
ATOM 368 N N . ALA A 1 44 ? 15.830 40.353 20.023 1.00 16.07 ? ? ? ? ? ? 194 ALA A N 1
ATOM 369 C CA . ALA A 1 44 ? 16.248 41.392 19.084 1.00 16.92 ? ? ? ? ? ? 194 ALA A CA 1
ATOM 370 C C . ALA A 1 44 ? 15.758 42.759 19.582 1.00 18.37 ? ? ? ? ? ? 194 ALA A C 1
ATOM 371 O O . ALA A 1 44 ? 14.809 42.834 20.368 1.00 17.63 ? ? ? ? ? ? 194 ALA A O 1
ATOM 372 C CB . ALA A 1 44 ? 15.689 41.097 17.701 1.00 13.98 ? ? ? ? ? ? 194 ALA A CB 1
ATOM 373 N N . ASN A 1 45 ? 16.404 43.837 19.140 1.00 18.93 ? ? ? ? ? ? 195 ASN A N 1
ATOM 374 C CA . ASN A 1 45 ? 16.005 45.172 19.582 1.00 19.84 ? ? ? ? ? ? 195 ASN A CA 1
ATOM 375 C C . ASN A 1 45 ? 14.639 45.580 19.015 1.00 22.01 ? ? ? ? ? ? 195 ASN A C 1
ATOM 376 O O . ASN A 1 45 ? 14.122 44.928 18.111 1.00 20.95 ? ? ? ? ? ? 195 ASN A O 1
ATOM 377 C CB . ASN A 1 45 ? 17.109 46.213 19.295 1.00 17.93 ? ? ? ? ? ? 195 ASN A CB 1
ATOM 378 C CG . ASN A 1 45 ? 17.396 46.399 17.818 1.00 16.61 ? ? ? ? ? ? 195 ASN A CG 1
ATOM 379 O OD1 . ASN A 1 45 ? 16.559 46.131 16.960 1.00 20.76 ? ? ? ? ? ? 195 ASN A OD1 1
ATOM 380 N ND2 . ASN A 1 45 ? 18.588 46.890 17.519 1.00 17.86 ? ? ? ? ? ? 195 ASN A ND2 1
ATOM 381 N N . PRO A 1 46 ? 14.018 46.635 19.574 1.00 24.87 ? ? ? ? ? ? 196 PRO A N 1
ATOM 382 C CA . PRO A 1 46 ? 12.706 47.128 19.133 1.00 26.26 ? ? ? ? ? ? 196 PRO A CA 1
ATOM 383 C C . PRO A 1 46 ? 12.516 47.250 17.620 1.00 27.28 ? ? ? ? ? ? 196 PRO A C 1
ATOM 384 O O . PRO A 1 46 ? 11.536 46.743 17.073 1.00 28.19 ? ? ? ? ? ? 196 PRO A O 1
ATOM 385 C CB . PRO A 1 46 ? 12.617 48.485 19.822 1.00 26.56 ? ? ? ? ? ? 196 PRO A CB 1
ATOM 386 C CG . PRO A 1 46 ? 13.288 48.219 21.117 1.00 25.02 ? ? ? ? ? ? 196 PRO A CG 1
ATOM 387 C CD . PRO A 1 46 ? 14.522 47.454 20.693 1.00 24.81 ? ? ? ? ? ? 196 PRO A CD 1
ATOM 388 N N . ASP A 1 47 ? 13.454 47.913 16.952 1.00 28.53 ? ? ? ? ? ? 197 ASP A N 1
ATOM 389 C CA . ASP A 1 47 ? 13.383 48.098 15.506 1.00 29.38 ? ? ? ? ? ? 197 ASP A CA 1
ATOM 390 C C . ASP A 1 47 ? 13.351 46.786 14.733 1.00 28.53 ? ? ? ? ? ? 197 ASP A C 1
ATOM 391 O O . ASP A 1 47 ? 12.406 46.515 13.991 1.00 29.43 ? ? ? ? ? ? 197 ASP A O 1
ATOM 392 C CB . ASP A 1 47 ? 14.564 48.939 15.018 1.00 32.68 ? ? ? ? ? ? 197 ASP A CB 1
ATOM 393 C CG . ASP A 1 47 ? 14.482 50.380 15.475 1.00 36.01 ? ? ? ? ? ? 197 ASP A CG 1
ATOM 394 O OD1 . ASP A 1 47 ? 13.353 50.889 15.662 1.00 37.27 ? ? ? ? ? ? 197 ASP A OD1 1
ATOM 395 O OD2 . ASP A 1 47 ? 15.552 51.007 15.637 1.00 39.13 ? ? ? ? ? ? 197 ASP A OD2 1
ATOM 396 N N . CYS A 1 48 ? 14.378 45.967 14.932 1.00 25.72 ? ? ? ? ? ? 198 CYS A N 1
ATOM 397 C CA . CYS A 1 48 ? 14.488 44.687 14.241 1.00 24.21 ? ? ? ? ? ? 198 CYS A CA 1
ATOM 398 C C . CYS A 1 48 ? 13.443 43.638 14.633 1.00 22.75 ? ? ? ? ? ? 198 CYS A C 1
ATOM 399 O O . CYS A 1 48 ? 12.968 42.886 13.783 1.00 22.43 ? ? ? ? ? ? 198 CYS A O 1
ATOM 400 C CB . CYS A 1 48 ? 15.902 44.124 14.411 1.00 21.40 ? ? ? ? ? ? 198 CYS A CB 1
ATOM 401 S SG . CYS A 1 48 ? 16.144 42.477 13.674 1.00 23.23 ? ? ? ? ? ? 198 CYS A SG 1
ATOM 402 N N . LYS A 1 49 ? 13.061 43.612 15.907 1.00 22.97 ? ? ? ? ? ? 199 LYS A N 1
ATOM 403 C CA . LYS A 1 49 ? 12.087 42.641 16.402 1.00 22.51 ? ? ? ? ? ? 199 LYS A CA 1
ATOM 404 C C . LYS A 1 49 ? 10.746 42.686 15.673 1.00 23.08 ? ? ? ? ? ? 199 LYS A C 1
ATOM 405 O O . LYS A 1 49 ? 10.157 41.641 15.386 1.00 22.88 ? ? ? ? ? ? 199 LYS A O 1
ATOM 406 C CB . LYS A 1 49 ? 11.879 42.818 17.907 1.00 21.78 ? ? ? ? ? ? 199 LYS A CB 1
ATOM 407 C CG . LYS A 1 49 ? 11.014 41.753 18.541 1.00 21.47 ? ? ? ? ? ? 199 LYS A CG 1
ATOM 408 C CD . LYS A 1 49 ? 11.003 41.892 20.045 1.00 24.48 ? ? ? ? ? ? 199 LYS A CD 1
ATOM 409 C CE . LYS A 1 49 ? 10.171 40.797 20.670 1.00 26.88 ? ? ? ? ? ? 199 LYS A CE 1
ATOM 410 N NZ . LYS A 1 49 ? 10.269 40.823 22.154 1.00 29.75 ? ? ? ? ? ? 199 LYS A NZ 1
ATOM 411 N N . THR A 1 50 ? 10.273 43.892 15.369 1.00 23.51 ? ? ? ? ? ? 200 THR A N 1
ATOM 412 C CA . THR A 1 50 ? 9.002 44.065 14.665 1.00 25.81 ? ? ? ? ? ? 200 THR A CA 1
ATOM 413 C C . THR A 1 50 ? 9.101 43.494 13.251 1.00 24.75 ? ? ? ? ? ? 200 THR A C 1
ATOM 414 O O . THR A 1 50 ? 8.227 42.753 12.799 1.00 24.72 ? ? ? ? ? ? 200 THR A O 1
ATOM 415 C CB . THR A 1 50 ? 8.612 45.551 14.577 1.00 27.33 ? ? ? ? ? ? 200 THR A CB 1
ATOM 416 O OG1 . THR A 1 50 ? 8.611 46.122 15.892 1.00 28.04 ? ? ? ? ? ? 200 THR A OG1 1
ATOM 417 C CG2 . THR A 1 50 ? 7.224 45.702 13.961 1.00 28.16 ? ? ? ? ? ? 200 THR A CG2 1
ATOM 418 N N . ILE A 1 51 ? 10.191 43.835 12.574 1.00 23.98 ? ? ? ? ? ? 201 ILE A N 1
ATOM 419 C CA . ILE A 1 51 ? 10.458 43.373 11.221 1.00 22.55 ? ? ? ? ? ? 201 ILE A CA 1
ATOM 420 C C . ILE A 1 51 ? 10.518 41.848 11.161 1.00 22.09 ? ? ? ? ? ? 201 ILE A C 1
ATOM 421 O O . ILE A 1 51 ? 9.916 41.229 10.284 1.00 21.81 ? ? ? ? ? ? 201 ILE A O 1
ATOM 422 C CB . ILE A 1 51 ? 11.791 43.960 10.721 1.00 23.07 ? ? ? ? ? ? 201 ILE A CB 1
ATOM 423 C CG1 . ILE A 1 51 ? 11.677 45.481 10.620 1.00 23.41 ? ? ? ? ? ? 201 ILE A CG1 1
ATOM 424 C CG2 . ILE A 1 51 ? 12.184 43.356 9.389 1.00 22.61 ? ? ? ? ? ? 201 ILE A CG2 1
ATOM 425 C CD1 . ILE A 1 51 ? 12.967 46.169 10.250 1.00 25.93 ? ? ? ? ? ? 201 ILE A CD1 1
ATOM 426 N N . LEU A 1 52 ? 11.222 41.249 12.117 1.00 21.32 ? ? ? ? ? ? 202 LEU A N 1
ATOM 427 C CA . LEU A 1 52 ? 11.377 39.801 12.170 1.00 21.25 ? ? ? ? ? ? 202 LEU A CA 1
ATOM 428 C C . LEU A 1 52 ? 10.082 39.036 12.412 1.00 23.50 ? ? ? ? ? ? 202 LEU A C 1
ATOM 429 O O . LEU A 1 52 ? 9.885 37.956 11.855 1.00 24.38 ? ? ? ? ? ? 202 LEU A O 1
ATOM 430 C CB . LEU A 1 52 ? 12.416 39.416 13.221 1.00 19.31 ? ? ? ? ? ? 202 LEU A CB 1
ATOM 431 C CG . LEU A 1 52 ? 13.824 39.939 12.950 1.00 16.32 ? ? ? ? ? ? 202 LEU A CG 1
ATOM 432 C CD1 . LEU A 1 52 ? 14.764 39.438 14.027 1.00 15.31 ? ? ? ? ? ? 202 LEU A CD1 1
ATOM 433 C CD2 . LEU A 1 52 ? 14.287 39.491 11.575 1.00 17.16 ? ? ? ? ? ? 202 LEU A CD2 1
ATOM 434 N N . LYS A 1 53 ? 9.214 39.575 13.261 1.00 25.33 ? ? ? ? ? ? 203 LYS A N 1
ATOM 435 C CA . LYS A 1 53 ? 7.937 38.927 13.546 1.00 28.13 ? ? ? ? ? ? 203 LYS A CA 1
ATOM 436 C C . LYS A 1 53 ? 7.048 38.954 12.303 1.00 30.02 ? ? ? ? ? ? 203 LYS A C 1
ATOM 437 O O . LYS A 1 53 ? 6.294 38.011 12.044 1.00 30.66 ? ? ? ? ? ? 203 LYS A O 1
ATOM 438 C CB . LYS A 1 53 ? 7.230 39.620 14.712 1.00 28.40 ? ? ? ? ? ? 203 LYS A CB 1
ATOM 439 C CG . LYS A 1 53 ? 7.828 39.324 16.085 1.00 27.94 ? ? ? ? ? ? 203 LYS A CG 1
ATOM 440 C CD . LYS A 1 53 ? 7.618 37.867 16.471 0.00 28.06 ? ? ? ? ? ? 203 LYS A CD 1
ATOM 441 C CE . LYS A 1 53 ? 8.090 37.590 17.889 0.00 28.00 ? ? ? ? ? ? 203 LYS A CE 1
ATOM 442 N NZ . LYS A 1 53 ? 7.916 36.158 18.262 0.00 28.04 ? ? ? ? ? ? 203 LYS A NZ 1
ATOM 443 N N . ALA A 1 54 ? 7.189 40.020 11.516 1.00 30.84 ? ? ? ? ? ? 204 ALA A N 1
ATOM 444 C CA . ALA A 1 54 ? 6.419 40.213 10.290 1.00 31.07 ? ? ? ? ? ? 204 ALA A CA 1
ATOM 445 C C . ALA A 1 54 ? 6.871 39.332 9.117 1.00 32.46 ? ? ? ? ? ? 204 ALA A C 1
ATOM 446 O O . ALA A 1 54 ? 6.391 39.495 7.991 1.00 33.68 ? ? ? ? ? ? 204 ALA A O 1
ATOM 447 C CB . ALA A 1 54 ? 6.449 41.683 9.885 1.00 30.70 ? ? ? ? ? ? 204 ALA A CB 1
ATOM 448 N N . LEU A 1 55 ? 7.815 38.428 9.369 1.00 31.38 ? ? ? ? ? ? 205 LEU A N 1
ATOM 449 C CA . LEU A 1 55 ? 8.305 37.528 8.328 1.00 30.07 ? ? ? ? ? ? 205 LEU A CA 1
ATOM 450 C C . LEU A 1 55 ? 7.481 36.243 8.312 1.00 30.06 ? ? ? ? ? ? 205 LEU A C 1
ATOM 451 O O . LEU A 1 55 ? 7.371 35.579 7.281 1.00 31.24 ? ? ? ? ? ? 205 LEU A O 1
ATOM 452 C CB . LEU A 1 55 ? 9.788 37.196 8.539 1.00 29.91 ? ? ? ? ? ? 205 LEU A CB 1
ATOM 453 C CG . LEU A 1 55 ? 10.832 38.299 8.323 1.00 27.95 ? ? ? ? ? ? 205 LEU A CG 1
ATOM 454 C CD1 . LEU A 1 55 ? 12.217 37.767 8.660 1.00 27.73 ? ? ? ? ? ? 205 LEU A CD1 1
ATOM 455 C CD2 . LEU A 1 55 ? 10.789 38.797 6.888 1.00 26.18 ? ? ? ? ? ? 205 LEU A CD2 1
ATOM 456 N N . GLY A 1 56 ? 6.886 35.909 9.455 1.00 28.82 ? ? ? ? ? ? 206 GLY A N 1
ATOM 457 C CA . GLY A 1 56 ? 6.080 34.704 9.548 1.00 26.90 ? ? ? ? ? ? 206 GLY A CA 1
ATOM 458 C C . GLY A 1 56 ? 6.922 33.478 9.835 1.00 27.00 ? ? ? ? ? ? 206 GLY A C 1
ATOM 459 O O . GLY A 1 56 ? 8.149 33.569 9.881 1.00 27.32 ? ? ? ? ? ? 206 GLY A O 1
ATOM 460 N N . PRO A 1 57 ? 6.294 32.310 10.042 1.00 27.00 ? ? ? ? ? ? 207 PRO A N 1
ATOM 461 C CA . PRO A 1 57 ? 7.024 31.068 10.328 1.00 26.75 ? ? ? ? ? ? 207 PRO A CA 1
ATOM 462 C C . PRO A 1 57 ? 7.912 30.540 9.197 1.00 25.01 ? ? ? ? ? ? 207 PRO A C 1
ATOM 463 O O . PRO A 1 57 ? 7.680 30.812 8.017 1.00 24.67 ? ? ? ? ? ? 207 PRO A O 1
ATOM 464 C CB . PRO A 1 57 ? 5.901 30.083 10.675 1.00 27.70 ? ? ? ? ? ? 207 PRO A CB 1
ATOM 465 C CG . PRO A 1 57 ? 4.734 30.601 9.890 1.00 27.32 ? ? ? ? ? ? 207 PRO A CG 1
ATOM 466 C CD . PRO A 1 57 ? 4.839 32.090 10.112 1.00 28.17 ? ? ? ? ? ? 207 PRO A CD 1
ATOM 467 N N . GLY A 1 58 ? 8.952 29.808 9.585 1.00 23.60 ? ? ? ? ? ? 208 GLY A N 1
ATOM 468 C CA . GLY A 1 58 ? 9.861 29.227 8.617 1.00 22.39 ? ? ? ? ? ? 208 GLY A CA 1
ATOM 469 C C . GLY A 1 58 ? 10.886 30.161 8.004 1.00 21.37 ? ? ? ? ? ? 208 GLY A C 1
ATOM 470 O O . GLY A 1 58 ? 11.642 29.736 7.130 1.00 22.27 ? ? ? ? ? ? 208 GLY A O 1
ATOM 471 N N . ALA A 1 59 ? 10.910 31.423 8.429 1.00 20.71 ? ? ? ? ? ? 209 ALA A N 1
ATOM 472 C CA . ALA A 1 59 ? 11.884 32.382 7.900 1.00 19.17 ? ? ? ? ? ? 209 ALA A CA 1
ATOM 473 C C . ALA A 1 59 ? 13.285 31.936 8.311 1.00 18.52 ? ? ? ? ? ? 209 ALA A C 1
ATOM 474 O O . ALA A 1 59 ? 13.524 31.614 9.478 1.00 18.84 ? ? ? ? ? ? 209 ALA A O 1
ATOM 475 C CB . ALA A 1 59 ? 11.599 33.779 8.428 1.00 18.69 ? ? ? ? ? ? 209 ALA A CB 1
ATOM 476 N N . THR A 1 60 ? 14.199 31.887 7.347 1.00 15.99 ? ? ? ? ? ? 210 THR A N 1
ATOM 477 C CA . THR A 1 60 ? 15.563 31.458 7.625 1.00 16.19 ? ? ? ? ? ? 210 THR A CA 1
ATOM 478 C C . THR A 1 60 ? 16.391 32.562 8.265 1.00 15.24 ? ? ? ? ? ? 210 THR A C 1
ATOM 479 O O . THR A 1 60 ? 16.022 33.735 8.212 1.00 14.97 ? ? ? ? ? ? 210 THR A O 1
ATOM 480 C CB . THR A 1 60 ? 16.290 31.000 6.345 1.00 16.78 ? ? ? ? ? ? 210 THR A CB 1
ATOM 481 O OG1 . THR A 1 60 ? 16.498 32.124 5.479 1.00 17.67 ? ? ? ? ? ? 210 THR A OG1 1
ATOM 482 C CG2 . THR A 1 60 ? 15.473 29.943 5.616 1.00 18.07 ? ? ? ? ? ? 210 THR A CG2 1
ATOM 483 N N . LEU A 1 61 ? 17.509 32.169 8.871 1.00 13.73 ? ? ? ? ? ? 211 LEU A N 1
ATOM 484 C CA . LEU A 1 61 ? 18.426 33.111 9.499 1.00 12.88 ? ? ? ? ? ? 211 LEU A CA 1
ATOM 485 C C . LEU A 1 61 ? 18.875 34.122 8.447 1.00 15.07 ? ? ? ? ? ? 211 LEU A C 1
ATOM 486 O O . LEU A 1 61 ? 19.012 35.308 8.739 1.00 15.69 ? ? ? ? ? ? 211 LEU A O 1
ATOM 487 C CB . LEU A 1 61 ? 19.645 32.369 10.045 1.00 11.67 ? ? ? ? ? ? 211 LEU A CB 1
ATOM 488 C CG . LEU A 1 61 ? 20.773 33.233 10.603 1.00 11.35 ? ? ? ? ? ? 211 LEU A CG 1
ATOM 489 C CD1 . LEU A 1 61 ? 20.264 34.065 11.765 1.00 11.67 ? ? ? ? ? ? 211 LEU A CD1 1
ATOM 490 C CD2 . LEU A 1 61 ? 21.920 32.342 11.045 1.00 12.84 ? ? ? ? ? ? 211 LEU A CD2 1
ATOM 491 N N . GLU A 1 62 ? 19.082 33.643 7.221 1.00 14.89 ? ? ? ? ? ? 212 GLU A N 1
ATOM 492 C CA . GLU A 1 62 ? 19.510 34.489 6.111 1.00 16.56 ? ? ? ? ? ? 212 GLU A CA 1
ATOM 493 C C . GLU A 1 62 ? 18.471 35.569 5.808 1.00 16.12 ? ? ? ? ? ? 212 GLU A C 1
ATOM 494 O O . GLU A 1 62 ? 18.816 36.740 5.636 1.00 14.41 ? ? ? ? ? ? 212 GLU A O 1
ATOM 495 C CB . GLU A 1 62 ? 19.784 33.638 4.863 1.00 19.36 ? ? ? ? ? ? 212 GLU A CB 1
ATOM 496 C CG . GLU A 1 62 ? 21.035 32.751 4.953 1.00 24.84 ? ? ? ? ? ? 212 GLU A CG 1
ATOM 497 C CD . GLU A 1 62 ? 20.954 31.668 6.033 1.00 29.36 ? ? ? ? ? ? 212 GLU A CD 1
ATOM 498 O OE1 . GLU A 1 62 ? 19.902 30.999 6.155 1.00 27.99 ? ? ? ? ? ? 212 GLU A OE1 1
ATOM 499 O OE2 . GLU A 1 62 ? 21.955 31.483 6.762 1.00 31.94 ? ? ? ? ? ? 212 GLU A OE2 1
ATOM 500 N N . GLU A 1 63 ? 17.199 35.173 5.771 1.00 14.31 ? ? ? ? ? ? 213 GLU A N 1
ATOM 501 C CA . GLU A 1 63 ? 16.109 36.113 5.512 1.00 15.24 ? ? ? ? ? ? 213 GLU A CA 1
ATOM 502 C C . GLU A 1 63 ? 16.001 37.117 6.660 1.00 14.13 ? ? ? ? ? ? 213 GLU A C 1
ATOM 503 O O . GLU A 1 63 ? 15.690 38.289 6.438 1.00 12.96 ? ? ? ? ? ? 213 GLU A O 1
ATOM 504 C CB . GLU A 1 63 ? 14.787 35.364 5.300 1.00 17.00 ? ? ? ? ? ? 213 GLU A CB 1
ATOM 505 C CG . GLU A 1 63 ? 14.776 34.514 4.026 1.00 19.68 ? ? ? ? ? ? 213 GLU A CG 1
ATOM 506 C CD . GLU A 1 63 ? 13.539 33.638 3.893 1.00 21.17 ? ? ? ? ? ? 213 GLU A CD 1
ATOM 507 O OE1 . GLU A 1 63 ? 13.220 32.890 4.838 1.00 20.24 ? ? ? ? ? ? 213 GLU A OE1 1
ATOM 508 O OE2 . GLU A 1 63 ? 12.888 33.683 2.829 1.00 25.47 ? ? ? ? ? ? 213 GLU A OE2 1
ATOM 509 N N . MSE A 1 64 ? 16.301 36.659 7.877 1.00 13.37 ? ? ? ? ? ? 214 MSE A N 1
ATOM 510 C CA . MSE A 1 64 ? 16.274 37.519 9.059 1.00 12.33 ? ? ? ? ? ? 214 MSE A CA 1
ATOM 511 C C . MSE A 1 64 ? 17.413 38.530 8.956 1.00 11.56 ? ? ? ? ? ? 214 MSE A C 1
ATOM 512 O O . MSE A 1 64 ? 17.209 39.721 9.177 1.00 12.28 ? ? ? ? ? ? 214 MSE A O 1
ATOM 513 C CB . MSE A 1 64 ? 16.429 36.699 10.346 1.00 11.82 ? ? ? ? ? ? 214 MSE A CB 1
ATOM 514 C CG . MSE A 1 64 ? 15.284 35.728 10.626 1.00 14.91 ? ? ? ? ? ? 214 MSE A CG 1
ATOM 515 SE SE . MSE A 1 64 ? 15.332 35.046 12.310 1.00 17.52 ? ? ? ? ? ? 214 MSE A SE 1
ATOM 516 C CE . MSE A 1 64 ? 13.844 34.046 12.296 1.00 16.42 ? ? ? ? ? ? 214 MSE A CE 1
ATOM 517 N N . MSE A 1 65 ? 18.606 38.055 8.603 1.00 10.35 ? ? ? ? ? ? 215 MSE A N 1
ATOM 518 C CA . MSE A 1 65 ? 19.764 38.935 8.460 1.00 11.55 ? ? ? ? ? ? 215 MSE A CA 1
ATOM 519 C C . MSE A 1 65 ? 19.548 39.953 7.340 1.00 11.81 ? ? ? ? ? ? 215 MSE A C 1
ATOM 520 O O . MSE A 1 65 ? 19.922 41.116 7.471 1.00 12.78 ? ? ? ? ? ? 215 MSE A O 1
ATOM 521 C CB . MSE A 1 65 ? 21.047 38.127 8.220 1.00 11.17 ? ? ? ? ? ? 215 MSE A CB 1
ATOM 522 C CG . MSE A 1 65 ? 21.507 37.319 9.432 1.00 13.26 ? ? ? ? ? ? 215 MSE A CG 1
ATOM 523 SE SE . MSE A 1 65 ? 23.105 36.476 9.199 1.00 20.46 ? ? ? ? ? ? 215 MSE A SE 1
ATOM 524 C CE . MSE A 1 65 ? 22.645 35.192 8.071 1.00 15.69 ? ? ? ? ? ? 215 MSE A CE 1
ATOM 525 N N . THR A 1 66 ? 18.915 39.521 6.253 1.00 11.79 ? ? ? ? ? ? 216 THR A N 1
ATOM 526 C CA . THR A 1 66 ? 18.636 40.413 5.133 1.00 13.57 ? ? ? ? ? ? 216 THR A CA 1
ATOM 527 C C . THR A 1 66 ? 17.640 41.485 5.571 1.00 14.27 ? ? ? ? ? ? 216 THR A C 1
ATOM 528 O O . THR A 1 66 ? 17.807 42.666 5.263 1.00 14.93 ? ? ? ? ? ? 216 THR A O 1
ATOM 529 C CB . THR A 1 66 ? 18.050 39.641 3.929 1.00 13.53 ? ? ? ? ? ? 216 THR A CB 1
ATOM 530 O OG1 . THR A 1 66 ? 18.998 38.664 3.483 1.00 12.21 ? ? ? ? ? ? 216 THR A OG1 1
ATOM 531 C CG2 . THR A 1 66 ? 17.730 40.596 2.778 1.00 14.56 ? ? ? ? ? ? 216 THR A CG2 1
ATOM 532 N N . ALA A 1 67 ? 16.631 41.064 6.328 1.00 14.20 ? ? ? ? ? ? 217 ALA A N 1
ATOM 533 C CA . ALA A 1 67 ? 15.593 41.963 6.816 1.00 14.19 ? ? ? ? ? ? 217 ALA A CA 1
ATOM 534 C C . ALA A 1 67 ? 16.104 43.052 7.759 1.00 13.96 ? ? ? ? ? ? 217 ALA A C 1
ATOM 535 O O . ALA A 1 67 ? 15.685 44.202 7.659 1.00 13.90 ? ? ? ? ? ? 217 ALA A O 1
ATOM 536 C CB . ALA A 1 67 ? 14.486 41.158 7.488 1.00 13.87 ? ? ? ? ? ? 217 ALA A CB 1
ATOM 537 N N . CYS A 1 68 ? 17.033 42.701 8.645 1.00 14.68 ? ? ? ? ? ? 218 CYS A N 1
ATOM 538 C CA . CYS A 1 68 ? 17.572 43.657 9.613 1.00 15.55 ? ? ? ? ? ? 218 CYS A CA 1
ATOM 539 C C . CYS A 1 68 ? 18.985 44.159 9.339 1.00 16.84 ? ? ? ? ? ? 218 CYS A C 1
ATOM 540 O O . CYS A 1 68 ? 19.634 44.683 10.245 1.00 17.92 ? ? ? ? ? ? 218 CYS A O 1
ATOM 541 C CB . CYS A 1 68 ? 17.525 43.060 11.021 1.00 16.55 ? ? ? ? ? ? 218 CYS A CB 1
ATOM 542 S SG . CYS A 1 68 ? 15.855 42.777 11.680 1.00 18.79 ? ? ? ? ? ? 218 CYS A SG 1
ATOM 543 N N . GLN A 1 69 ? 19.451 44.037 8.099 1.00 17.89 ? ? ? ? ? ? 219 GLN A N 1
ATOM 544 C CA . GLN A 1 69 ? 20.802 44.479 7.755 1.00 18.32 ? ? ? ? ? ? 219 GLN A CA 1
ATOM 545 C C . GLN A 1 69 ? 21.001 45.986 7.940 1.00 20.96 ? ? ? ? ? ? 219 GLN A C 1
ATOM 546 O O . GLN A 1 69 ? 20.066 46.772 7.786 1.00 18.54 ? ? ? ? ? ? 219 GLN A O 1
ATOM 547 C CB . GLN A 1 69 ? 21.152 44.074 6.323 1.00 17.21 ? ? ? ? ? ? 219 GLN A CB 1
ATOM 548 C CG . GLN A 1 69 ? 20.421 44.863 5.251 1.00 18.39 ? ? ? ? ? ? 219 GLN A CG 1
ATOM 549 C CD . GLN A 1 69 ? 20.725 44.362 3.860 1.00 14.75 ? ? ? ? ? ? 219 GLN A CD 1
ATOM 550 O OE1 . GLN A 1 69 ? 21.768 44.673 3.288 1.00 14.70 ? ? ? ? ? ? 219 GLN A OE1 1
ATOM 551 N NE2 . GLN A 1 69 ? 19.817 43.572 3.311 1.00 14.97 ? ? ? ? ? ? 219 GLN A NE2 1
ATOM 552 N N . GLY A 1 70 ? 22.226 46.374 8.287 1.00 25.08 ? ? ? ? ? ? 220 GLY A N 1
ATOM 553 C CA . GLY A 1 70 ? 22.536 47.781 8.491 1.00 31.02 ? ? ? ? ? ? 220 GLY A CA 1
ATOM 554 C C . GLY A 1 70 ? 23.683 48.032 9.461 1.00 34.02 ? ? ? ? ? ? 220 GLY A C 1
ATOM 555 O O . GLY A 1 70 ? 24.328 47.057 9.907 1.00 37.36 ? ? ? ? ? ? 220 GLY A O 1
ATOM 556 O OXT . GLY A 1 70 ? 23.949 49.212 9.776 1.00 35.95 ? ? ? ? ? ? 220 GLY A OXT 1
HETATM 557 O O . HOH B 2 . ? 15.165 37.722 1.767 1.00 17.71 ? ? ? ? ? ? 1000 HOH A O 1
HETATM 558 O O . HOH B 2 . ? 19.774 39.105 29.335 1.00 14.76 ? ? ? ? ? ? 1001 HOH A O 1
HETATM 559 O O . HOH B 2 . ? 22.152 41.230 9.295 1.00 12.50 ? ? ? ? ? ? 1002 HOH A O 1
HETATM 560 O O . HOH B 2 . ? 12.938 36.120 1.368 1.00 20.01 ? ? ? ? ? ? 1003 HOH A O 1
HETATM 561 O O . HOH B 2 . ? 23.499 43.387 10.442 1.00 11.86 ? ? ? ? ? ? 1004 HOH A O 1
HETATM 562 O O . HOH B 2 . ? 17.568 32.010 2.812 1.00 41.17 ? ? ? ? ? ? 1005 HOH A O 1
HETATM 563 O O . HOH B 2 . ? 13.544 42.152 23.067 1.00 44.74 ? ? ? ? ? ? 1006 HOH A O 1
HETATM 564 O O . HOH B 2 . ? 15.524 51.867 21.467 1.00 25.06 ? ? ? ? ? ? 1007 HOH A O 1
HETATM 565 O O . HOH B 2 . ? 31.249 29.077 22.178 1.00 32.20 ? ? ? ? ? ? 1008 HOH A O 1
HETATM 566 O O . HOH B 2 . ? 11.999 37.653 3.633 1.00 22.01 ? ? ? ? ? ? 1009 HOH A O 1
HETATM 567 O O . HOH B 2 . ? 14.511 39.069 4.067 1.00 13.97 ? ? ? ? ? ? 1010 HOH A O 1
HETATM 568 O O . HOH B 2 . ? 7.439 39.671 4.171 1.00 29.20 ? ? ? ? ? ? 1011 HOH A O 1
HETATM 569 O O . HOH B 2 . ? 19.303 38.158 0.364 1.00 16.18 ? ? ? ? ? ? 1012 HOH A O 1
HETATM 570 O O . HOH B 2 . ? 17.114 46.823 7.498 1.00 37.24 ? ? ? ? ? ? 1013 HOH A O 1
HETATM 571 O O . HOH B 2 . ? 21.867 45.557 11.341 1.00 18.21 ? ? ? ? ? ? 1014 HOH A O 1
HETATM 572 O O . HOH B 2 . ? 17.573 36.347 2.076 1.00 26.66 ? ? ? ? ? ? 1015 HOH A O 1
HETATM 573 O O . HOH B 2 . ? 26.151 39.210 7.337 1.00 28.81 ? ? ? ? ? ? 1016 HOH A O 1
HETATM 574 O O . HOH B 2 . ? 20.974 36.704 2.736 1.00 22.52 ? ? ? ? ? ? 1017 HOH A O 1
HETATM 575 O O . HOH B 2 . ? 20.796 49.132 25.996 1.00 19.50 ? ? ? ? ? ? 1018 HOH A O 1
HETATM 576 O O . HOH B 2 . ? 28.370 43.431 19.191 1.00 23.90 ? ? ? ? ? ? 1019 HOH A O 1
HETATM 577 O O . HOH B 2 . ? 29.565 39.861 17.495 1.00 22.27 ? ? ? ? ? ? 1020 HOH A O 1
HETATM 578 O O . HOH B 2 . ? 21.248 19.663 20.917 1.00 26.18 ? ? ? ? ? ? 1021 HOH A O 1
HETATM 579 O O . HOH B 2 . ? 25.744 28.721 26.627 1.00 18.71 ? ? ? ? ? ? 1022 HOH A O 1
HETATM 580 O O . HOH B 2 . ? 8.691 29.441 5.693 1.00 28.32 ? ? ? ? ? ? 1023 HOH A O 1
HETATM 581 O O . HOH B 2 . ? 30.789 37.281 18.454 1.00 23.96 ? ? ? ? ? ? 1024 HOH A O 1
HETATM 582 O O . HOH B 2 . ? 30.905 41.821 19.077 1.00 32.78 ? ? ? ? ? ? 1025 HOH A O 1
HETATM 583 O O . HOH B 2 . ? 28.623 45.786 17.612 1.00 30.03 ? ? ? ? ? ? 1026 HOH A O 1
HETATM 584 O O . HOH B 2 . ? 24.935 39.275 27.098 1.00 35.54 ? ? ? ? ? ? 1027 HOH A O 1
HETATM 585 O O . HOH B 2 . ? 23.462 49.242 21.058 1.00 24.52 ? ? ? ? ? ? 1028 HOH A O 1
HETATM 586 O O . HOH B 2 . ? 9.924 39.544 2.749 1.00 27.80 ? ? ? ? ? ? 1029 HOH A O 1
HETATM 587 O O . HOH B 2 . ? 28.729 39.834 24.613 1.00 29.16 ? ? ? ? ? ? 1030 HOH A O 1
HETATM 588 O O . HOH B 2 . ? 13.579 27.260 21.149 1.00 84.05 ? ? ? ? ? ? 1031 HOH A O 1
HETATM 589 O O . HOH B 2 . ? 23.652 23.003 29.711 1.00 34.06 ? ? ? ? ? ? 1032 HOH A O 1
HETATM 590 O O . HOH B 2 . ? 25.631 24.685 18.228 1.00 39.61 ? ? ? ? ? ? 1033 HOH A O 1
HETATM 591 O O . HOH B 2 . ? 17.799 29.236 9.197 1.00 26.02 ? ? ? ? ? ? 1034 HOH A O 1
HETATM 592 O O . HOH B 2 . ? 23.547 33.102 28.360 1.00 24.30 ? ? ? ? ? ? 1035 HOH A O 1
HETATM 593 O O . HOH B 2 . ? 16.363 35.102 26.457 1.00 43.03 ? ? ? ? ? ? 1036 HOH A O 1
HETATM 594 O O . HOH B 2 . ? 24.125 30.214 28.423 1.00 31.89 ? ? ? ? ? ? 1037 HOH A O 1
HETATM 595 O O . HOH B 2 . ? 33.063 32.577 18.258 1.00 33.77 ? ? ? ? ? ? 1038 HOH A O 1
HETATM 596 O O . HOH B 2 . ? 29.209 40.826 8.442 1.00 27.15 ? ? ? ? ? ? 1039 HOH A O 1
HETATM 597 O O . HOH B 2 . ? 10.391 48.156 12.777 1.00 28.18 ? ? ? ? ? ? 1040 HOH A O 1
HETATM 598 O O . HOH B 2 . ? 12.221 30.930 11.756 1.00 37.83 ? ? ? ? ? ? 1041 HOH A O 1
HETATM 599 O O . HOH B 2 . ? 18.997 45.418 13.303 1.00 45.45 ? ? ? ? ? ? 1042 HOH A O 1
HETATM 600 O O . HOH B 2 . ? 16.360 49.482 18.244 1.00 40.84 ? ? ? ? ? ? 1043 HOH A O 1
HETATM 601 O O . HOH B 2 . ? 27.915 38.760 27.252 1.00 28.47 ? ? ? ? ? ? 1044 HOH A O 1
HETATM 602 O O . HOH B 2 . ? 28.158 34.837 23.497 1.00 33.21 ? ? ? ? ? ? 1045 HOH A O 1
HETATM 603 O O . HOH B 2 . ? 21.975 48.757 12.570 1.00 43.49 ? ? ? ? ? ? 1046 HOH A O 1
HETATM 604 O O . HOH B 2 . ? 27.069 48.275 18.837 1.00 45.27 ? ? ? ? ? ? 1047 HOH A O 1
HETATM 605 O O . HOH B 2 . ? 30.148 32.964 9.614 1.00 40.65 ? ? ? ? ? ? 1048 HOH A O 1
HETATM 606 O O . HOH B 2 . ? 21.196 27.107 11.789 1.00 37.13 ? ? ? ? ? ? 1049 HOH A O 1
HETATM 607 O O . HOH B 2 . ? 8.864 38.227 22.360 1.00 51.22 ? ? ? ? ? ? 1050 HOH A O 1
HETATM 608 O O . HOH B 2 . ? 13.228 45.007 6.286 1.00 35.22 ? ? ? ? ? ? 1051 HOH A O 1
HETATM 609 O O . HOH B 2 . ? 18.577 28.344 11.840 1.00 26.01 ? ? ? ? ? ? 1052 HOH A O 1
HETATM 610 O O . HOH B 2 . ? 20.526 31.891 2.074 1.00 42.96 ? ? ? ? ? ? 1053 HOH A O 1
HETATM 611 O O . HOH B 2 . ? 25.758 34.472 27.008 1.00 42.18 ? ? ? ? ? ? 1054 HOH A O 1
HETATM 612 O O . HOH B 2 . ? 7.838 42.380 22.861 1.00 52.25 ? ? ? ? ? ? 1055 HOH A O 1
HETATM 613 O O . HOH B 2 . ? 20.569 50.052 9.597 1.00 32.67 ? ? ? ? ? ? 1056 HOH A O 1
HETATM 614 O O . HOH B 2 . ? 13.009 36.362 25.377 1.00 57.03 ? ? ? ? ? ? 1057 HOH A O 1
HETATM 615 O O . HOH B 2 . ? 19.229 48.467 11.442 1.00 39.61 ? ? ? ? ? ? 1058 HOH A O 1
HETATM 616 O O . HOH B 2 . ? 17.655 18.464 11.930 1.00 46.26 ? ? ? ? ? ? 1059 HOH A O 1
HETATM 617 O O . HOH B 2 . ? 30.445 40.241 14.615 1.00 42.89 ? ? ? ? ? ? 1060 HOH A O 1
HETATM 618 O O . HOH B 2 . ? 9.014 41.676 7.543 1.00 37.51 ? ? ? ? ? ? 1061 HOH A O 1
HETATM 619 O O . HOH B 2 . ? 3.398 36.556 10.329 1.00 43.89 ? ? ? ? ? ? 1062 HOH A O 1
HETATM 620 O O . HOH B 2 . ? 31.603 38.138 21.437 1.00 33.80 ? ? ? ? ? ? 1063 HOH A O 1
HETATM 621 O O . HOH B 2 . ? 16.543 47.103 11.490 1.00 39.36 ? ? ? ? ? ? 1064 HOH A O 1
HETATM 622 O O . HOH B 2 . ? 12.037 24.714 13.107 1.00 39.23 ? ? ? ? ? ? 1065 HOH A O 1
HETATM 623 O O . HOH B 2 . ? 7.261 36.306 24.007 1.00 56.18 ? ? ? ? ? ? 1066 HOH A O 1
HETATM 624 O O . HOH B 2 . ? 5.607 42.442 13.596 1.00 40.41 ? ? ? ? ? ? 1067 HOH A O 1
HETATM 625 O O . HOH B 2 . ? 23.532 49.788 24.189 1.00 54.62 ? ? ? ? ? ? 1068 HOH A O 1
HETATM 626 O O . HOH B 2 . ? 30.701 46.187 13.647 1.00 42.89 ? ? ? ? ? ? 1069 HOH A O 1
HETATM 627 O O . HOH B 2 . ? 32.300 36.531 11.832 1.00 60.41 ? ? ? ? ? ? 1070 HOH A O 1
HETATM 628 O O . HOH B 2 . ? 34.351 35.009 19.379 1.00 59.49 ? ? ? ? ? ? 1071 HOH A O 1
HETATM 629 O O . HOH B 2 . ? 9.450 49.006 15.663 1.00 44.77 ? ? ? ? ? ? 1072 HOH A O 1
HETATM 630 O O . HOH B 2 . ? 29.476 37.267 23.087 1.00 53.80 ? ? ? ? ? ? 1073 HOH A O 1
HETATM 631 O O . HOH B 2 . ? 13.681 31.440 0.753 1.00 40.69 ? ? ? ? ? ? 1074 HOH A O 1
HETATM 632 O O . HOH B 2 . ? 26.728 21.941 27.773 1.00 56.42 ? ? ? ? ? ? 1075 HOH A O 1
HETATM 633 O O . HOH B 2 . ? 10.004 34.063 12.086 1.00 37.89 ? ? ? ? ? ? 1076 HOH A O 1
HETATM 634 O O . HOH B 2 . ? 30.553 39.203 10.893 1.00 51.16 ? ? ? ? ? ? 1077 HOH A O 1
HETATM 635 O O . HOH B 2 . ? 23.569 17.799 20.501 1.00 66.90 ? ? ? ? ? ? 1078 HOH A O 1
HETATM 636 O O . HOH B 2 . ? 10.927 19.731 12.370 1.00 49.19 ? ? ? ? ? ? 1079 HOH A O 1
HETATM 637 O O . HOH B 2 . ? 17.983 47.329 4.501 1.00 50.08 ? ? ? ? ? ? 1080 HOH A O 1
HETATM 638 O O . HOH B 2 . ? 8.191 47.481 10.669 1.00 48.81 ? ? ? ? ? ? 1081 HOH A O 1
HETATM 639 O O . HOH B 2 . ? 32.095 31.237 24.622 1.00 48.03 ? ? ? ? ? ? 1082 HOH A O 1
HETATM 640 O O . HOH B 2 . ? 11.520 27.290 5.507 1.00 36.56 ? ? ? ? ? ? 1083 HOH A O 1
HETATM 641 O O . HOH B 2 . ? 13.249 36.425 28.955 1.00 56.49 ? ? ? ? ? ? 1084 HOH A O 1
HETATM 642 O O . HOH B 2 . ? 15.919 54.510 15.962 1.00 44.02 ? ? ? ? ? ? 1085 HOH A O 1
HETATM 643 O O . HOH B 2 . ? 11.187 43.000 5.973 1.00 39.42 ? ? ? ? ? ? 1086 HOH A O 1
HETATM 644 O O . HOH B 2 . ? 16.743 33.111 28.517 1.00 47.11 ? ? ? ? ? ? 1087 HOH A O 1
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 MSE 1 151 151 MSE MSE A . n
A 1 2 ASP 2 152 152 ASP ASP A . n
A 1 3 ILE 3 153 153 ILE ILE A . n
A 1 4 ARG 4 154 154 ARG ARG A . n
A 1 5 GLN 5 155 155 GLN GLN A . n
A 1 6 GLY 6 156 156 GLY GLY A . n
A 1 7 PRO 7 157 157 PRO PRO A . n
A 1 8 LYS 8 158 158 LYS LYS A . n
A 1 9 GLU 9 159 159 GLU GLU A . n
A 1 10 PRO 10 160 160 PRO PRO A . n
A 1 11 PHE 11 161 161 PHE PHE A . n
A 1 12 ARG 12 162 162 ARG ARG A . n
A 1 13 ASP 13 163 163 ASP ASP A . n
A 1 14 TYR 14 164 164 TYR TYR A . n
A 1 15 VAL 15 165 165 VAL VAL A . n
A 1 16 ASP 16 166 166 ASP ASP A . n
A 1 17 ARG 17 167 167 ARG ARG A . n
A 1 18 PHE 18 168 168 PHE PHE A . n
A 1 19 TYR 19 169 169 TYR TYR A . n
A 1 20 LYS 20 170 170 LYS LYS A . n
A 1 21 THR 21 171 171 THR THR A . n
A 1 22 LEU 22 172 172 LEU LEU A . n
A 1 23 ARG 23 173 173 ARG ARG A . n
A 1 24 ALA 24 174 174 ALA ALA A . n
A 1 25 GLU 25 175 175 GLU GLU A . n
A 1 26 GLN 26 176 176 GLN GLN A . n
A 1 27 ALA 27 177 177 ALA ALA A . n
A 1 28 SER 28 178 178 SER SER A . n
A 1 29 GLN 29 179 179 GLN GLN A . n
A 1 30 GLU 30 180 180 GLU GLU A . n
A 1 31 VAL 31 181 181 VAL VAL A . n
A 1 32 LYS 32 182 182 LYS LYS A . n
A 1 33 ASN 33 183 183 ASN ASN A . n
A 1 34 TRP 34 184 184 TRP TRP A . n
A 1 35 MSE 35 185 185 MSE MSE A . n
A 1 36 THR 36 186 186 THR THR A . n
A 1 37 GLU 37 187 187 GLU GLU A . n
A 1 38 THR 38 188 188 THR THR A . n
A 1 39 LEU 39 189 189 LEU LEU A . n
A 1 40 LEU 40 190 190 LEU LEU A . n
A 1 41 VAL 41 191 191 VAL VAL A . n
A 1 42 GLN 42 192 192 GLN GLN A . n
A 1 43 ASN 43 193 193 ASN ASN A . n
A 1 44 ALA 44 194 194 ALA ALA A . n
A 1 45 ASN 45 195 195 ASN ASN A . n
A 1 46 PRO 46 196 196 PRO PRO A . n
A 1 47 ASP 47 197 197 ASP ASP A . n
A 1 48 CYS 48 198 198 CYS CYS A . n
A 1 49 LYS 49 199 199 LYS LYS A . n
A 1 50 THR 50 200 200 THR THR A . n
A 1 51 ILE 51 201 201 ILE ILE A . n
A 1 52 LEU 52 202 202 LEU LEU A . n
A 1 53 LYS 53 203 203 LYS LYS A . n
A 1 54 ALA 54 204 204 ALA ALA A . n
A 1 55 LEU 55 205 205 LEU LEU A . n
A 1 56 GLY 56 206 206 GLY GLY A . n
A 1 57 PRO 57 207 207 PRO PRO A . n
A 1 58 GLY 58 208 208 GLY GLY A . n
A 1 59 ALA 59 209 209 ALA ALA A . n
A 1 60 THR 60 210 210 THR THR A . n
A 1 61 LEU 61 211 211 LEU LEU A . n
A 1 62 GLU 62 212 212 GLU GLU A . n
A 1 63 GLU 63 213 213 GLU GLU A . n
A 1 64 MSE 64 214 214 MSE MSE A . n
A 1 65 MSE 65 215 215 MSE MSE A . n
A 1 66 THR 66 216 216 THR THR A . n
A 1 67 ALA 67 217 217 ALA ALA A . n
A 1 68 CYS 68 218 218 CYS CYS A . n
A 1 69 GLN 69 219 219 GLN GLN A . n
A 1 70 GLY 70 220 220 GLY GLY A . n
#
loop_
_software.name
_software.classification
_software.version
_software.citation_id
_software.pdbx_ordinal
DENZO 'data collection' . ? 1
SCALEPACK 'data reduction' . ? 2
X-PLOR 'model building' 3.843 ? 3
X-PLOR refinement 3.843 ? 4
#
loop_
_pdbx_version.entry_id
_pdbx_version.revision_date
_pdbx_version.major_version
_pdbx_version.minor_version
_pdbx_version.revision_type
_pdbx_version.details
1A8O 2008-03-24 3 2 'Version format compliance' 'compliance with PDB format V.3.15'
1A8O 2011-07-13 4 0000 'Version format compliance' 'compliance with PDB Exchange Dictionary V4'
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
1 Y 0 1 A LYS 203 ? CD ?
2 Y 0 1 A LYS 203 ? CE ?
3 Y 0 1 A LYS 203 ? NZ ?
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_defined_assembly
_pdbx_struct_assembly.method_details ?
_pdbx_struct_assembly.oligomeric_details dimeric
_pdbx_struct_assembly.oligomeric_count 2
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1,2
_pdbx_struct_assembly_gen.asym_id_list A,B
#
loop_
_pdbx_struct_oper_list.id
_pdbx_struct_oper_list.type
_pdbx_struct_oper_list.name
_pdbx_struct_oper_list.symmetry_operation
_pdbx_struct_oper_list.matrix[1][1]
_pdbx_struct_oper_list.matrix[1][2]
_pdbx_struct_oper_list.matrix[1][3]
_pdbx_struct_oper_list.vector[1]
_pdbx_struct_oper_list.matrix[2][1]
_pdbx_struct_oper_list.matrix[2][2]
_pdbx_struct_oper_list.matrix[2][3]
_pdbx_struct_oper_list.vector[2]
_pdbx_struct_oper_list.matrix[3][1]
_pdbx_struct_oper_list.matrix[3][2]
_pdbx_struct_oper_list.matrix[3][3]
_pdbx_struct_oper_list.vector[3]
1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 41.9800000000 -1.0000000000
0.0000000000 0.0000000000 41.9800000000 0.0000000000 0.0000000000 -1.0000000000 44.4600000000
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 HOH 1 1000 1000 HOH HOH A .
B 2 HOH 2 1001 1001 HOH HOH A .
B 2 HOH 3 1002 1002 HOH HOH A .
B 2 HOH 4 1003 1003 HOH HOH A .
B 2 HOH 5 1004 1004 HOH HOH A .
B 2 HOH 6 1005 1005 HOH HOH A .
B 2 HOH 7 1006 1006 HOH HOH A .
B 2 HOH 8 1007 1007 HOH HOH A .
B 2 HOH 9 1008 1008 HOH HOH A .
B 2 HOH 10 1009 1009 HOH HOH A .
B 2 HOH 11 1010 1010 HOH HOH A .
B 2 HOH 12 1011 1011 HOH HOH A .
B 2 HOH 13 1012 1012 HOH HOH A .
B 2 HOH 14 1013 1013 HOH HOH A .
B 2 HOH 15 1014 1014 HOH HOH A .
B 2 HOH 16 1015 1015 HOH HOH A .
B 2 HOH 17 1016 1016 HOH HOH A .
B 2 HOH 18 1017 1017 HOH HOH A .
B 2 HOH 19 1018 1018 HOH HOH A .
B 2 HOH 20 1019 1019 HOH HOH A .
B 2 HOH 21 1020 1020 HOH HOH A .
B 2 HOH 22 1021 1021 HOH HOH A .
B 2 HOH 23 1022 1022 HOH HOH A .
B 2 HOH 24 1023 1023 HOH HOH A .
B 2 HOH 25 1024 1024 HOH HOH A .
B 2 HOH 26 1025 1025 HOH HOH A .
B 2 HOH 27 1026 1026 HOH HOH A .
B 2 HOH 28 1027 1027 HOH HOH A .
B 2 HOH 29 1028 1028 HOH HOH A .
B 2 HOH 30 1029 1029 HOH HOH A .
B 2 HOH 31 1030 1030 HOH HOH A .
B 2 HOH 32 1031 1031 HOH HOH A .
B 2 HOH 33 1032 1032 HOH HOH A .
B 2 HOH 34 1033 1033 HOH HOH A .
B 2 HOH 35 1034 1034 HOH HOH A .
B 2 HOH 36 1035 1035 HOH HOH A .
B 2 HOH 37 1036 1036 HOH HOH A .
B 2 HOH 38 1037 1037 HOH HOH A .
B 2 HOH 39 1038 1038 HOH HOH A .
B 2 HOH 40 1039 1039 HOH HOH A .
B 2 HOH 41 1040 1040 HOH HOH A .
B 2 HOH 42 1041 1041 HOH HOH A .
B 2 HOH 43 1042 1042 HOH HOH A .
B 2 HOH 44 1043 1043 HOH HOH A .
B 2 HOH 45 1044 1044 HOH HOH A .
B 2 HOH 46 1045 1045 HOH HOH A .
B 2 HOH 47 1046 1046 HOH HOH A .
B 2 HOH 48 1047 1047 HOH HOH A .
B 2 HOH 49 1048 1048 HOH HOH A .
B 2 HOH 50 1049 1049 HOH HOH A .
B 2 HOH 51 1050 1050 HOH HOH A .
B 2 HOH 52 1051 1051 HOH HOH A .
B 2 HOH 53 1052 1052 HOH HOH A .
B 2 HOH 54 1053 1053 HOH HOH A .
B 2 HOH 55 1054 1054 HOH HOH A .
B 2 HOH 56 1055 1055 HOH HOH A .
B 2 HOH 57 1056 1056 HOH HOH A .
B 2 HOH 58 1057 1057 HOH HOH A .
B 2 HOH 59 1058 1058 HOH HOH A .
B 2 HOH 60 1059 1059 HOH HOH A .
B 2 HOH 61 1060 1060 HOH HOH A .
B 2 HOH 62 1061 1061 HOH HOH A .
B 2 HOH 63 1062 1062 HOH HOH A .
B 2 HOH 64 1063 1063 HOH HOH A .
B 2 HOH 65 1064 1064 HOH HOH A .
B 2 HOH 66 1065 1065 HOH HOH A .
B 2 HOH 67 1066 1066 HOH HOH A .
B 2 HOH 68 1067 1067 HOH HOH A .
B 2 HOH 69 1068 1068 HOH HOH A .
B 2 HOH 70 1069 1069 HOH HOH A .
B 2 HOH 71 1070 1070 HOH HOH A .
B 2 HOH 72 1071 1071 HOH HOH A .
B 2 HOH 73 1072 1072 HOH HOH A .
B 2 HOH 74 1073 1073 HOH HOH A .
B 2 HOH 75 1074 1074 HOH HOH A .
B 2 HOH 76 1075 1075 HOH HOH A .
B 2 HOH 77 1076 1076 HOH HOH A .
B 2 HOH 78 1077 1077 HOH HOH A .
B 2 HOH 79 1078 1078 HOH HOH A .
B 2 HOH 80 1079 1079 HOH HOH A .
B 2 HOH 81 1080 1080 HOH HOH A .
B 2 HOH 82 1081 1081 HOH HOH A .
B 2 HOH 83 1082 1082 HOH HOH A .
B 2 HOH 84 1083 1083 HOH HOH A .
B 2 HOH 85 1084 1084 HOH HOH A .
B 2 HOH 86 1085 1085 HOH HOH A .
B 2 HOH 87 1086 1086 HOH HOH A .
B 2 HOH 88 1087 1087 HOH HOH A .
#
loop_
_pdbx_struct_mod_residue.id
_pdbx_struct_mod_residue.label_asym_id
_pdbx_struct_mod_residue.label_seq_id
_pdbx_struct_mod_residue.label_comp_id
_pdbx_struct_mod_residue.auth_asym_id
_pdbx_struct_mod_residue.auth_seq_id
_pdbx_struct_mod_residue.auth_comp_id
_pdbx_struct_mod_residue.PDB_ins_code
_pdbx_struct_mod_residue.parent_comp_id
_pdbx_struct_mod_residue.details
1 A 1 MSE A 151 MSE ? MET SELENOMETHIONINE
2 A 35 MSE A 185 MSE ? MET SELENOMETHIONINE
3 A 64 MSE A 214 MSE ? MET SELENOMETHIONINE
4 A 65 MSE A 215 MSE ? MET SELENOMETHIONINE
#
_pdbx_validate_torsion.id 1
_pdbx_validate_torsion.PDB_model_num 1
_pdbx_validate_torsion.auth_comp_id THR
_pdbx_validate_torsion.auth_asym_id A
_pdbx_validate_torsion.auth_seq_id 188
_pdbx_validate_torsion.PDB_ins_code ?
_pdbx_validate_torsion.phi -100.08
_pdbx_validate_torsion.psi -89.70
#
_pdbx_entity_nonpoly.entity_id 2
_pdbx_entity_nonpoly.name water
_pdbx_entity_nonpoly.comp_id HOH
#