Permalink
Fetching contributors…
Cannot retrieve contributors at this time
6625 lines (6624 sloc) 462 KB
data_1LCD
#
_entry.id 1LCD
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 4.007
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
PDB 1LCD
NDB 1LCD
#
loop_
_database_PDB_rev.num
_database_PDB_rev.date
_database_PDB_rev.date_original
_database_PDB_rev.status
_database_PDB_rev.replaces
_database_PDB_rev.mod_type
1 1994-01-31 1993-03-25 ? 1LCD 0
2 2003-04-01 ? ? 1LCD 1
3 2009-02-24 ? ? 1LCD 1
#
loop_
_database_PDB_rev_record.rev_num
_database_PDB_rev_record.type
_database_PDB_rev_record.details
2 JRNL ?
3 VERSN ?
#
_pdbx_database_related.db_name PDB
_pdbx_database_related.db_id 1LCC
_pdbx_database_related.details .
_pdbx_database_related.content_type 'representative structure'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.entry_id 1LCD
_pdbx_database_status.deposit_site ?
_pdbx_database_status.process_site ?
_pdbx_database_status.status_code_sf ?
_pdbx_database_status.status_code_mr REL
_pdbx_database_status.SG_entry ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Chuprina, V.P.' 1
'Rullmann, J.A.C.' 2
'Lamerichs, R.M.J.N.' 3
'Van Boom, J.H.' 4
'Boelens, R.' 5
'Kaptein, R.' 6
#
loop_
_citation.id
_citation.title
_citation.journal_abbrev
_citation.journal_volume
_citation.page_first
_citation.page_last
_citation.year
_citation.journal_id_ASTM
_citation.country
_citation.journal_id_ISSN
_citation.journal_id_CSD
_citation.book_publisher
_citation.pdbx_database_id_PubMed
_citation.pdbx_database_id_DOI
primary
;Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics.
;
J.Mol.Biol. 234 446 462 1993 JMOBAK UK 0022-2836 0070 ? 8230225 10.1006/jmbi.1993.1598
1
;Assignment of the 1H-NMR Spectrum of a Lac Repressor Headpiece-Operator Complex in H2O and Identification of Noes. Consequences for Protein-DNA Interaction
;
Eur.J.Biochem. 194 629 ? 1990 EJBCAI IX 0014-2956 0262 ? ? ?
2 'Two-Dimensional NMR Study of a Protein-DNA Complex. Lac Repressor Headpiece-Operator Interaction' Biochem.Pharm. 40 89
? 1990 BCPCA6 UK 0006-2952 0725 ? ? ?
3 '1H NMR Study of a Complex between the Lac Repressor Headpiece and a 22 Base Pair Symmetric Lac Operator' Biochemistry 28
2985 ? 1989 BICHAW US 0006-2960 0033 ? ? ?
4 'NMR Based Docking Studies of Lac Repressor Headpiece on a Lac Operator Fragment' 'Ucla Symp.Mol.Cell.Biol., New Ser.' 95
11 ? 1989 USMBD6 US 0735-9543 2001 ? ? ?
5 'The Interaction of Lac Repressor Headpiece with its Operator: An NMR View' 'Protein Seq.Data Anal.' 1 487
? 1988 PSDAE6 GW 0931-9506 0816 ? ? ?
6
;Combined Procedure of Distance Geometry and Restrained Molecular Dynamics Techniques for Protein Structure Determination from Nuclear Magnetic Resonance Data: Application to the DNA Binding Domain of Lac Repressor from Escherichia Coli
;
Proteins 3 209 ? 1988 PSFGEY US 0887-3585 0867 ? ? ?
7 'A Two-Dimensional NMR Study of the Complex of Lac Repressor Headpiece with a 14 Base Pair Lac Operator Fragment'
'Nato Asi Ser.,Ser.A' 137 191 ? 1987 NALSDJ US 0161-0449 2002 ? ? ?
8
'Complex of Lac Repressor Headpiece with a 14 Base Pair Lac Operator Fragment Studied by Two-Dimensional Nuclear Magnetic Resonance'
J.Mol.Biol. 193 213 ? 1987 JMOBAK UK 0022-2836 0070 ? ? ?
9
;Restrained Molecular Dynamics Procedure for Protein Tertiary Structure Determination from NMR Data: A Lac Repressor Headpiece Structure Based on Information on J-Coupling and from Presence and Absence of Noes
;
Isr.J.Chem. 27 181 ? 1986 ISJCAT IS 0021-2148 0204 ? ? ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Chuprina, V.P.' 1
primary 'Rullmann, J.A.' 2
primary 'Lamerichs, R.M.' 3
primary 'van Boom, J.H.' 4
primary 'Boelens, R.' 5
primary 'Kaptein, R.' 6
1 'Lamerichs, R.M.J.N.' 7
1 'Boelens, R.' 8
1 'Van Der Marel, G.A.' 9
1 'Van Boom, J.H.' 10
1 'Kaptein, R.' 11
2 'Kaptein, R.' 12
2 'Lamerichs, R.M.J.N.' 13
2 'Boelens, R.' 14
2 'Rullmann, J.A.C.' 15
3 'Lamerichs, R.M.J.N.' 16
3 'Boelens, R.' 17
3 'Van Der Marel, G.A.' 18
3 'Van Boom, J.H.' 19
3 'Kaptein, R.' 20
3 'Buck, F.' 21
3 'Fera, B.' 22
3 'Rueterjans, H.' 23
4 'Rullmann, J.A.C.' 24
4 'Boelens, R.' 25
4 'Kaptein, R.' 26
5 'Boelens, R.' 27
5 'Lamerichs, R.M.J.N.' 28
5 'Rullmann, J.A.C.' 29
5 'Van Boom, J.H.' 30
5 'Kaptein, R.' 31
6 'De Vlieg, J.' 32
6 'Scheek, R.M.' 33
6 'Van Gunsteren, W.F.' 34
6 'Berendsen, H.J.C.' 35
6 'Kaptein, R.' 36
6 'Thomason, J.' 37
7 'Boelens, R.' 38
7 'Scheek, R.M.' 39
7 'Lamerichs, R.M.J.N.' 40
7 'De Vlieg, J.' 41
7 'Van Boom, J.H.' 42
7 'Kaptein, R.' 43
8 'Boelens, R.' 44
8 'Scheek, R.M.' 45
8 'Van Boom, J.H.' 46
8 'Kaptein, R.' 47
9 'De Vlieg, J.' 48
9 'Boelens, R.' 49
9 'Scheek, R.M.' 50
9 'Kaptein, R.' 51
9 'Van Gunsteren, W.F.' 52
#
_cell.entry_id 1LCD
_cell.length_a 1.000
_cell.length_b 1.000
_cell.length_c 1.000
_cell.angle_alpha 90.00
_cell.angle_beta 90.00
_cell.angle_gamma 90.00
_cell.Z_PDB 1
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 1LCD
_symmetry.space_group_name_H-M 'P 1'
_symmetry.pdbx_full_space_group_name_H-M ?
_symmetry.cell_setting ?
_symmetry.Int_Tables_number ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
1 polymer syn
;DNA (5'-D(*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*G)-3')
;
3413.274 1 ?
2 polymer syn
;DNA (5'-D(*CP*GP*CP*TP*CP*AP*CP*AP*AP*TP*T)-3')
;
3293.201 1 ?
3 polymer man 'Lac Repressor' 5693.497 1 ?
4 non-polymer syn 'SODIUM ION' 22.990 1 ?
5 water nat water 18.015 49 ?
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
_entity_poly.pdbx_strand_id
1 polydeoxyribonucleotide no no '(DA)(DA)(DT)(DT)(DG)(DT)(DG)(DA)(DG)(DC)(DG)' AATTGTGAGCG B
2 polydeoxyribonucleotide no no '(DC)(DG)(DC)(DT)(DC)(DA)(DC)(DA)(DA)(DT)(DT)' CGCTCACAATT C
3 'polypeptide(L)' no no MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR A
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 DA n
1 2 DA n
1 3 DT n
1 4 DT n
1 5 DG n
1 6 DT n
1 7 DG n
1 8 DA n
1 9 DG n
1 10 DC n
1 11 DG n
2 1 DC n
2 2 DG n
2 3 DC n
2 4 DT n
2 5 DC n
2 6 DA n
2 7 DC n
2 8 DA n
2 9 DA n
2 10 DT n
2 11 DT n
3 1 MET n
3 2 LYS n
3 3 PRO n
3 4 VAL n
3 5 THR n
3 6 LEU n
3 7 TYR n
3 8 ASP n
3 9 VAL n
3 10 ALA n
3 11 GLU n
3 12 TYR n
3 13 ALA n
3 14 GLY n
3 15 VAL n
3 16 SER n
3 17 TYR n
3 18 GLN n
3 19 THR n
3 20 VAL n
3 21 SER n
3 22 ARG n
3 23 VAL n
3 24 VAL n
3 25 ASN n
3 26 GLN n
3 27 ALA n
3 28 SER n
3 29 HIS n
3 30 VAL n
3 31 SER n
3 32 ALA n
3 33 LYS n
3 34 THR n
3 35 ARG n
3 36 GLU n
3 37 LYS n
3 38 VAL n
3 39 GLU n
3 40 ALA n
3 41 ALA n
3 42 MET n
3 43 ALA n
3 44 GLU n
3 45 LEU n
3 46 ASN n
3 47 TYR n
3 48 ILE n
3 49 PRO n
3 50 ASN n
3 51 ARG n
#
_entity_src_gen.entity_id 3
_entity_src_gen.gene_src_common_name ?
_entity_src_gen.gene_src_genus Escherichia
_entity_src_gen.pdbx_gene_src_gene ?
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name ?
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ?
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type LAC
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_struct_ref.id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.entity_id
_struct_ref.pdbx_align_begin
_struct_ref.biol_id
1 UNP LACI_ECOLI P03023 3 1 .
2 PDB 1LCD 1LCD 1 ? .
3 PDB 1LCD 1LCD 2 ? .
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.pdbx_PDB_id_code
_struct_ref_seq.pdbx_strand_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.pdbx_seq_align_beg_ins_code
_struct_ref_seq.seq_align_end
_struct_ref_seq.pdbx_seq_align_end_ins_code
_struct_ref_seq.pdbx_db_accession
_struct_ref_seq.db_align_beg
_struct_ref_seq.db_align_end
_struct_ref_seq.pdbx_auth_seq_align_beg
_struct_ref_seq.pdbx_auth_seq_align_end
_struct_ref_seq.details
1 1 1LCD A 1 . 51 . P03023 1 51 1 51 .
2 2 1LCD B 1 ? 11 ? 1LCD 1 11 1 11 ?
3 3 1LCD C 1 ? 11 ? 1LCD 1 11 1 11 ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.224
DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.211
DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.224
DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.199
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.207
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.197
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.132
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.147
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.120
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.174
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.191
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.104
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.094
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.130
GLY 'PEPTIDE LINKING' y GLYCINE ? 'C2 H5 N O2' 75.067
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.146
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.210
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.119
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.164
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.174
NA NON-POLYMER . 'SODIUM ION' ? 'NA 1' 22.990
HOH NON-POLYMER . WATER ? 'H2 O' 18.015
#
_pdbx_nmr_ensemble.entry_id 1LCD
_pdbx_nmr_ensemble.conformers_calculated_total_number ?
_pdbx_nmr_ensemble.conformers_submitted_total_number 3
_pdbx_nmr_ensemble.conformer_selection_criteria ?
#
_exptl.entry_id 1LCD
_exptl.method 'SOLUTION NMR'
_exptl.crystals_number ?
#
_struct.entry_id 1LCD
_struct.title
;STRUCTURE OF THE COMPLEX OF LAC REPRESSOR HEADPIECE AND AN 11 BASE-PAIR HALF-OPERATOR DETERMINED BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND RESTRAINED MOLECULAR DYNAMICS
;
_struct.pdbx_descriptor 'LAC REPRESSOR/DNA COMPLEX'
_struct.pdbx_model_details ?
_struct.pdbx_CASP_flag ?
_struct.pdbx_model_type_details ?
#
_struct_keywords.entry_id 1LCD
_struct_keywords.pdbx_keywords 'GENE REGULATION/DNA'
_struct_keywords.text 'GENE REGULATION/DNA, GENE REGULATION-DNA complex'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
D N N 4 ?
E N N 5 ?
F N N 5 ?
G N N 5 ?
#
_struct_biol.id 1
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 1 THR C 5 ? GLY C 14 ? THR A 5 GLY A 14 1 ? 10
HELX_P HELX_P2 2 SER C 16 ? ASN C 25 ? SER A 16 ASN A 25 1 ? 10
HELX_P HELX_P3 3 SER C 31 ? LEU C 45 ? SER A 31 LEU A 45 1 ? 15
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
metalc1 metalc ? D NA . NA ? ? ? 1_555 B DT 4 OP1 ? ? C NA 12 C DT 4 1_555 ? ? ? ? ? ? ? 2.517 ?
metalc2 metalc ? D NA . NA ? ? ? 1_555 E HOH . O ? ? C NA 12 A HOH 53 1_555 ? ? ? ? ? ? ? 2.101 ?
metalc3 metalc ? D NA . NA ? ? ? 1_555 E HOH . O ? ? C NA 12 A HOH 57 1_555 ? ? ? ? ? ? ? 2.218 ?
metalc4 metalc ? D NA . NA ? ? ? 1_555 G HOH . O ? ? C NA 12 C HOH 923 1_555 ? ? ? ? ? ? ? 2.131 ?
hydrog1 hydrog ? A DA 1 N1 ? ? ? 1_555 B DT 11 N3 ? ? B DA 1 C DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog2 hydrog ? A DA 1 N6 ? ? ? 1_555 B DT 11 O4 ? ? B DA 1 C DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog3 hydrog ? A DA 2 N1 ? ? ? 1_555 B DT 10 N3 ? ? B DA 2 C DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog4 hydrog ? A DA 2 N6 ? ? ? 1_555 B DT 10 O4 ? ? B DA 2 C DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog5 hydrog ? A DT 3 N3 ? ? ? 1_555 B DA 9 N1 ? ? B DT 3 C DA 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog6 hydrog ? A DT 3 O4 ? ? ? 1_555 B DA 9 N6 ? ? B DT 3 C DA 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog7 hydrog ? A DT 4 N3 ? ? ? 1_555 B DA 8 N1 ? ? B DT 4 C DA 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog8 hydrog ? A DT 4 O4 ? ? ? 1_555 B DA 8 N6 ? ? B DT 4 C DA 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog9 hydrog ? A DG 5 N1 ? ? ? 1_555 B DC 7 N3 ? ? B DG 5 C DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog10 hydrog ? A DG 5 N2 ? ? ? 1_555 B DC 7 O2 ? ? B DG 5 C DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog11 hydrog ? A DG 5 O6 ? ? ? 1_555 B DC 7 N4 ? ? B DG 5 C DC 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog12 hydrog ? A DT 6 N3 ? ? ? 1_555 B DA 6 N1 ? ? B DT 6 C DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog13 hydrog ? A DT 6 O4 ? ? ? 1_555 B DA 6 N6 ? ? B DT 6 C DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog14 hydrog ? A DG 7 N1 ? ? ? 1_555 B DC 5 N3 ? ? B DG 7 C DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog15 hydrog ? A DG 7 N2 ? ? ? 1_555 B DC 5 O2 ? ? B DG 7 C DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog16 hydrog ? A DG 7 O6 ? ? ? 1_555 B DC 5 N4 ? ? B DG 7 C DC 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog17 hydrog ? A DA 8 N1 ? ? ? 1_555 B DT 4 N3 ? ? B DA 8 C DT 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog18 hydrog ? A DA 8 N6 ? ? ? 1_555 B DT 4 O4 ? ? B DA 8 C DT 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog19 hydrog ? A DG 9 N1 ? ? ? 1_555 B DC 3 N3 ? ? B DG 9 C DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog20 hydrog ? A DG 9 N2 ? ? ? 1_555 B DC 3 O2 ? ? B DG 9 C DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog21 hydrog ? A DG 9 O6 ? ? ? 1_555 B DC 3 N4 ? ? B DG 9 C DC 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog22 hydrog ? A DC 10 N3 ? ? ? 1_555 B DG 2 N1 ? ? B DC 10 C DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog23 hydrog ? A DC 10 N4 ? ? ? 1_555 B DG 2 O6 ? ? B DC 10 C DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog24 hydrog ? A DC 10 O2 ? ? ? 1_555 B DG 2 N2 ? ? B DC 10 C DG 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog25 hydrog ? A DG 11 N1 ? ? ? 1_555 B DC 1 N3 ? ? B DG 11 C DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog26 hydrog ? A DG 11 N2 ? ? ? 1_555 B DC 1 O2 ? ? B DG 11 C DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
hydrog27 hydrog ? A DG 11 O6 ? ? ? 1_555 B DC 1 N4 ? ? B DG 11 C DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ?
#
loop_
_struct_conn_type.id
_struct_conn_type.criteria
_struct_conn_type.reference
metalc ? ?
hydrog 'For hydrogen bonding between nucleic acid bases, donor to acceptor distance of 2.2 -3.5 Angstroms was used.' ?
#
_struct_site.id AC1
_struct_site.details 'BINDING SITE FOR RESIDUE NA C 12'
_struct_site.pdbx_evidence_code SOFTWARE
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 6 VAL C 24 ? VAL A 24 . . 1_555 ?
2 AC1 6 HOH E . ? HOH A 53 . . 1_555 ?
3 AC1 6 HOH E . ? HOH A 57 . . 1_555 ?
4 AC1 6 DC B 3 ? DC C 3 . . 1_555 ?
5 AC1 6 DT B 4 ? DT C 4 . . 1_555 ?
6 AC1 6 HOH G . ? HOH C 923 . . 1_555 ?
#
_database_PDB_matrix.entry_id 1LCD
_database_PDB_matrix.origx[1][1] 1.000000
_database_PDB_matrix.origx[1][2] 0.000000
_database_PDB_matrix.origx[1][3] 0.000000
_database_PDB_matrix.origx[2][1] 0.000000
_database_PDB_matrix.origx[2][2] 1.000000
_database_PDB_matrix.origx[2][3] 0.000000
_database_PDB_matrix.origx[3][1] 0.000000
_database_PDB_matrix.origx[3][2] 0.000000
_database_PDB_matrix.origx[3][3] 1.000000
_database_PDB_matrix.origx_vector[1] 0.00000
_database_PDB_matrix.origx_vector[2] 0.00000
_database_PDB_matrix.origx_vector[3] 0.00000
#
_atom_sites.entry_id 1LCD
_atom_sites.Cartn_transform_axes ?
_atom_sites.fract_transf_matrix[1][1] 1.000000
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 1.000000
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 1.000000
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
#
loop_
_atom_type.symbol
O
C
N
H
P
S
NA
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_asym_id
_atom_site.label_entity_id
_atom_site.label_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.B_iso_or_equiv
_atom_site.Cartn_x_esd
_atom_site.Cartn_y_esd
_atom_site.Cartn_z_esd
_atom_site.occupancy_esd
_atom_site.B_iso_or_equiv_esd
_atom_site.pdbx_formal_charge
_atom_site.auth_seq_id
_atom_site.auth_comp_id
_atom_site.auth_asym_id
_atom_site.auth_atom_id
_atom_site.pdbx_PDB_model_num
ATOM 1 O "O5'" . DA A 1 1 ? 8.090 29.550 48.440 1.00 0.00 ? ? ? ? ? ? 1 DA B "O5'" 1
ATOM 2 C "C5'" . DA A 1 1 ? 8.340 29.590 47.030 1.00 0.00 ? ? ? ? ? ? 1 DA B "C5'" 1
ATOM 3 C "C4'" . DA A 1 1 ? 9.490 30.500 46.610 1.00 0.00 ? ? ? ? ? ? 1 DA B "C4'" 1
ATOM 4 O "O4'" . DA A 1 1 ? 10.740 30.100 47.230 1.00 0.00 ? ? ? ? ? ? 1 DA B "O4'" 1
ATOM 5 C "C3'" . DA A 1 1 ? 9.700 30.280 45.130 1.00 0.00 ? ? ? ? ? ? 1 DA B "C3'" 1
ATOM 6 O "O3'" . DA A 1 1 ? 9.870 31.540 44.460 1.00 0.00 ? ? ? ? ? ? 1 DA B "O3'" 1
ATOM 7 C "C2'" . DA A 1 1 ? 10.890 29.370 45.060 1.00 0.00 ? ? ? ? ? ? 1 DA B "C2'" 1
ATOM 8 C "C1'" . DA A 1 1 ? 11.710 30.030 46.160 1.00 0.00 ? ? ? ? ? ? 1 DA B "C1'" 1
ATOM 9 N N9 . DA A 1 1 ? 12.880 29.240 46.620 1.00 0.00 ? ? ? ? ? ? 1 DA B N9 1
ATOM 10 C C8 . DA A 1 1 ? 12.750 27.970 46.990 1.00 0.00 ? ? ? ? ? ? 1 DA B C8 1
ATOM 11 N N7 . DA A 1 1 ? 13.820 27.550 47.660 1.00 0.00 ? ? ? ? ? ? 1 DA B N7 1
ATOM 12 C C5 . DA A 1 1 ? 14.670 28.580 47.680 1.00 0.00 ? ? ? ? ? ? 1 DA B C5 1
ATOM 13 C C6 . DA A 1 1 ? 15.950 28.780 48.190 1.00 0.00 ? ? ? ? ? ? 1 DA B C6 1
ATOM 14 N N6 . DA A 1 1 ? 16.660 27.750 48.610 1.00 0.00 ? ? ? ? ? ? 1 DA B N6 1
ATOM 15 N N1 . DA A 1 1 ? 16.580 29.960 48.070 1.00 0.00 ? ? ? ? ? ? 1 DA B N1 1
ATOM 16 C C2 . DA A 1 1 ? 16.010 30.970 47.410 1.00 0.00 ? ? ? ? ? ? 1 DA B C2 1
ATOM 17 N N3 . DA A 1 1 ? 14.790 30.810 46.880 1.00 0.00 ? ? ? ? ? ? 1 DA B N3 1
ATOM 18 C C4 . DA A 1 1 ? 14.090 29.650 47.000 1.00 0.00 ? ? ? ? ? ? 1 DA B C4 1
ATOM 19 H H61 . DA A 1 1 ? 17.580 27.900 48.940 1.00 0.00 ? ? ? ? ? ? 1 DA B H61 1
ATOM 20 H H62 . DA A 1 1 ? 16.240 26.840 48.580 1.00 0.00 ? ? ? ? ? ? 1 DA B H62 1
ATOM 21 H "HO5'" . DA A 1 1 ? 7.710 30.440 48.770 1.00 0.00 ? ? ? ? ? ? 1 DA B "HO5'" 1
ATOM 22 P P . DA A 1 2 ? 9.650 31.670 42.870 1.00 0.00 ? ? ? ? ? ? 2 DA B P 1
ATOM 23 O OP1 . DA A 1 2 ? 8.790 32.860 42.710 1.00 0.00 ? ? ? ? ? ? 2 DA B OP1 1
ATOM 24 O OP2 . DA A 1 2 ? 9.140 30.390 42.310 1.00 0.00 ? ? ? ? ? ? 2 DA B OP2 1
ATOM 25 O "O5'" . DA A 1 2 ? 11.160 31.910 42.400 1.00 0.00 ? ? ? ? ? ? 2 DA B "O5'" 1
ATOM 26 C "C5'" . DA A 1 2 ? 11.610 33.140 41.820 1.00 0.00 ? ? ? ? ? ? 2 DA B "C5'" 1
ATOM 27 C "C4'" . DA A 1 2 ? 13.070 33.060 41.360 1.00 0.00 ? ? ? ? ? ? 2 DA B "C4'" 1
ATOM 28 O "O4'" . DA A 1 2 ? 13.910 32.250 42.210 1.00 0.00 ? ? ? ? ? ? 2 DA B "O4'" 1
ATOM 29 C "C3'" . DA A 1 2 ? 13.170 32.460 39.980 1.00 0.00 ? ? ? ? ? ? 2 DA B "C3'" 1
ATOM 30 O "O3'" . DA A 1 2 ? 14.220 33.040 39.190 1.00 0.00 ? ? ? ? ? ? 2 DA B "O3'" 1
ATOM 31 C "C2'" . DA A 1 2 ? 13.470 31.010 40.230 1.00 0.00 ? ? ? ? ? ? 2 DA B "C2'" 1
ATOM 32 C "C1'" . DA A 1 2 ? 14.430 31.170 41.390 1.00 0.00 ? ? ? ? ? ? 2 DA B "C1'" 1
ATOM 33 N N9 . DA A 1 2 ? 14.490 29.960 42.220 1.00 0.00 ? ? ? ? ? ? 2 DA B N9 1
ATOM 34 C C8 . DA A 1 2 ? 13.430 29.300 42.690 1.00 0.00 ? ? ? ? ? ? 2 DA B C8 1
ATOM 35 N N7 . DA A 1 2 ? 13.830 28.360 43.550 1.00 0.00 ? ? ? ? ? ? 2 DA B N7 1
ATOM 36 C C5 . DA A 1 2 ? 15.150 28.460 43.650 1.00 0.00 ? ? ? ? ? ? 2 DA B C5 1
ATOM 37 C C6 . DA A 1 2 ? 16.170 27.780 44.320 1.00 0.00 ? ? ? ? ? ? 2 DA B C6 1
ATOM 38 N N6 . DA A 1 2 ? 15.860 26.880 45.230 1.00 0.00 ? ? ? ? ? ? 2 DA B N6 1
ATOM 39 N N1 . DA A 1 2 ? 17.470 28.040 44.090 1.00 0.00 ? ? ? ? ? ? 2 DA B N1 1
ATOM 40 C C2 . DA A 1 2 ? 17.840 28.970 43.210 1.00 0.00 ? ? ? ? ? ? 2 DA B C2 1
ATOM 41 N N3 . DA A 1 2 ? 16.900 29.680 42.560 1.00 0.00 ? ? ? ? ? ? 2 DA B N3 1
ATOM 42 C C4 . DA A 1 2 ? 15.580 29.450 42.770 1.00 0.00 ? ? ? ? ? ? 2 DA B C4 1
ATOM 43 H H61 . DA A 1 2 ? 16.600 26.370 45.680 1.00 0.00 ? ? ? ? ? ? 2 DA B H61 1
ATOM 44 H H62 . DA A 1 2 ? 14.910 26.770 45.540 1.00 0.00 ? ? ? ? ? ? 2 DA B H62 1
ATOM 45 P P . DT A 1 3 ? 13.840 33.560 37.730 1.00 0.00 ? ? ? ? ? ? 3 DT B P 1
ATOM 46 O OP1 . DT A 1 3 ? 13.260 34.900 37.950 1.00 0.00 ? ? ? ? ? ? 3 DT B OP1 1
ATOM 47 O OP2 . DT A 1 3 ? 13.020 32.550 37.010 1.00 0.00 ? ? ? ? ? ? 3 DT B OP2 1
ATOM 48 O "O5'" . DT A 1 3 ? 15.250 33.720 36.970 1.00 0.00 ? ? ? ? ? ? 3 DT B "O5'" 1
ATOM 49 C "C5'" . DT A 1 3 ? 15.730 32.690 36.110 1.00 0.00 ? ? ? ? ? ? 3 DT B "C5'" 1
ATOM 50 C "C4'" . DT A 1 3 ? 16.570 31.730 36.930 1.00 0.00 ? ? ? ? ? ? 3 DT B "C4'" 1
ATOM 51 O "O4'" . DT A 1 3 ? 15.880 30.830 37.810 1.00 0.00 ? ? ? ? ? ? 3 DT B "O4'" 1
ATOM 52 C "C3'" . DT A 1 3 ? 17.360 30.810 36.060 1.00 0.00 ? ? ? ? ? ? 3 DT B "C3'" 1
ATOM 53 O "O3'" . DT A 1 3 ? 18.400 31.530 35.350 1.00 0.00 ? ? ? ? ? ? 3 DT B "O3'" 1
ATOM 54 C "C2'" . DT A 1 3 ? 17.950 29.920 37.130 1.00 0.00 ? ? ? ? ? ? 3 DT B "C2'" 1
ATOM 55 C "C1'" . DT A 1 3 ? 17.000 30.070 38.300 1.00 0.00 ? ? ? ? ? ? 3 DT B "C1'" 1
ATOM 56 N N1 . DT A 1 3 ? 16.580 28.780 38.910 1.00 0.00 ? ? ? ? ? ? 3 DT B N1 1
ATOM 57 C C2 . DT A 1 3 ? 17.500 28.110 39.760 1.00 0.00 ? ? ? ? ? ? 3 DT B C2 1
ATOM 58 O O2 . DT A 1 3 ? 18.680 28.010 39.470 1.00 0.00 ? ? ? ? ? ? 3 DT B O2 1
ATOM 59 N N3 . DT A 1 3 ? 17.030 27.170 40.670 1.00 0.00 ? ? ? ? ? ? 3 DT B N3 1
ATOM 60 C C4 . DT A 1 3 ? 15.670 26.860 40.730 1.00 0.00 ? ? ? ? ? ? 3 DT B C4 1
ATOM 61 O O4 . DT A 1 3 ? 15.300 26.340 41.780 1.00 0.00 ? ? ? ? ? ? 3 DT B O4 1
ATOM 62 C C5 . DT A 1 3 ? 14.760 27.410 39.820 1.00 0.00 ? ? ? ? ? ? 3 DT B C5 1
ATOM 63 C C7 . DT A 1 3 ? 13.320 26.900 39.770 1.00 0.00 ? ? ? ? ? ? 3 DT B C7 1
ATOM 64 C C6 . DT A 1 3 ? 15.220 28.370 38.920 1.00 0.00 ? ? ? ? ? ? 3 DT B C6 1
ATOM 65 H H3 . DT A 1 3 ? 17.670 26.650 41.230 1.00 0.00 ? ? ? ? ? ? 3 DT B H3 1
ATOM 66 P P . DT A 1 4 ? 19.180 30.910 34.100 1.00 0.00 ? ? ? ? ? ? 4 DT B P 1
ATOM 67 O OP1 . DT A 1 4 ? 19.750 32.080 33.400 1.00 0.00 ? ? ? ? ? ? 4 DT B OP1 1
ATOM 68 O OP2 . DT A 1 4 ? 18.370 29.930 33.350 1.00 0.00 ? ? ? ? ? ? 4 DT B OP2 1
ATOM 69 O "O5'" . DT A 1 4 ? 20.360 30.080 34.770 1.00 0.00 ? ? ? ? ? ? 4 DT B "O5'" 1
ATOM 70 C "C5'" . DT A 1 4 ? 21.250 30.730 35.690 1.00 0.00 ? ? ? ? ? ? 4 DT B "C5'" 1
ATOM 71 C "C4'" . DT A 1 4 ? 22.180 29.780 36.430 1.00 0.00 ? ? ? ? ? ? 4 DT B "C4'" 1
ATOM 72 O "O4'" . DT A 1 4 ? 21.470 28.850 37.270 1.00 0.00 ? ? ? ? ? ? 4 DT B "O4'" 1
ATOM 73 C "C3'" . DT A 1 4 ? 23.050 28.950 35.520 1.00 0.00 ? ? ? ? ? ? 4 DT B "C3'" 1
ATOM 74 O "O3'" . DT A 1 4 ? 24.330 28.890 36.150 1.00 0.00 ? ? ? ? ? ? 4 DT B "O3'" 1
ATOM 75 C "C2'" . DT A 1 4 ? 22.440 27.580 35.450 1.00 0.00 ? ? ? ? ? ? 4 DT B "C2'" 1
ATOM 76 C "C1'" . DT A 1 4 ? 21.850 27.520 36.840 1.00 0.00 ? ? ? ? ? ? 4 DT B "C1'" 1
ATOM 77 N N1 . DT A 1 4 ? 20.620 26.700 36.820 1.00 0.00 ? ? ? ? ? ? 4 DT B N1 1
ATOM 78 C C2 . DT A 1 4 ? 20.420 25.770 37.840 1.00 0.00 ? ? ? ? ? ? 4 DT B C2 1
ATOM 79 O O2 . DT A 1 4 ? 21.330 25.330 38.530 1.00 0.00 ? ? ? ? ? ? 4 DT B O2 1
ATOM 80 N N3 . DT A 1 4 ? 19.150 25.280 38.100 1.00 0.00 ? ? ? ? ? ? 4 DT B N3 1
ATOM 81 C C4 . DT A 1 4 ? 18.050 25.720 37.350 1.00 0.00 ? ? ? ? ? ? 4 DT B C4 1
ATOM 82 O O4 . DT A 1 4 ? 16.970 25.710 37.950 1.00 0.00 ? ? ? ? ? ? 4 DT B O4 1
ATOM 83 C C5 . DT A 1 4 ? 18.240 26.560 36.250 1.00 0.00 ? ? ? ? ? ? 4 DT B C5 1
ATOM 84 C C7 . DT A 1 4 ? 17.100 26.890 35.290 1.00 0.00 ? ? ? ? ? ? 4 DT B C7 1
ATOM 85 C C6 . DT A 1 4 ? 19.530 27.040 35.990 1.00 0.00 ? ? ? ? ? ? 4 DT B C6 1
ATOM 86 H H3 . DT A 1 4 ? 19.030 24.650 38.860 1.00 0.00 ? ? ? ? ? ? 4 DT B H3 1
ATOM 87 P P . DG A 1 5 ? 25.670 28.660 35.310 1.00 0.00 ? ? ? ? ? ? 5 DG B P 1
ATOM 88 O OP1 . DG A 1 5 ? 26.720 29.390 36.060 1.00 0.00 ? ? ? ? ? ? 5 DG B OP1 1
ATOM 89 O OP2 . DG A 1 5 ? 25.490 29.100 33.910 1.00 0.00 ? ? ? ? ? ? 5 DG B OP2 1
ATOM 90 O "O5'" . DG A 1 5 ? 25.890 27.070 35.350 1.00 0.00 ? ? ? ? ? ? 5 DG B "O5'" 1
ATOM 91 C "C5'" . DG A 1 5 ? 26.310 26.520 36.610 1.00 0.00 ? ? ? ? ? ? 5 DG B "C5'" 1
ATOM 92 C "C4'" . DG A 1 5 ? 25.780 25.140 36.960 1.00 0.00 ? ? ? ? ? ? 5 DG B "C4'" 1
ATOM 93 O "O4'" . DG A 1 5 ? 24.370 25.060 36.690 1.00 0.00 ? ? ? ? ? ? 5 DG B "O4'" 1
ATOM 94 C "C3'" . DG A 1 5 ? 26.460 24.060 36.140 1.00 0.00 ? ? ? ? ? ? 5 DG B "C3'" 1
ATOM 95 O "O3'" . DG A 1 5 ? 27.350 23.330 37.020 1.00 0.00 ? ? ? ? ? ? 5 DG B "O3'" 1
ATOM 96 C "C2'" . DG A 1 5 ? 25.330 23.250 35.550 1.00 0.00 ? ? ? ? ? ? 5 DG B "C2'" 1
ATOM 97 C "C1'" . DG A 1 5 ? 24.110 23.690 36.370 1.00 0.00 ? ? ? ? ? ? 5 DG B "C1'" 1
ATOM 98 N N9 . DG A 1 5 ? 22.830 23.580 35.630 1.00 0.00 ? ? ? ? ? ? 5 DG B N9 1
ATOM 99 C C8 . DG A 1 5 ? 22.500 24.250 34.540 1.00 0.00 ? ? ? ? ? ? 5 DG B C8 1
ATOM 100 N N7 . DG A 1 5 ? 21.170 24.190 34.350 1.00 0.00 ? ? ? ? ? ? 5 DG B N7 1
ATOM 101 C C5 . DG A 1 5 ? 20.650 23.470 35.350 1.00 0.00 ? ? ? ? ? ? 5 DG B C5 1
ATOM 102 C C6 . DG A 1 5 ? 19.370 23.000 35.700 1.00 0.00 ? ? ? ? ? ? 5 DG B C6 1
ATOM 103 O O6 . DG A 1 5 ? 18.340 23.450 35.190 1.00 0.00 ? ? ? ? ? ? 5 DG B O6 1
ATOM 104 N N1 . DG A 1 5 ? 19.230 22.120 36.780 1.00 0.00 ? ? ? ? ? ? 5 DG B N1 1
ATOM 105 C C2 . DG A 1 5 ? 20.360 21.740 37.490 1.00 0.00 ? ? ? ? ? ? 5 DG B C2 1
ATOM 106 N N2 . DG A 1 5 ? 20.290 20.690 38.240 1.00 0.00 ? ? ? ? ? ? 5 DG B N2 1
ATOM 107 N N3 . DG A 1 5 ? 21.560 22.240 37.190 1.00 0.00 ? ? ? ? ? ? 5 DG B N3 1
ATOM 108 C C4 . DG A 1 5 ? 21.730 23.070 36.150 1.00 0.00 ? ? ? ? ? ? 5 DG B C4 1
ATOM 109 H H1 . DG A 1 5 ? 18.350 21.740 37.040 1.00 0.00 ? ? ? ? ? ? 5 DG B H1 1
ATOM 110 H H21 . DG A 1 5 ? 19.430 20.240 38.490 1.00 0.00 ? ? ? ? ? ? 5 DG B H21 1
ATOM 111 H H22 . DG A 1 5 ? 21.150 20.370 38.710 1.00 0.00 ? ? ? ? ? ? 5 DG B H22 1
ATOM 112 P P . DT A 1 6 ? 28.440 22.240 36.580 1.00 0.00 ? ? ? ? ? ? 6 DT B P 1
ATOM 113 O OP1 . DT A 1 6 ? 29.640 22.540 37.390 1.00 0.00 ? ? ? ? ? ? 6 DT B OP1 1
ATOM 114 O OP2 . DT A 1 6 ? 28.600 22.170 35.110 1.00 0.00 ? ? ? ? ? ? 6 DT B OP2 1
ATOM 115 O "O5'" . DT A 1 6 ? 27.770 20.840 36.990 1.00 0.00 ? ? ? ? ? ? 6 DT B "O5'" 1
ATOM 116 C "C5'" . DT A 1 6 ? 27.150 20.610 38.270 1.00 0.00 ? ? ? ? ? ? 6 DT B "C5'" 1
ATOM 117 C "C4'" . DT A 1 6 ? 26.100 19.500 38.220 1.00 0.00 ? ? ? ? ? ? 6 DT B "C4'" 1
ATOM 118 O "O4'" . DT A 1 6 ? 24.820 19.860 37.670 1.00 0.00 ? ? ? ? ? ? 6 DT B "O4'" 1
ATOM 119 C "C3'" . DT A 1 6 ? 26.630 18.340 37.420 1.00 0.00 ? ? ? ? ? ? 6 DT B "C3'" 1
ATOM 120 O "O3'" . DT A 1 6 ? 26.850 17.200 38.260 1.00 0.00 ? ? ? ? ? ? 6 DT B "O3'" 1
ATOM 121 C "C2'" . DT A 1 6 ? 25.580 18.060 36.390 1.00 0.00 ? ? ? ? ? ? 6 DT B "C2'" 1
ATOM 122 C "C1'" . DT A 1 6 ? 24.330 18.670 37.030 1.00 0.00 ? ? ? ? ? ? 6 DT B "C1'" 1
ATOM 123 N N1 . DT A 1 6 ? 23.310 19.090 36.040 1.00 0.00 ? ? ? ? ? ? 6 DT B N1 1
ATOM 124 C C2 . DT A 1 6 ? 21.970 18.630 36.090 1.00 0.00 ? ? ? ? ? ? 6 DT B C2 1
ATOM 125 O O2 . DT A 1 6 ? 21.630 17.600 36.660 1.00 0.00 ? ? ? ? ? ? 6 DT B O2 1
ATOM 126 N N3 . DT A 1 6 ? 21.030 19.250 35.260 1.00 0.00 ? ? ? ? ? ? 6 DT B N3 1
ATOM 127 C C4 . DT A 1 6 ? 21.440 20.230 34.350 1.00 0.00 ? ? ? ? ? ? 6 DT B C4 1
ATOM 128 O O4 . DT A 1 6 ? 20.560 20.760 33.680 1.00 0.00 ? ? ? ? ? ? 6 DT B O4 1
ATOM 129 C C5 . DT A 1 6 ? 22.780 20.610 34.220 1.00 0.00 ? ? ? ? ? ? 6 DT B C5 1
ATOM 130 C C7 . DT A 1 6 ? 23.350 21.050 32.880 1.00 0.00 ? ? ? ? ? ? 6 DT B C7 1
ATOM 131 C C6 . DT A 1 6 ? 23.680 20.080 35.120 1.00 0.00 ? ? ? ? ? ? 6 DT B C6 1
ATOM 132 H H3 . DT A 1 6 ? 20.050 19.070 35.400 1.00 0.00 ? ? ? ? ? ? 6 DT B H3 1
ATOM 133 P P . DG A 1 7 ? 27.660 15.900 37.780 1.00 0.00 ? ? ? ? ? ? 7 DG B P 1
ATOM 134 O OP1 . DG A 1 7 ? 28.440 15.370 38.930 1.00 0.00 ? ? ? ? ? ? 7 DG B OP1 1
ATOM 135 O OP2 . DG A 1 7 ? 28.390 16.180 36.510 1.00 0.00 ? ? ? ? ? ? 7 DG B OP2 1
ATOM 136 O "O5'" . DG A 1 7 ? 26.470 14.880 37.420 1.00 0.00 ? ? ? ? ? ? 7 DG B "O5'" 1
ATOM 137 C "C5'" . DG A 1 7 ? 25.230 14.820 38.170 1.00 0.00 ? ? ? ? ? ? 7 DG B "C5'" 1
ATOM 138 C "C4'" . DG A 1 7 ? 23.990 14.520 37.310 1.00 0.00 ? ? ? ? ? ? 7 DG B "C4'" 1
ATOM 139 O "O4'" . DG A 1 7 ? 23.700 15.530 36.320 1.00 0.00 ? ? ? ? ? ? 7 DG B "O4'" 1
ATOM 140 C "C3'" . DG A 1 7 ? 24.080 13.240 36.500 1.00 0.00 ? ? ? ? ? ? 7 DG B "C3'" 1
ATOM 141 O "O3'" . DG A 1 7 ? 23.060 12.310 36.920 1.00 0.00 ? ? ? ? ? ? 7 DG B "O3'" 1
ATOM 142 C "C2'" . DG A 1 7 ? 23.820 13.640 35.070 1.00 0.00 ? ? ? ? ? ? 7 DG B "C2'" 1
ATOM 143 C "C1'" . DG A 1 7 ? 22.950 14.870 35.300 1.00 0.00 ? ? ? ? ? ? 7 DG B "C1'" 1
ATOM 144 N N9 . DG A 1 7 ? 22.780 15.770 34.140 1.00 0.00 ? ? ? ? ? ? 7 DG B N9 1
ATOM 145 C C8 . DG A 1 7 ? 23.740 16.420 33.500 1.00 0.00 ? ? ? ? ? ? 7 DG B C8 1
ATOM 146 N N7 . DG A 1 7 ? 23.210 17.320 32.660 1.00 0.00 ? ? ? ? ? ? 7 DG B N7 1
ATOM 147 C C5 . DG A 1 7 ? 21.880 17.240 32.780 1.00 0.00 ? ? ? ? ? ? 7 DG B C5 1
ATOM 148 C C6 . DG A 1 7 ? 20.780 17.890 32.200 1.00 0.00 ? ? ? ? ? ? 7 DG B C6 1
ATOM 149 O O6 . DG A 1 7 ? 20.910 18.890 31.490 1.00 0.00 ? ? ? ? ? ? 7 DG B O6 1
ATOM 150 N N1 . DG A 1 7 ? 19.480 17.490 32.540 1.00 0.00 ? ? ? ? ? ? 7 DG B N1 1
ATOM 151 C C2 . DG A 1 7 ? 19.310 16.470 33.460 1.00 0.00 ? ? ? ? ? ? 7 DG B C2 1
ATOM 152 N N2 . DG A 1 7 ? 18.240 15.750 33.330 1.00 0.00 ? ? ? ? ? ? 7 DG B N2 1
ATOM 153 N N3 . DG A 1 7 ? 20.360 15.890 34.040 1.00 0.00 ? ? ? ? ? ? 7 DG B N3 1
ATOM 154 C C4 . DG A 1 7 ? 21.620 16.240 33.720 1.00 0.00 ? ? ? ? ? ? 7 DG B C4 1
ATOM 155 H H1 . DG A 1 7 ? 18.690 17.770 32.010 1.00 0.00 ? ? ? ? ? ? 7 DG B H1 1
ATOM 156 H H21 . DG A 1 7 ? 17.410 16.060 32.860 1.00 0.00 ? ? ? ? ? ? 7 DG B H21 1
ATOM 157 H H22 . DG A 1 7 ? 18.300 14.810 33.650 1.00 0.00 ? ? ? ? ? ? 7 DG B H22 1
ATOM 158 P P . DA A 1 8 ? 23.280 10.730 36.760 1.00 0.00 ? ? ? ? ? ? 8 DA B P 1
ATOM 159 O OP1 . DA A 1 8 ? 22.960 10.160 38.090 1.00 0.00 ? ? ? ? ? ? 8 DA B OP1 1
ATOM 160 O OP2 . DA A 1 8 ? 24.620 10.480 36.190 1.00 0.00 ? ? ? ? ? ? 8 DA B OP2 1
ATOM 161 O "O5'" . DA A 1 8 ? 22.240 10.280 35.630 1.00 0.00 ? ? ? ? ? ? 8 DA B "O5'" 1
ATOM 162 C "C5'" . DA A 1 8 ? 20.800 10.330 35.740 1.00 0.00 ? ? ? ? ? ? 8 DA B "C5'" 1
ATOM 163 C "C4'" . DA A 1 8 ? 20.150 10.660 34.400 1.00 0.00 ? ? ? ? ? ? 8 DA B "C4'" 1
ATOM 164 O "O4'" . DA A 1 8 ? 20.330 12.020 33.900 1.00 0.00 ? ? ? ? ? ? 8 DA B "O4'" 1
ATOM 165 C "C3'" . DA A 1 8 ? 20.620 9.740 33.280 1.00 0.00 ? ? ? ? ? ? 8 DA B "C3'" 1
ATOM 166 O "O3'" . DA A 1 8 ? 19.570 9.230 32.450 1.00 0.00 ? ? ? ? ? ? 8 DA B "O3'" 1
ATOM 167 C "C2'" . DA A 1 8 ? 21.400 10.660 32.390 1.00 0.00 ? ? ? ? ? ? 8 DA B "C2'" 1
ATOM 168 C "C1'" . DA A 1 8 ? 20.520 11.890 32.470 1.00 0.00 ? ? ? ? ? ? 8 DA B "C1'" 1
ATOM 169 N N9 . DA A 1 8 ? 21.090 13.090 31.800 1.00 0.00 ? ? ? ? ? ? 8 DA B N9 1
ATOM 170 C C8 . DA A 1 8 ? 22.390 13.340 31.660 1.00 0.00 ? ? ? ? ? ? 8 DA B C8 1
ATOM 171 N N7 . DA A 1 8 ? 22.590 14.370 30.850 1.00 0.00 ? ? ? ? ? ? 8 DA B N7 1
ATOM 172 C C5 . DA A 1 8 ? 21.400 14.790 30.470 1.00 0.00 ? ? ? ? ? ? 8 DA B C5 1
ATOM 173 C C6 . DA A 1 8 ? 20.930 15.870 29.720 1.00 0.00 ? ? ? ? ? ? 8 DA B C6 1
ATOM 174 N N6 . DA A 1 8 ? 21.770 16.580 28.990 1.00 0.00 ? ? ? ? ? ? 8 DA B N6 1
ATOM 175 N N1 . DA A 1 8 ? 19.610 16.080 29.570 1.00 0.00 ? ? ? ? ? ? 8 DA B N1 1
ATOM 176 C C2 . DA A 1 8 ? 18.710 15.260 30.110 1.00 0.00 ? ? ? ? ? ? 8 DA B C2 1
ATOM 177 N N3 . DA A 1 8 ? 19.120 14.230 30.850 1.00 0.00 ? ? ? ? ? ? 8 DA B N3 1
ATOM 178 C C4 . DA A 1 8 ? 20.430 13.980 31.060 1.00 0.00 ? ? ? ? ? ? 8 DA B C4 1
ATOM 179 H H61 . DA A 1 8 ? 21.530 17.480 28.620 1.00 0.00 ? ? ? ? ? ? 8 DA B H61 1
ATOM 180 H H62 . DA A 1 8 ? 22.640 16.150 28.730 1.00 0.00 ? ? ? ? ? ? 8 DA B H62 1
ATOM 181 P P . DG A 1 9 ? 18.370 8.320 33.000 1.00 0.00 ? ? ? ? ? ? 9 DG B P 1
ATOM 182 O OP1 . DG A 1 9 ? 17.340 9.180 33.650 1.00 0.00 ? ? ? ? ? ? 9 DG B OP1 1
ATOM 183 O OP2 . DG A 1 9 ? 18.890 7.140 33.720 1.00 0.00 ? ? ? ? ? ? 9 DG B OP2 1
ATOM 184 O "O5'" . DG A 1 9 ? 17.780 7.940 31.560 1.00 0.00 ? ? ? ? ? ? 9 DG B "O5'" 1
ATOM 185 C "C5'" . DG A 1 9 ? 16.960 8.920 30.890 1.00 0.00 ? ? ? ? ? ? 9 DG B "C5'" 1
ATOM 186 C "C4'" . DG A 1 9 ? 17.520 9.480 29.610 1.00 0.00 ? ? ? ? ? ? 9 DG B "C4'" 1
ATOM 187 O "O4'" . DG A 1 9 ? 18.570 10.450 29.690 1.00 0.00 ? ? ? ? ? ? 9 DG B "O4'" 1
ATOM 188 C "C3'" . DG A 1 9 ? 18.030 8.360 28.740 1.00 0.00 ? ? ? ? ? ? 9 DG B "C3'" 1
ATOM 189 O "O3'" . DG A 1 9 ? 17.220 8.330 27.560 1.00 0.00 ? ? ? ? ? ? 9 DG B "O3'" 1
ATOM 190 C "C2'" . DG A 1 9 ? 19.410 8.790 28.390 1.00 0.00 ? ? ? ? ? ? 9 DG B "C2'" 1
ATOM 191 C "C1'" . DG A 1 9 ? 19.150 10.290 28.390 1.00 0.00 ? ? ? ? ? ? 9 DG B "C1'" 1
ATOM 192 N N9 . DG A 1 9 ? 20.330 11.140 28.190 1.00 0.00 ? ? ? ? ? ? 9 DG B N9 1
ATOM 193 C C8 . DG A 1 9 ? 21.500 10.910 28.760 1.00 0.00 ? ? ? ? ? ? 9 DG B C8 1
ATOM 194 N N7 . DG A 1 9 ? 22.340 11.900 28.480 1.00 0.00 ? ? ? ? ? ? 9 DG B N7 1
ATOM 195 C C5 . DG A 1 9 ? 21.680 12.770 27.730 1.00 0.00 ? ? ? ? ? ? 9 DG B C5 1
ATOM 196 C C6 . DG A 1 9 ? 22.030 13.970 27.090 1.00 0.00 ? ? ? ? ? ? 9 DG B C6 1
ATOM 197 O O6 . DG A 1 9 ? 23.130 14.490 27.270 1.00 0.00 ? ? ? ? ? ? 9 DG B O6 1
ATOM 198 N N1 . DG A 1 9 ? 21.100 14.630 26.280 1.00 0.00 ? ? ? ? ? ? 9 DG B N1 1
ATOM 199 C C2 . DG A 1 9 ? 19.820 14.100 26.120 1.00 0.00 ? ? ? ? ? ? 9 DG B C2 1
ATOM 200 N N2 . DG A 1 9 ? 18.930 14.710 25.370 1.00 0.00 ? ? ? ? ? ? 9 DG B N2 1
ATOM 201 N N3 . DG A 1 9 ? 19.490 12.960 26.760 1.00 0.00 ? ? ? ? ? ? 9 DG B N3 1
ATOM 202 C C4 . DG A 1 9 ? 20.380 12.300 27.530 1.00 0.00 ? ? ? ? ? ? 9 DG B C4 1
ATOM 203 H H1 . DG A 1 9 ? 21.350 15.470 25.810 1.00 0.00 ? ? ? ? ? ? 9 DG B H1 1
ATOM 204 H H21 . DG A 1 9 ? 19.140 15.560 24.870 1.00 0.00 ? ? ? ? ? ? 9 DG B H21 1
ATOM 205 H H22 . DG A 1 9 ? 17.990 14.360 25.280 1.00 0.00 ? ? ? ? ? ? 9 DG B H22 1
ATOM 206 P P . DC A 1 10 ? 17.220 7.100 26.550 1.00 0.00 ? ? ? ? ? ? 10 DC B P 1
ATOM 207 O OP1 . DC A 1 10 ? 16.070 6.260 26.960 1.00 0.00 ? ? ? ? ? ? 10 DC B OP1 1
ATOM 208 O OP2 . DC A 1 10 ? 18.580 6.520 26.410 1.00 0.00 ? ? ? ? ? ? 10 DC B OP2 1
ATOM 209 O "O5'" . DC A 1 10 ? 16.910 7.900 25.210 1.00 0.00 ? ? ? ? ? ? 10 DC B "O5'" 1
ATOM 210 C "C5'" . DC A 1 10 ? 15.770 8.770 25.150 1.00 0.00 ? ? ? ? ? ? 10 DC B "C5'" 1
ATOM 211 C "C4'" . DC A 1 10 ? 15.960 9.890 24.130 1.00 0.00 ? ? ? ? ? ? 10 DC B "C4'" 1
ATOM 212 O "O4'" . DC A 1 10 ? 17.160 10.640 24.440 1.00 0.00 ? ? ? ? ? ? 10 DC B "O4'" 1
ATOM 213 C "C3'" . DC A 1 10 ? 16.180 9.370 22.720 1.00 0.00 ? ? ? ? ? ? 10 DC B "C3'" 1
ATOM 214 O "O3'" . DC A 1 10 ? 15.420 10.200 21.780 1.00 0.00 ? ? ? ? ? ? 10 DC B "O3'" 1
ATOM 215 C "C2'" . DC A 1 10 ? 17.680 9.360 22.560 1.00 0.00 ? ? ? ? ? ? 10 DC B "C2'" 1
ATOM 216 C "C1'" . DC A 1 10 ? 17.940 10.680 23.230 1.00 0.00 ? ? ? ? ? ? 10 DC B "C1'" 1
ATOM 217 N N1 . DC A 1 10 ? 19.380 10.880 23.540 1.00 0.00 ? ? ? ? ? ? 10 DC B N1 1
ATOM 218 C C2 . DC A 1 10 ? 20.060 12.050 23.150 1.00 0.00 ? ? ? ? ? ? 10 DC B C2 1
ATOM 219 O O2 . DC A 1 10 ? 19.590 12.820 22.310 1.00 0.00 ? ? ? ? ? ? 10 DC B O2 1
ATOM 220 N N3 . DC A 1 10 ? 21.310 12.260 23.590 1.00 0.00 ? ? ? ? ? ? 10 DC B N3 1
ATOM 221 C C4 . DC A 1 10 ? 21.930 11.370 24.390 1.00 0.00 ? ? ? ? ? ? 10 DC B C4 1
ATOM 222 N N4 . DC A 1 10 ? 23.190 11.660 24.600 1.00 0.00 ? ? ? ? ? ? 10 DC B N4 1
ATOM 223 C C5 . DC A 1 10 ? 21.320 10.170 24.790 1.00 0.00 ? ? ? ? ? ? 10 DC B C5 1
ATOM 224 C C6 . DC A 1 10 ? 20.020 9.930 24.320 1.00 0.00 ? ? ? ? ? ? 10 DC B C6 1
ATOM 225 H H41 . DC A 1 10 ? 23.560 12.450 24.110 1.00 0.00 ? ? ? ? ? ? 10 DC B H41 1
ATOM 226 H H42 . DC A 1 10 ? 23.760 11.110 25.220 1.00 0.00 ? ? ? ? ? ? 10 DC B H42 1
ATOM 227 P P . DG A 1 11 ? 15.250 9.800 20.220 1.00 0.00 ? ? ? ? ? ? 11 DG B P 1
ATOM 228 O OP1 . DG A 1 11 ? 13.950 10.240 19.670 1.00 0.00 ? ? ? ? ? ? 11 DG B OP1 1
ATOM 229 O OP2 . DG A 1 11 ? 15.530 8.360 20.050 1.00 0.00 ? ? ? ? ? ? 11 DG B OP2 1
ATOM 230 O "O5'" . DG A 1 11 ? 16.490 10.570 19.540 1.00 0.00 ? ? ? ? ? ? 11 DG B "O5'" 1
ATOM 231 C "C5'" . DG A 1 11 ? 16.380 11.850 18.890 1.00 0.00 ? ? ? ? ? ? 11 DG B "C5'" 1
ATOM 232 C "C4'" . DG A 1 11 ? 17.750 12.330 18.410 1.00 0.00 ? ? ? ? ? ? 11 DG B "C4'" 1
ATOM 233 O "O4'" . DG A 1 11 ? 18.730 12.430 19.470 1.00 0.00 ? ? ? ? ? ? 11 DG B "O4'" 1
ATOM 234 C "C3'" . DG A 1 11 ? 18.350 11.430 17.340 1.00 0.00 ? ? ? ? ? ? 11 DG B "C3'" 1
ATOM 235 O "O3'" . DG A 1 11 ? 18.000 11.770 15.980 1.00 0.00 ? ? ? ? ? ? 11 DG B "O3'" 1
ATOM 236 C "C2'" . DG A 1 11 ? 19.840 11.660 17.530 1.00 0.00 ? ? ? ? ? ? 11 DG B "C2'" 1
ATOM 237 C "C1'" . DG A 1 11 ? 19.940 12.600 18.720 1.00 0.00 ? ? ? ? ? ? 11 DG B "C1'" 1
ATOM 238 N N9 . DG A 1 11 ? 21.120 12.260 19.550 1.00 0.00 ? ? ? ? ? ? 11 DG B N9 1
ATOM 239 C C8 . DG A 1 11 ? 21.240 11.120 20.230 1.00 0.00 ? ? ? ? ? ? 11 DG B C8 1
ATOM 240 N N7 . DG A 1 11 ? 22.430 11.070 20.840 1.00 0.00 ? ? ? ? ? ? 11 DG B N7 1
ATOM 241 C C5 . DG A 1 11 ? 23.080 12.190 20.510 1.00 0.00 ? ? ? ? ? ? 11 DG B C5 1
ATOM 242 C C6 . DG A 1 11 ? 24.360 12.670 20.770 1.00 0.00 ? ? ? ? ? ? 11 DG B C6 1
ATOM 243 O O6 . DG A 1 11 ? 24.960 12.380 21.810 1.00 0.00 ? ? ? ? ? ? 11 DG B O6 1
ATOM 244 N N1 . DG A 1 11 ? 24.790 13.820 20.110 1.00 0.00 ? ? ? ? ? ? 11 DG B N1 1
ATOM 245 C C2 . DG A 1 11 ? 23.950 14.500 19.260 1.00 0.00 ? ? ? ? ? ? 11 DG B C2 1
ATOM 246 N N2 . DG A 1 11 ? 24.340 15.690 18.900 1.00 0.00 ? ? ? ? ? ? 11 DG B N2 1
ATOM 247 N N3 . DG A 1 11 ? 22.690 14.080 19.080 1.00 0.00 ? ? ? ? ? ? 11 DG B N3 1
ATOM 248 C C4 . DG A 1 11 ? 22.250 12.940 19.670 1.00 0.00 ? ? ? ? ? ? 11 DG B C4 1
ATOM 249 H "HO3'" . DG A 1 11 ? 17.020 11.980 15.720 1.00 0.00 ? ? ? ? ? ? 11 DG B "HO3'" 1
ATOM 250 H H1 . DG A 1 11 ? 25.650 14.240 20.390 1.00 0.00 ? ? ? ? ? ? 11 DG B H1 1
ATOM 251 H H21 . DG A 1 11 ? 25.300 15.940 18.950 1.00 0.00 ? ? ? ? ? ? 11 DG B H21 1
ATOM 252 H H22 . DG A 1 11 ? 23.660 16.430 18.850 1.00 0.00 ? ? ? ? ? ? 11 DG B H22 1
ATOM 253 O "O5'" . DC B 2 1 ? 33.280 17.670 18.830 1.00 0.00 ? ? ? ? ? ? 1 DC C "O5'" 1
ATOM 254 C "C5'" . DC B 2 1 ? 32.290 18.610 19.290 1.00 0.00 ? ? ? ? ? ? 1 DC C "C5'" 1
ATOM 255 C "C4'" . DC B 2 1 ? 30.880 18.030 19.290 1.00 0.00 ? ? ? ? ? ? 1 DC C "C4'" 1
ATOM 256 O "O4'" . DC B 2 1 ? 30.650 16.820 20.030 1.00 0.00 ? ? ? ? ? ? 1 DC C "O4'" 1
ATOM 257 C "C3'" . DC B 2 1 ? 29.780 18.990 19.780 1.00 0.00 ? ? ? ? ? ? 1 DC C "C3'" 1
ATOM 258 O "O3'" . DC B 2 1 ? 29.280 19.700 18.650 1.00 0.00 ? ? ? ? ? ? 1 DC C "O3'" 1
ATOM 259 C "C2'" . DC B 2 1 ? 28.700 18.090 20.320 1.00 0.00 ? ? ? ? ? ? 1 DC C "C2'" 1
ATOM 260 C "C1'" . DC B 2 1 ? 29.210 16.720 20.000 1.00 0.00 ? ? ? ? ? ? 1 DC C "C1'" 1
ATOM 261 N N1 . DC B 2 1 ? 28.720 15.740 20.990 1.00 0.00 ? ? ? ? ? ? 1 DC C N1 1
ATOM 262 C C2 . DC B 2 1 ? 27.870 14.690 20.590 1.00 0.00 ? ? ? ? ? ? 1 DC C C2 1
ATOM 263 O O2 . DC B 2 1 ? 27.350 14.690 19.480 1.00 0.00 ? ? ? ? ? ? 1 DC C O2 1
ATOM 264 N N3 . DC B 2 1 ? 27.350 13.880 21.540 1.00 0.00 ? ? ? ? ? ? 1 DC C N3 1
ATOM 265 C C4 . DC B 2 1 ? 27.590 14.080 22.850 1.00 0.00 ? ? ? ? ? ? 1 DC C C4 1
ATOM 266 N N4 . DC B 2 1 ? 27.250 13.050 23.590 1.00 0.00 ? ? ? ? ? ? 1 DC C N4 1
ATOM 267 C C5 . DC B 2 1 ? 28.350 15.160 23.320 1.00 0.00 ? ? ? ? ? ? 1 DC C C5 1
ATOM 268 C C6 . DC B 2 1 ? 28.960 15.960 22.360 1.00 0.00 ? ? ? ? ? ? 1 DC C C6 1
ATOM 269 H H41 . DC B 2 1 ? 26.800 12.320 23.090 1.00 0.00 ? ? ? ? ? ? 1 DC C H41 1
ATOM 270 H H42 . DC B 2 1 ? 27.400 13.020 24.590 1.00 0.00 ? ? ? ? ? ? 1 DC C H42 1
ATOM 271 H "HO5'" . DC B 2 1 ? 34.030 17.610 19.560 1.00 0.00 ? ? ? ? ? ? 1 DC C "HO5'" 1
ATOM 272 P P . DG B 2 2 ? 28.590 21.140 18.770 1.00 0.00 ? ? ? ? ? ? 2 DG C P 1
ATOM 273 O OP1 . DG B 2 2 ? 28.990 21.790 17.500 1.00 0.00 ? ? ? ? ? ? 2 DG C OP1 1
ATOM 274 O OP2 . DG B 2 2 ? 28.960 21.760 20.070 1.00 0.00 ? ? ? ? ? ? 2 DG C OP2 1
ATOM 275 O "O5'" . DG B 2 2 ? 27.050 20.730 18.870 1.00 0.00 ? ? ? ? ? ? 2 DG C "O5'" 1
ATOM 276 C "C5'" . DG B 2 2 ? 26.230 20.390 17.740 1.00 0.00 ? ? ? ? ? ? 2 DG C "C5'" 1
ATOM 277 C "C4'" . DG B 2 2 ? 24.850 19.980 18.240 1.00 0.00 ? ? ? ? ? ? 2 DG C "C4'" 1
ATOM 278 O "O4'" . DG B 2 2 ? 24.820 18.730 18.970 1.00 0.00 ? ? ? ? ? ? 2 DG C "O4'" 1
ATOM 279 C "C3'" . DG B 2 2 ? 24.300 21.080 19.140 1.00 0.00 ? ? ? ? ? ? 2 DG C "C3'" 1
ATOM 280 O "O3'" . DG B 2 2 ? 23.290 21.870 18.460 1.00 0.00 ? ? ? ? ? ? 2 DG C "O3'" 1
ATOM 281 C "C2'" . DG B 2 2 ? 23.880 20.350 20.400 1.00 0.00 ? ? ? ? ? ? 2 DG C "C2'" 1
ATOM 282 C "C1'" . DG B 2 2 ? 23.780 18.900 19.940 1.00 0.00 ? ? ? ? ? ? 2 DG C "C1'" 1
ATOM 283 N N9 . DG B 2 2 ? 24.020 17.920 21.030 1.00 0.00 ? ? ? ? ? ? 2 DG C N9 1
ATOM 284 C C8 . DG B 2 2 ? 25.110 17.840 21.800 1.00 0.00 ? ? ? ? ? ? 2 DG C C8 1
ATOM 285 N N7 . DG B 2 2 ? 24.990 16.830 22.660 1.00 0.00 ? ? ? ? ? ? 2 DG C N7 1
ATOM 286 C C5 . DG B 2 2 ? 23.800 16.240 22.450 1.00 0.00 ? ? ? ? ? ? 2 DG C C5 1
ATOM 287 C C6 . DG B 2 2 ? 23.120 15.140 22.980 1.00 0.00 ? ? ? ? ? ? 2 DG C C6 1
ATOM 288 O O6 . DG B 2 2 ? 23.400 14.630 24.060 1.00 0.00 ? ? ? ? ? ? 2 DG C O6 1
ATOM 289 N N1 . DG B 2 2 ? 21.900 14.760 22.410 1.00 0.00 ? ? ? ? ? ? 2 DG C N1 1
ATOM 290 C C2 . DG B 2 2 ? 21.360 15.480 21.360 1.00 0.00 ? ? ? ? ? ? 2 DG C C2 1
ATOM 291 N N2 . DG B 2 2 ? 20.090 15.460 21.080 1.00 0.00 ? ? ? ? ? ? 2 DG C N2 1
ATOM 292 N N3 . DG B 2 2 ? 22.010 16.550 20.890 1.00 0.00 ? ? ? ? ? ? 2 DG C N3 1
ATOM 293 C C4 . DG B 2 2 ? 23.200 16.940 21.400 1.00 0.00 ? ? ? ? ? ? 2 DG C C4 1
ATOM 294 H H1 . DG B 2 2 ? 21.380 14.010 22.830 1.00 0.00 ? ? ? ? ? ? 2 DG C H1 1
ATOM 295 H H21 . DG B 2 2 ? 19.490 14.680 21.210 1.00 0.00 ? ? ? ? ? ? 2 DG C H21 1
ATOM 296 H H22 . DG B 2 2 ? 19.730 16.340 20.770 1.00 0.00 ? ? ? ? ? ? 2 DG C H22 1
ATOM 297 P P . DC B 2 3 ? 22.460 23.100 19.110 1.00 0.00 ? ? ? ? ? ? 3 DC C P 1
ATOM 298 O OP1 . DC B 2 3 ? 21.830 23.940 18.060 1.00 0.00 ? ? ? ? ? ? 3 DC C OP1 1
ATOM 299 O OP2 . DC B 2 3 ? 23.220 23.800 20.160 1.00 0.00 ? ? ? ? ? ? 3 DC C OP2 1
ATOM 300 O "O5'" . DC B 2 3 ? 21.290 22.350 19.920 1.00 0.00 ? ? ? ? ? ? 3 DC C "O5'" 1
ATOM 301 C "C5'" . DC B 2 3 ? 20.300 21.520 19.290 1.00 0.00 ? ? ? ? ? ? 3 DC C "C5'" 1
ATOM 302 C "C4'" . DC B 2 3 ? 19.570 20.630 20.280 1.00 0.00 ? ? ? ? ? ? 3 DC C "C4'" 1
ATOM 303 O "O4'" . DC B 2 3 ? 20.380 19.640 20.960 1.00 0.00 ? ? ? ? ? ? 3 DC C "O4'" 1
ATOM 304 C "C3'" . DC B 2 3 ? 18.850 21.440 21.320 1.00 0.00 ? ? ? ? ? ? 3 DC C "C3'" 1
ATOM 305 O "O3'" . DC B 2 3 ? 17.440 21.410 21.060 1.00 0.00 ? ? ? ? ? ? 3 DC C "O3'" 1
ATOM 306 C "C2'" . DC B 2 3 ? 19.310 20.840 22.640 1.00 0.00 ? ? ? ? ? ? 3 DC C "C2'" 1
ATOM 307 C "C1'" . DC B 2 3 ? 19.730 19.430 22.230 1.00 0.00 ? ? ? ? ? ? 3 DC C "C1'" 1
ATOM 308 N N1 . DC B 2 3 ? 20.670 18.760 23.150 1.00 0.00 ? ? ? ? ? ? 3 DC C N1 1
ATOM 309 C C2 . DC B 2 3 ? 20.300 17.590 23.840 1.00 0.00 ? ? ? ? ? ? 3 DC C C2 1
ATOM 310 O O2 . DC B 2 3 ? 19.140 17.180 23.850 1.00 0.00 ? ? ? ? ? ? 3 DC C O2 1
ATOM 311 N N3 . DC B 2 3 ? 21.140 17.090 24.780 1.00 0.00 ? ? ? ? ? ? 3 DC C N3 1
ATOM 312 C C4 . DC B 2 3 ? 22.270 17.730 25.110 1.00 0.00 ? ? ? ? ? ? 3 DC C C4 1
ATOM 313 N N4 . DC B 2 3 ? 23.070 17.160 25.980 1.00 0.00 ? ? ? ? ? ? 3 DC C N4 1
ATOM 314 C C5 . DC B 2 3 ? 22.690 18.890 24.460 1.00 0.00 ? ? ? ? ? ? 3 DC C C5 1
ATOM 315 C C6 . DC B 2 3 ? 21.890 19.400 23.450 1.00 0.00 ? ? ? ? ? ? 3 DC C C6 1
ATOM 316 H H41 . DC B 2 3 ? 23.180 16.170 25.990 1.00 0.00 ? ? ? ? ? ? 3 DC C H41 1
ATOM 317 H H42 . DC B 2 3 ? 23.830 17.710 26.330 1.00 0.00 ? ? ? ? ? ? 3 DC C H42 1
ATOM 318 P P . DT B 2 4 ? 16.390 22.240 21.940 1.00 0.00 ? ? ? ? ? ? 4 DT C P 1
ATOM 319 O OP1 . DT B 2 4 ? 15.330 22.670 21.000 1.00 0.00 ? ? ? ? ? ? 4 DT C OP1 1
ATOM 320 O OP2 . DT B 2 4 ? 17.130 23.300 22.650 1.00 0.00 ? ? ? ? ? ? 4 DT C OP2 1
ATOM 321 O "O5'" . DT B 2 4 ? 15.920 21.110 22.960 1.00 0.00 ? ? ? ? ? ? 4 DT C "O5'" 1
ATOM 322 C "C5'" . DT B 2 4 ? 15.210 19.950 22.490 1.00 0.00 ? ? ? ? ? ? 4 DT C "C5'" 1
ATOM 323 C "C4'" . DT B 2 4 ? 14.910 18.940 23.590 1.00 0.00 ? ? ? ? ? ? 4 DT C "C4'" 1
ATOM 324 O "O4'" . DT B 2 4 ? 16.100 18.580 24.310 1.00 0.00 ? ? ? ? ? ? 4 DT C "O4'" 1
ATOM 325 C "C3'" . DT B 2 4 ? 13.940 19.420 24.650 1.00 0.00 ? ? ? ? ? ? 4 DT C "C3'" 1
ATOM 326 O "O3'" . DT B 2 4 ? 12.880 18.440 24.650 1.00 0.00 ? ? ? ? ? ? 4 DT C "O3'" 1
ATOM 327 C "C2'" . DT B 2 4 ? 14.720 19.600 25.910 1.00 0.00 ? ? ? ? ? ? 4 DT C "C2'" 1
ATOM 328 C "C1'" . DT B 2 4 ? 15.700 18.460 25.690 1.00 0.00 ? ? ? ? ? ? 4 DT C "C1'" 1
ATOM 329 N N1 . DT B 2 4 ? 16.980 18.620 26.400 1.00 0.00 ? ? ? ? ? ? 4 DT C N1 1
ATOM 330 C C2 . DT B 2 4 ? 17.640 17.540 27.010 1.00 0.00 ? ? ? ? ? ? 4 DT C C2 1
ATOM 331 O O2 . DT B 2 4 ? 17.080 16.470 27.260 1.00 0.00 ? ? ? ? ? ? 4 DT C O2 1
ATOM 332 N N3 . DT B 2 4 ? 18.940 17.730 27.480 1.00 0.00 ? ? ? ? ? ? 4 DT C N3 1
ATOM 333 C C4 . DT B 2 4 ? 19.580 18.960 27.330 1.00 0.00 ? ? ? ? ? ? 4 DT C C4 1
ATOM 334 O O4 . DT B 2 4 ? 20.640 19.100 27.950 1.00 0.00 ? ? ? ? ? ? 4 DT C O4 1
ATOM 335 C C5 . DT B 2 4 ? 18.940 20.040 26.720 1.00 0.00 ? ? ? ? ? ? 4 DT C C5 1
ATOM 336 C C7 . DT B 2 4 ? 19.610 21.390 26.510 1.00 0.00 ? ? ? ? ? ? 4 DT C C7 1
ATOM 337 C C6 . DT B 2 4 ? 17.620 19.860 26.280 1.00 0.00 ? ? ? ? ? ? 4 DT C C6 1
ATOM 338 H H3 . DT B 2 4 ? 19.310 17.060 28.120 1.00 0.00 ? ? ? ? ? ? 4 DT C H3 1
ATOM 339 P P . DC B 2 5 ? 11.390 18.780 25.110 1.00 0.00 ? ? ? ? ? ? 5 DC C P 1
ATOM 340 O OP1 . DC B 2 5 ? 10.500 17.910 24.310 1.00 0.00 ? ? ? ? ? ? 5 DC C OP1 1
ATOM 341 O OP2 . DC B 2 5 ? 11.150 20.240 25.020 1.00 0.00 ? ? ? ? ? ? 5 DC C OP2 1
ATOM 342 O "O5'" . DC B 2 5 ? 11.450 18.330 26.650 1.00 0.00 ? ? ? ? ? ? 5 DC C "O5'" 1
ATOM 343 C "C5'" . DC B 2 5 ? 11.530 16.940 27.010 1.00 0.00 ? ? ? ? ? ? 5 DC C "C5'" 1
ATOM 344 C "C4'" . DC B 2 5 ? 12.200 16.730 28.370 1.00 0.00 ? ? ? ? ? ? 5 DC C "C4'" 1
ATOM 345 O "O4'" . DC B 2 5 ? 13.580 17.100 28.380 1.00 0.00 ? ? ? ? ? ? 5 DC C "O4'" 1
ATOM 346 C "C3'" . DC B 2 5 ? 11.540 17.480 29.520 1.00 0.00 ? ? ? ? ? ? 5 DC C "C3'" 1
ATOM 347 O "O3'" . DC B 2 5 ? 10.530 16.640 30.140 1.00 0.00 ? ? ? ? ? ? 5 DC C "O3'" 1
ATOM 348 C "C2'" . DC B 2 5 ? 12.680 17.700 30.470 1.00 0.00 ? ? ? ? ? ? 5 DC C "C2'" 1
ATOM 349 C "C1'" . DC B 2 5 ? 13.900 17.110 29.780 1.00 0.00 ? ? ? ? ? ? 5 DC C "C1'" 1
ATOM 350 N N1 . DC B 2 5 ? 15.070 17.970 29.990 1.00 0.00 ? ? ? ? ? ? 5 DC C N1 1
ATOM 351 C C2 . DC B 2 5 ? 16.200 17.470 30.670 1.00 0.00 ? ? ? ? ? ? 5 DC C C2 1
ATOM 352 O O2 . DC B 2 5 ? 16.090 16.630 31.550 1.00 0.00 ? ? ? ? ? ? 5 DC C O2 1
ATOM 353 N N3 . DC B 2 5 ? 17.310 18.220 30.700 1.00 0.00 ? ? ? ? ? ? 5 DC C N3 1
ATOM 354 C C4 . DC B 2 5 ? 17.320 19.450 30.160 1.00 0.00 ? ? ? ? ? ? 5 DC C C4 1
ATOM 355 N N4 . DC B 2 5 ? 18.490 20.040 30.250 1.00 0.00 ? ? ? ? ? ? 5 DC C N4 1
ATOM 356 C C5 . DC B 2 5 ? 16.220 20.050 29.560 1.00 0.00 ? ? ? ? ? ? 5 DC C C5 1
ATOM 357 C C6 . DC B 2 5 ? 15.070 19.270 29.430 1.00 0.00 ? ? ? ? ? ? 5 DC C C6 1
ATOM 358 H H41 . DC B 2 5 ? 19.260 19.610 30.730 1.00 0.00 ? ? ? ? ? ? 5 DC C H41 1
ATOM 359 H H42 . DC B 2 5 ? 18.640 20.930 29.790 1.00 0.00 ? ? ? ? ? ? 5 DC C H42 1
ATOM 360 P P . DA B 2 6 ? 9.400 17.170 31.160 1.00 0.00 ? ? ? ? ? ? 6 DA C P 1
ATOM 361 O OP1 . DA B 2 6 ? 8.370 16.100 31.200 1.00 0.00 ? ? ? ? ? ? 6 DA C OP1 1
ATOM 362 O OP2 . DA B 2 6 ? 8.980 18.530 30.770 1.00 0.00 ? ? ? ? ? ? 6 DA C OP2 1
ATOM 363 O "O5'" . DA B 2 6 ? 10.120 17.210 32.590 1.00 0.00 ? ? ? ? ? ? 6 DA C "O5'" 1
ATOM 364 C "C5'" . DA B 2 6 ? 10.380 15.930 33.190 1.00 0.00 ? ? ? ? ? ? 6 DA C "C5'" 1
ATOM 365 C "C4'" . DA B 2 6 ? 11.470 15.890 34.240 1.00 0.00 ? ? ? ? ? ? 6 DA C "C4'" 1
ATOM 366 O "O4'" . DA B 2 6 ? 12.650 16.580 33.790 1.00 0.00 ? ? ? ? ? ? 6 DA C "O4'" 1
ATOM 367 C "C3'" . DA B 2 6 ? 11.030 16.660 35.470 1.00 0.00 ? ? ? ? ? ? 6 DA C "C3'" 1
ATOM 368 O "O3'" . DA B 2 6 ? 11.220 15.800 36.620 1.00 0.00 ? ? ? ? ? ? 6 DA C "O3'" 1
ATOM 369 C "C2'" . DA B 2 6 ? 11.780 17.950 35.430 1.00 0.00 ? ? ? ? ? ? 6 DA C "C2'" 1
ATOM 370 C "C1'" . DA B 2 6 ? 13.080 17.340 34.940 1.00 0.00 ? ? ? ? ? ? 6 DA C "C1'" 1
ATOM 371 N N9 . DA B 2 6 ? 14.050 18.370 34.560 1.00 0.00 ? ? ? ? ? ? 6 DA C N9 1
ATOM 372 C C8 . DA B 2 6 ? 13.800 19.240 33.600 1.00 0.00 ? ? ? ? ? ? 6 DA C C8 1
ATOM 373 N N7 . DA B 2 6 ? 14.930 19.770 33.120 1.00 0.00 ? ? ? ? ? ? 6 DA C N7 1
ATOM 374 C C5 . DA B 2 6 ? 15.900 19.300 33.900 1.00 0.00 ? ? ? ? ? ? 6 DA C C5 1
ATOM 375 C C6 . DA B 2 6 ? 17.230 19.670 34.120 1.00 0.00 ? ? ? ? ? ? 6 DA C C6 1
ATOM 376 N N6 . DA B 2 6 ? 17.980 20.160 33.160 1.00 0.00 ? ? ? ? ? ? 6 DA C N6 1
ATOM 377 N N1 . DA B 2 6 ? 17.910 19.260 35.200 1.00 0.00 ? ? ? ? ? ? 6 DA C N1 1
ATOM 378 C C2 . DA B 2 6 ? 17.360 18.410 36.070 1.00 0.00 ? ? ? ? ? ? 6 DA C C2 1
ATOM 379 N N3 . DA B 2 6 ? 16.100 18.000 35.880 1.00 0.00 ? ? ? ? ? ? 6 DA C N3 1
ATOM 380 C C4 . DA B 2 6 ? 15.350 18.420 34.830 1.00 0.00 ? ? ? ? ? ? 6 DA C C4 1
ATOM 381 H H61 . DA B 2 6 ? 18.920 20.410 33.450 1.00 0.00 ? ? ? ? ? ? 6 DA C H61 1
ATOM 382 H H62 . DA B 2 6 ? 17.780 20.030 32.190 1.00 0.00 ? ? ? ? ? ? 6 DA C H62 1
ATOM 383 P P . DC B 2 7 ? 10.910 16.270 38.120 1.00 0.00 ? ? ? ? ? ? 7 DC C P 1
ATOM 384 O OP1 . DC B 2 7 ? 10.370 15.100 38.830 1.00 0.00 ? ? ? ? ? ? 7 DC C OP1 1
ATOM 385 O OP2 . DC B 2 7 ? 10.110 17.530 38.140 1.00 0.00 ? ? ? ? ? ? 7 DC C OP2 1
ATOM 386 O "O5'" . DC B 2 7 ? 12.390 16.590 38.640 1.00 0.00 ? ? ? ? ? ? 7 DC C "O5'" 1
ATOM 387 C "C5'" . DC B 2 7 ? 13.430 15.590 38.730 1.00 0.00 ? ? ? ? ? ? 7 DC C "C5'" 1
ATOM 388 C "C4'" . DC B 2 7 ? 14.710 16.090 39.400 1.00 0.00 ? ? ? ? ? ? 7 DC C "C4'" 1
ATOM 389 O "O4'" . DC B 2 7 ? 15.320 17.220 38.740 1.00 0.00 ? ? ? ? ? ? 7 DC C "O4'" 1
ATOM 390 C "C3'" . DC B 2 7 ? 14.330 16.540 40.780 1.00 0.00 ? ? ? ? ? ? 7 DC C "C3'" 1
ATOM 391 O "O3'" . DC B 2 7 ? 15.200 15.970 41.760 1.00 0.00 ? ? ? ? ? ? 7 DC C "O3'" 1
ATOM 392 C "C2'" . DC B 2 7 ? 14.230 18.050 40.660 1.00 0.00 ? ? ? ? ? ? 7 DC C "C2'" 1
ATOM 393 C "C1'" . DC B 2 7 ? 15.380 18.310 39.700 1.00 0.00 ? ? ? ? ? ? 7 DC C "C1'" 1
ATOM 394 N N1 . DC B 2 7 ? 15.290 19.540 38.870 1.00 0.00 ? ? ? ? ? ? 7 DC C N1 1
ATOM 395 C C2 . DC B 2 7 ? 16.460 20.280 38.590 1.00 0.00 ? ? ? ? ? ? 7 DC C C2 1
ATOM 396 O O2 . DC B 2 7 ? 17.520 20.080 39.180 1.00 0.00 ? ? ? ? ? ? 7 DC C O2 1
ATOM 397 N N3 . DC B 2 7 ? 16.440 21.240 37.640 1.00 0.00 ? ? ? ? ? ? 7 DC C N3 1
ATOM 398 C C4 . DC B 2 7 ? 15.300 21.530 36.980 1.00 0.00 ? ? ? ? ? ? 7 DC C C4 1
ATOM 399 N N4 . DC B 2 7 ? 15.430 22.440 36.040 1.00 0.00 ? ? ? ? ? ? 7 DC C N4 1
ATOM 400 C C5 . DC B 2 7 ? 14.090 20.860 37.210 1.00 0.00 ? ? ? ? ? ? 7 DC C C5 1
ATOM 401 C C6 . DC B 2 7 ? 14.100 19.850 38.180 1.00 0.00 ? ? ? ? ? ? 7 DC C C6 1
ATOM 402 H H41 . DC B 2 7 ? 16.320 22.760 35.740 1.00 0.00 ? ? ? ? ? ? 7 DC C H41 1
ATOM 403 H H42 . DC B 2 7 ? 14.610 22.770 35.520 1.00 0.00 ? ? ? ? ? ? 7 DC C H42 1
ATOM 404 P P . DA B 2 8 ? 14.710 15.840 43.280 1.00 0.00 ? ? ? ? ? ? 8 DA C P 1
ATOM 405 O OP1 . DA B 2 8 ? 14.800 14.410 43.660 1.00 0.00 ? ? ? ? ? ? 8 DA C OP1 1
ATOM 406 O OP2 . DA B 2 8 ? 13.420 16.550 43.430 1.00 0.00 ? ? ? ? ? ? 8 DA C OP2 1
ATOM 407 O "O5'" . DA B 2 8 ? 15.830 16.650 44.070 1.00 0.00 ? ? ? ? ? ? 8 DA C "O5'" 1
ATOM 408 C "C5'" . DA B 2 8 ? 17.200 16.260 43.870 1.00 0.00 ? ? ? ? ? ? 8 DA C "C5'" 1
ATOM 409 C "C4'" . DA B 2 8 ? 18.150 17.450 43.910 1.00 0.00 ? ? ? ? ? ? 8 DA C "C4'" 1
ATOM 410 O "O4'" . DA B 2 8 ? 17.720 18.440 42.970 1.00 0.00 ? ? ? ? ? ? 8 DA C "O4'" 1
ATOM 411 C "C3'" . DA B 2 8 ? 18.090 18.090 45.280 1.00 0.00 ? ? ? ? ? ? 8 DA C "C3'" 1
ATOM 412 O "O3'" . DA B 2 8 ? 19.410 18.330 45.850 1.00 0.00 ? ? ? ? ? ? 8 DA C "O3'" 1
ATOM 413 C "C2'" . DA B 2 8 ? 17.350 19.380 45.030 1.00 0.00 ? ? ? ? ? ? 8 DA C "C2'" 1
ATOM 414 C "C1'" . DA B 2 8 ? 17.960 19.680 43.670 1.00 0.00 ? ? ? ? ? ? 8 DA C "C1'" 1
ATOM 415 N N9 . DA B 2 8 ? 17.250 20.680 42.850 1.00 0.00 ? ? ? ? ? ? 8 DA C N9 1
ATOM 416 C C8 . DA B 2 8 ? 15.930 20.730 42.800 1.00 0.00 ? ? ? ? ? ? 8 DA C C8 1
ATOM 417 N N7 . DA B 2 8 ? 15.510 21.640 41.920 1.00 0.00 ? ? ? ? ? ? 8 DA C N7 1
ATOM 418 C C5 . DA B 2 8 ? 16.620 22.190 41.410 1.00 0.00 ? ? ? ? ? ? 8 DA C C5 1
ATOM 419 C C6 . DA B 2 8 ? 16.870 23.060 40.340 1.00 0.00 ? ? ? ? ? ? 8 DA C C6 1
ATOM 420 N N6 . DA B 2 8 ? 15.910 23.710 39.710 1.00 0.00 ? ? ? ? ? ? 8 DA C N6 1
ATOM 421 N N1 . DA B 2 8 ? 18.120 23.270 39.890 1.00 0.00 ? ? ? ? ? ? 8 DA C N1 1
ATOM 422 C C2 . DA B 2 8 ? 19.160 22.650 40.460 1.00 0.00 ? ? ? ? ? ? 8 DA C C2 1
ATOM 423 N N3 . DA B 2 8 ? 18.970 21.830 41.490 1.00 0.00 ? ? ? ? ? ? 8 DA C N3 1
ATOM 424 C C4 . DA B 2 8 ? 17.730 21.570 41.980 1.00 0.00 ? ? ? ? ? ? 8 DA C C4 1
ATOM 425 H H61 . DA B 2 8 ? 16.160 24.270 38.920 1.00 0.00 ? ? ? ? ? ? 8 DA C H61 1
ATOM 426 H H62 . DA B 2 8 ? 14.950 23.630 40.000 1.00 0.00 ? ? ? ? ? ? 8 DA C H62 1
ATOM 427 P P . DA B 2 9 ? 20.360 17.180 46.460 1.00 0.00 ? ? ? ? ? ? 9 DA C P 1
ATOM 428 O OP1 . DA B 2 9 ? 20.670 16.150 45.440 1.00 0.00 ? ? ? ? ? ? 9 DA C OP1 1
ATOM 429 O OP2 . DA B 2 9 ? 19.790 16.750 47.760 1.00 0.00 ? ? ? ? ? ? 9 DA C OP2 1
ATOM 430 O "O5'" . DA B 2 9 ? 21.720 17.920 46.880 1.00 0.00 ? ? ? ? ? ? 9 DA C "O5'" 1
ATOM 431 C "C5'" . DA B 2 9 ? 22.600 18.420 45.860 1.00 0.00 ? ? ? ? ? ? 9 DA C "C5'" 1
ATOM 432 C "C4'" . DA B 2 9 ? 22.560 19.940 45.740 1.00 0.00 ? ? ? ? ? ? 9 DA C "C4'" 1
ATOM 433 O "O4'" . DA B 2 9 ? 21.390 20.640 45.260 1.00 0.00 ? ? ? ? ? ? 9 DA C "O4'" 1
ATOM 434 C "C3'" . DA B 2 9 ? 22.970 20.600 47.040 1.00 0.00 ? ? ? ? ? ? 9 DA C "C3'" 1
ATOM 435 O "O3'" . DA B 2 9 ? 24.390 20.790 46.990 1.00 0.00 ? ? ? ? ? ? 9 DA C "O3'" 1
ATOM 436 C "C2'" . DA B 2 9 ? 22.150 21.850 47.110 1.00 0.00 ? ? ? ? ? ? 9 DA C "C2'" 1
ATOM 437 C "C1'" . DA B 2 9 ? 21.630 22.000 45.680 1.00 0.00 ? ? ? ? ? ? 9 DA C "C1'" 1
ATOM 438 N N9 . DA B 2 9 ? 20.350 22.740 45.660 1.00 0.00 ? ? ? ? ? ? 9 DA C N9 1
ATOM 439 C C8 . DA B 2 9 ? 19.280 22.400 46.360 1.00 0.00 ? ? ? ? ? ? 9 DA C C8 1
ATOM 440 N N7 . DA B 2 9 ? 18.180 22.970 45.850 1.00 0.00 ? ? ? ? ? ? 9 DA C N7 1
ATOM 441 C C5 . DA B 2 9 ? 18.570 23.670 44.790 1.00 0.00 ? ? ? ? ? ? 9 DA C C5 1
ATOM 442 C C6 . DA B 2 9 ? 17.970 24.430 43.780 1.00 0.00 ? ? ? ? ? ? 9 DA C C6 1
ATOM 443 N N6 . DA B 2 9 ? 16.670 24.580 43.650 1.00 0.00 ? ? ? ? ? ? 9 DA C N6 1
ATOM 444 N N1 . DA B 2 9 ? 18.680 25.030 42.800 1.00 0.00 ? ? ? ? ? ? 9 DA C N1 1
ATOM 445 C C2 . DA B 2 9 ? 20.010 24.930 42.790 1.00 0.00 ? ? ? ? ? ? 9 DA C C2 1
ATOM 446 N N3 . DA B 2 9 ? 20.640 24.210 43.720 1.00 0.00 ? ? ? ? ? ? 9 DA C N3 1
ATOM 447 C C4 . DA B 2 9 ? 19.960 23.570 44.700 1.00 0.00 ? ? ? ? ? ? 9 DA C C4 1
ATOM 448 H H61 . DA B 2 9 ? 16.330 25.200 42.940 1.00 0.00 ? ? ? ? ? ? 9 DA C H61 1
ATOM 449 H H62 . DA B 2 9 ? 16.040 24.190 44.340 1.00 0.00 ? ? ? ? ? ? 9 DA C H62 1
ATOM 450 P P . DT B 2 10 ? 25.260 21.500 48.140 1.00 0.00 ? ? ? ? ? ? 10 DT C P 1
ATOM 451 O OP1 . DT B 2 10 ? 26.600 20.870 48.060 1.00 0.00 ? ? ? ? ? ? 10 DT C OP1 1
ATOM 452 O OP2 . DT B 2 10 ? 24.530 21.440 49.430 1.00 0.00 ? ? ? ? ? ? 10 DT C OP2 1
ATOM 453 O "O5'" . DT B 2 10 ? 25.350 23.040 47.690 1.00 0.00 ? ? ? ? ? ? 10 DT C "O5'" 1
ATOM 454 C "C5'" . DT B 2 10 ? 25.880 23.400 46.400 1.00 0.00 ? ? ? ? ? ? 10 DT C "C5'" 1
ATOM 455 C "C4'" . DT B 2 10 ? 25.410 24.710 45.790 1.00 0.00 ? ? ? ? ? ? 10 DT C "C4'" 1
ATOM 456 O "O4'" . DT B 2 10 ? 23.980 24.760 45.630 1.00 0.00 ? ? ? ? ? ? 10 DT C "O4'" 1
ATOM 457 C "C3'" . DT B 2 10 ? 25.810 25.930 46.610 1.00 0.00 ? ? ? ? ? ? 10 DT C "C3'" 1
ATOM 458 O "O3'" . DT B 2 10 ? 26.740 26.780 45.900 1.00 0.00 ? ? ? ? ? ? 10 DT C "O3'" 1
ATOM 459 C "C2'" . DT B 2 10 ? 24.510 26.650 46.890 1.00 0.00 ? ? ? ? ? ? 10 DT C "C2'" 1
ATOM 460 C "C1'" . DT B 2 10 ? 23.640 26.140 45.770 1.00 0.00 ? ? ? ? ? ? 10 DT C "C1'" 1
ATOM 461 N N1 . DT B 2 10 ? 22.190 26.230 46.090 1.00 0.00 ? ? ? ? ? ? 10 DT C N1 1
ATOM 462 C C2 . DT B 2 10 ? 21.300 27.000 45.310 1.00 0.00 ? ? ? ? ? ? 10 DT C C2 1
ATOM 463 O O2 . DT B 2 10 ? 21.610 27.350 44.180 1.00 0.00 ? ? ? ? ? ? 10 DT C O2 1
ATOM 464 N N3 . DT B 2 10 ? 19.940 27.040 45.660 1.00 0.00 ? ? ? ? ? ? 10 DT C N3 1
ATOM 465 C C4 . DT B 2 10 ? 19.460 26.270 46.720 1.00 0.00 ? ? ? ? ? ? 10 DT C C4 1
ATOM 466 O O4 . DT B 2 10 ? 18.260 25.990 46.660 1.00 0.00 ? ? ? ? ? ? 10 DT C O4 1
ATOM 467 C C5 . DT B 2 10 ? 20.340 25.540 47.520 1.00 0.00 ? ? ? ? ? ? 10 DT C C5 1
ATOM 468 C C7 . DT B 2 10 ? 19.930 24.920 48.860 1.00 0.00 ? ? ? ? ? ? 10 DT C C7 1
ATOM 469 C C6 . DT B 2 10 ? 21.690 25.510 47.200 1.00 0.00 ? ? ? ? ? ? 10 DT C C6 1
ATOM 470 H H3 . DT B 2 10 ? 19.340 27.740 45.270 1.00 0.00 ? ? ? ? ? ? 10 DT C H3 1
ATOM 471 P P . DT B 2 11 ? 27.460 28.020 46.650 1.00 0.00 ? ? ? ? ? ? 11 DT C P 1
ATOM 472 O OP1 . DT B 2 11 ? 28.720 28.370 45.940 1.00 0.00 ? ? ? ? ? ? 11 DT C OP1 1
ATOM 473 O OP2 . DT B 2 11 ? 27.610 27.680 48.080 1.00 0.00 ? ? ? ? ? ? 11 DT C OP2 1
ATOM 474 O "O5'" . DT B 2 11 ? 26.350 29.190 46.650 1.00 0.00 ? ? ? ? ? ? 11 DT C "O5'" 1
ATOM 475 C "C5'" . DT B 2 11 ? 25.900 29.910 45.480 1.00 0.00 ? ? ? ? ? ? 11 DT C "C5'" 1
ATOM 476 C "C4'" . DT B 2 11 ? 24.540 30.590 45.670 1.00 0.00 ? ? ? ? ? ? 11 DT C "C4'" 1
ATOM 477 O "O4'" . DT B 2 11 ? 23.540 29.650 46.090 1.00 0.00 ? ? ? ? ? ? 11 DT C "O4'" 1
ATOM 478 C "C3'" . DT B 2 11 ? 24.460 31.700 46.710 1.00 0.00 ? ? ? ? ? ? 11 DT C "C3'" 1
ATOM 479 O "O3'" . DT B 2 11 ? 24.740 33.020 46.220 1.00 0.00 ? ? ? ? ? ? 11 DT C "O3'" 1
ATOM 480 C "C2'" . DT B 2 11 ? 22.990 31.740 47.080 1.00 0.00 ? ? ? ? ? ? 11 DT C "C2'" 1
ATOM 481 C "C1'" . DT B 2 11 ? 22.430 30.480 46.430 1.00 0.00 ? ? ? ? ? ? 11 DT C "C1'" 1
ATOM 482 N N1 . DT B 2 11 ? 21.560 29.760 47.390 1.00 0.00 ? ? ? ? ? ? 11 DT C N1 1
ATOM 483 C C2 . DT B 2 11 ? 20.170 29.920 47.310 1.00 0.00 ? ? ? ? ? ? 11 DT C C2 1
ATOM 484 O O2 . DT B 2 11 ? 19.620 29.940 46.210 1.00 0.00 ? ? ? ? ? ? 11 DT C O2 1
ATOM 485 N N3 . DT B 2 11 ? 19.380 29.510 48.380 1.00 0.00 ? ? ? ? ? ? 11 DT C N3 1
ATOM 486 C C4 . DT B 2 11 ? 19.940 28.820 49.460 1.00 0.00 ? ? ? ? ? ? 11 DT C C4 1
ATOM 487 O O4 . DT B 2 11 ? 19.170 28.020 49.990 1.00 0.00 ? ? ? ? ? ? 11 DT C O4 1
ATOM 488 C C5 . DT B 2 11 ? 21.320 28.650 49.550 1.00 0.00 ? ? ? ? ? ? 11 DT C C5 1
ATOM 489 C C7 . DT B 2 11 ? 21.990 28.060 50.790 1.00 0.00 ? ? ? ? ? ? 11 DT C C7 1
ATOM 490 C C6 . DT B 2 11 ? 22.120 29.110 48.510 1.00 0.00 ? ? ? ? ? ? 11 DT C C6 1
ATOM 491 H "HO3'" . DT B 2 11 ? 25.720 33.030 45.940 1.00 0.00 ? ? ? ? ? ? 11 DT C "HO3'" 1
ATOM 492 H H3 . DT B 2 11 ? 18.440 29.840 48.450 1.00 0.00 ? ? ? ? ? ? 11 DT C H3 1
ATOM 493 N N . MET C 3 1 ? 27.960 27.500 6.070 1.00 0.00 ? ? ? ? ? ? 1 MET A N 1
ATOM 494 C CA . MET C 3 1 ? 27.910 28.670 6.970 1.00 0.00 ? ? ? ? ? ? 1 MET A CA 1
ATOM 495 C C . MET C 3 1 ? 28.300 28.280 8.410 1.00 0.00 ? ? ? ? ? ? 1 MET A C 1
ATOM 496 O O . MET C 3 1 ? 28.040 27.180 8.890 1.00 0.00 ? ? ? ? ? ? 1 MET A O 1
ATOM 497 C CB . MET C 3 1 ? 26.500 29.280 6.980 1.00 0.00 ? ? ? ? ? ? 1 MET A CB 1
ATOM 498 C CG . MET C 3 1 ? 26.140 29.930 5.650 1.00 0.00 ? ? ? ? ? ? 1 MET A CG 1
ATOM 499 S SD . MET C 3 1 ? 26.900 31.580 5.430 1.00 0.00 ? ? ? ? ? ? 1 MET A SD 1
ATOM 500 C CE . MET C 3 1 ? 26.360 31.940 3.770 1.00 0.00 ? ? ? ? ? ? 1 MET A CE 1
ATOM 501 H H1 . MET C 3 1 ? 27.340 26.800 6.430 1.00 0.00 ? ? ? ? ? ? 1 MET A H1 1
ATOM 502 H H2 . MET C 3 1 ? 27.690 27.730 5.140 1.00 0.00 ? ? ? ? ? ? 1 MET A H2 1
ATOM 503 H H3 . MET C 3 1 ? 28.910 27.170 6.080 1.00 0.00 ? ? ? ? ? ? 1 MET A H3 1
ATOM 504 N N . LYS C 3 2 ? 28.880 29.280 9.060 1.00 0.00 ? ? ? ? ? ? 2 LYS A N 1
ATOM 505 C CA . LYS C 3 2 ? 29.320 29.300 10.470 1.00 0.00 ? ? ? ? ? ? 2 LYS A CA 1
ATOM 506 C C . LYS C 3 2 ? 28.280 28.560 11.340 1.00 0.00 ? ? ? ? ? ? 2 LYS A C 1
ATOM 507 O O . LYS C 3 2 ? 27.140 29.030 11.440 1.00 0.00 ? ? ? ? ? ? 2 LYS A O 1
ATOM 508 C CB . LYS C 3 2 ? 29.500 30.750 10.940 1.00 0.00 ? ? ? ? ? ? 2 LYS A CB 1
ATOM 509 C CG . LYS C 3 2 ? 29.910 30.840 12.410 1.00 0.00 ? ? ? ? ? ? 2 LYS A CG 1
ATOM 510 C CD . LYS C 3 2 ? 30.340 32.240 12.840 1.00 0.00 ? ? ? ? ? ? 2 LYS A CD 1
ATOM 511 C CE . LYS C 3 2 ? 31.460 32.180 13.890 1.00 0.00 ? ? ? ? ? ? 2 LYS A CE 1
ATOM 512 N NZ . LYS C 3 2 ? 31.090 31.610 15.200 1.00 0.00 ? ? ? ? ? ? 2 LYS A NZ 1
ATOM 513 H H . LYS C 3 2 ? 28.960 30.170 8.570 1.00 0.00 ? ? ? ? ? ? 2 LYS A H 1
ATOM 514 H HZ1 . LYS C 3 2 ? 30.240 32.000 15.540 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ1 1
ATOM 515 H HZ2 . LYS C 3 2 ? 30.940 30.620 15.150 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ2 1
ATOM 516 H HZ3 . LYS C 3 2 ? 31.820 31.770 15.890 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ3 1
ATOM 517 N N . PRO C 3 3 ? 28.630 27.380 11.860 1.00 0.00 ? ? ? ? ? ? 3 PRO A N 1
ATOM 518 C CA . PRO C 3 3 ? 27.650 26.540 12.560 1.00 0.00 ? ? ? ? ? ? 3 PRO A CA 1
ATOM 519 C C . PRO C 3 3 ? 27.460 27.020 14.000 1.00 0.00 ? ? ? ? ? ? 3 PRO A C 1
ATOM 520 O O . PRO C 3 3 ? 28.120 26.570 14.930 1.00 0.00 ? ? ? ? ? ? 3 PRO A O 1
ATOM 521 C CB . PRO C 3 3 ? 28.160 25.110 12.370 1.00 0.00 ? ? ? ? ? ? 3 PRO A CB 1
ATOM 522 C CG . PRO C 3 3 ? 29.670 25.240 12.200 1.00 0.00 ? ? ? ? ? ? 3 PRO A CG 1
ATOM 523 C CD . PRO C 3 3 ? 29.900 26.650 11.650 1.00 0.00 ? ? ? ? ? ? 3 PRO A CD 1
ATOM 524 N N . VAL C 3 4 ? 26.560 27.990 14.090 1.00 0.00 ? ? ? ? ? ? 4 VAL A N 1
ATOM 525 C CA . VAL C 3 4 ? 26.220 28.700 15.340 1.00 0.00 ? ? ? ? ? ? 4 VAL A CA 1
ATOM 526 C C . VAL C 3 4 ? 25.270 27.810 16.160 1.00 0.00 ? ? ? ? ? ? 4 VAL A C 1
ATOM 527 O O . VAL C 3 4 ? 24.060 27.820 15.940 1.00 0.00 ? ? ? ? ? ? 4 VAL A O 1
ATOM 528 C CB . VAL C 3 4 ? 25.540 30.060 15.050 1.00 0.00 ? ? ? ? ? ? 4 VAL A CB 1
ATOM 529 C CG1 . VAL C 3 4 ? 25.300 30.850 16.350 1.00 0.00 ? ? ? ? ? ? 4 VAL A CG1 1
ATOM 530 C CG2 . VAL C 3 4 ? 26.340 30.940 14.090 1.00 0.00 ? ? ? ? ? ? 4 VAL A CG2 1
ATOM 531 H H . VAL C 3 4 ? 26.040 28.300 13.290 1.00 0.00 ? ? ? ? ? ? 4 VAL A H 1
ATOM 532 N N . THR C 3 5 ? 25.870 27.230 17.190 1.00 0.00 ? ? ? ? ? ? 5 THR A N 1
ATOM 533 C CA . THR C 3 5 ? 25.170 26.410 18.210 1.00 0.00 ? ? ? ? ? ? 5 THR A CA 1
ATOM 534 C C . THR C 3 5 ? 24.430 27.300 19.210 1.00 0.00 ? ? ? ? ? ? 5 THR A C 1
ATOM 535 O O . THR C 3 5 ? 24.770 28.470 19.370 1.00 0.00 ? ? ? ? ? ? 5 THR A O 1
ATOM 536 C CB . THR C 3 5 ? 26.120 25.530 19.050 1.00 0.00 ? ? ? ? ? ? 5 THR A CB 1
ATOM 537 O OG1 . THR C 3 5 ? 27.230 26.240 19.620 1.00 0.00 ? ? ? ? ? ? 5 THR A OG1 1
ATOM 538 C CG2 . THR C 3 5 ? 26.530 24.250 18.320 1.00 0.00 ? ? ? ? ? ? 5 THR A CG2 1
ATOM 539 H H . THR C 3 5 ? 26.800 27.540 17.440 1.00 0.00 ? ? ? ? ? ? 5 THR A H 1
ATOM 540 H HG1 . THR C 3 5 ? 27.650 26.900 18.950 1.00 0.00 ? ? ? ? ? ? 5 THR A HG1 1
ATOM 541 N N . LEU C 3 6 ? 23.560 26.690 20.020 1.00 0.00 ? ? ? ? ? ? 6 LEU A N 1
ATOM 542 C CA . LEU C 3 6 ? 23.050 27.360 21.240 1.00 0.00 ? ? ? ? ? ? 6 LEU A CA 1
ATOM 543 C C . LEU C 3 6 ? 24.160 27.970 22.110 1.00 0.00 ? ? ? ? ? ? 6 LEU A C 1
ATOM 544 O O . LEU C 3 6 ? 24.040 29.130 22.510 1.00 0.00 ? ? ? ? ? ? 6 LEU A O 1
ATOM 545 C CB . LEU C 3 6 ? 22.240 26.420 22.130 1.00 0.00 ? ? ? ? ? ? 6 LEU A CB 1
ATOM 546 C CG . LEU C 3 6 ? 20.920 25.970 21.480 1.00 0.00 ? ? ? ? ? ? 6 LEU A CG 1
ATOM 547 C CD1 . LEU C 3 6 ? 20.340 24.850 22.340 1.00 0.00 ? ? ? ? ? ? 6 LEU A CD1 1
ATOM 548 C CD2 . LEU C 3 6 ? 19.910 27.100 21.290 1.00 0.00 ? ? ? ? ? ? 6 LEU A CD2 1
ATOM 549 H H . LEU C 3 6 ? 23.120 25.810 19.790 1.00 0.00 ? ? ? ? ? ? 6 LEU A H 1
ATOM 550 N N . TYR C 3 7 ? 25.260 27.230 22.280 1.00 0.00 ? ? ? ? ? ? 7 TYR A N 1
ATOM 551 C CA . TYR C 3 7 ? 26.380 27.660 23.160 1.00 0.00 ? ? ? ? ? ? 7 TYR A CA 1
ATOM 552 C C . TYR C 3 7 ? 26.920 29.050 22.800 1.00 0.00 ? ? ? ? ? ? 7 TYR A C 1
ATOM 553 O O . TYR C 3 7 ? 26.920 29.930 23.660 1.00 0.00 ? ? ? ? ? ? 7 TYR A O 1
ATOM 554 C CB . TYR C 3 7 ? 27.560 26.680 23.180 1.00 0.00 ? ? ? ? ? ? 7 TYR A CB 1
ATOM 555 C CG . TYR C 3 7 ? 27.260 25.290 23.760 1.00 0.00 ? ? ? ? ? ? 7 TYR A CG 1
ATOM 556 C CD1 . TYR C 3 7 ? 26.860 24.290 22.850 1.00 0.00 ? ? ? ? ? ? 7 TYR A CD1 1
ATOM 557 C CD2 . TYR C 3 7 ? 27.750 24.960 25.050 1.00 0.00 ? ? ? ? ? ? 7 TYR A CD2 1
ATOM 558 C CE1 . TYR C 3 7 ? 26.990 22.940 23.200 1.00 0.00 ? ? ? ? ? ? 7 TYR A CE1 1
ATOM 559 C CE2 . TYR C 3 7 ? 27.890 23.600 25.410 1.00 0.00 ? ? ? ? ? ? 7 TYR A CE2 1
ATOM 560 C CZ . TYR C 3 7 ? 27.520 22.610 24.470 1.00 0.00 ? ? ? ? ? ? 7 TYR A CZ 1
ATOM 561 O OH . TYR C 3 7 ? 27.760 21.300 24.760 1.00 0.00 ? ? ? ? ? ? 7 TYR A OH 1
ATOM 562 H H . TYR C 3 7 ? 25.380 26.360 21.810 1.00 0.00 ? ? ? ? ? ? 7 TYR A H 1
ATOM 563 H HH . TYR C 3 7 ? 26.910 20.920 25.220 1.00 0.00 ? ? ? ? ? ? 7 TYR A HH 1
ATOM 564 N N . ASP C 3 8 ? 26.960 29.290 21.490 1.00 0.00 ? ? ? ? ? ? 8 ASP A N 1
ATOM 565 C CA . ASP C 3 8 ? 27.420 30.510 20.800 1.00 0.00 ? ? ? ? ? ? 8 ASP A CA 1
ATOM 566 C C . ASP C 3 8 ? 26.540 31.740 21.040 1.00 0.00 ? ? ? ? ? ? 8 ASP A C 1
ATOM 567 O O . ASP C 3 8 ? 27.060 32.820 21.320 1.00 0.00 ? ? ? ? ? ? 8 ASP A O 1
ATOM 568 C CB . ASP C 3 8 ? 27.420 30.230 19.310 1.00 0.00 ? ? ? ? ? ? 8 ASP A CB 1
ATOM 569 C CG . ASP C 3 8 ? 28.580 29.330 18.890 1.00 0.00 ? ? ? ? ? ? 8 ASP A CG 1
ATOM 570 O OD1 . ASP C 3 8 ? 29.730 29.710 19.180 1.00 0.00 ? ? ? ? ? ? 8 ASP A OD1 1
ATOM 571 O OD2 . ASP C 3 8 ? 28.330 28.340 18.180 1.00 0.00 ? ? ? ? ? ? 8 ASP A OD2 1
ATOM 572 H H . ASP C 3 8 ? 26.650 28.600 20.840 1.00 0.00 ? ? ? ? ? ? 8 ASP A H 1
ATOM 573 N N . VAL C 3 9 ? 25.240 31.570 20.800 1.00 0.00 ? ? ? ? ? ? 9 VAL A N 1
ATOM 574 C CA . VAL C 3 9 ? 24.270 32.640 21.130 1.00 0.00 ? ? ? ? ? ? 9 VAL A CA 1
ATOM 575 C C . VAL C 3 9 ? 24.240 32.930 22.630 1.00 0.00 ? ? ? ? ? ? 9 VAL A C 1
ATOM 576 O O . VAL C 3 9 ? 24.470 34.060 23.040 1.00 0.00 ? ? ? ? ? ? 9 VAL A O 1
ATOM 577 C CB . VAL C 3 9 ? 22.840 32.430 20.570 1.00 0.00 ? ? ? ? ? ? 9 VAL A CB 1
ATOM 578 C CG1 . VAL C 3 9 ? 22.700 33.140 19.230 1.00 0.00 ? ? ? ? ? ? 9 VAL A CG1 1
ATOM 579 C CG2 . VAL C 3 9 ? 22.380 30.970 20.490 1.00 0.00 ? ? ? ? ? ? 9 VAL A CG2 1
ATOM 580 H H . VAL C 3 9 ? 24.860 30.690 20.500 1.00 0.00 ? ? ? ? ? ? 9 VAL A H 1
ATOM 581 N N . ALA C 3 10 ? 24.300 31.850 23.400 1.00 0.00 ? ? ? ? ? ? 10 ALA A N 1
ATOM 582 C CA . ALA C 3 10 ? 24.270 31.910 24.870 1.00 0.00 ? ? ? ? ? ? 10 ALA A CA 1
ATOM 583 C C . ALA C 3 10 ? 25.460 32.720 25.450 1.00 0.00 ? ? ? ? ? ? 10 ALA A C 1
ATOM 584 O O . ALA C 3 10 ? 25.250 33.730 26.140 1.00 0.00 ? ? ? ? ? ? 10 ALA A O 1
ATOM 585 C CB . ALA C 3 10 ? 24.260 30.500 25.460 1.00 0.00 ? ? ? ? ? ? 10 ALA A CB 1
ATOM 586 H H . ALA C 3 10 ? 24.410 30.940 23.000 1.00 0.00 ? ? ? ? ? ? 10 ALA A H 1
ATOM 587 N N . GLU C 3 11 ? 26.660 32.350 25.010 1.00 0.00 ? ? ? ? ? ? 11 GLU A N 1
ATOM 588 C CA . GLU C 3 11 ? 27.930 33.050 25.340 1.00 0.00 ? ? ? ? ? ? 11 GLU A CA 1
ATOM 589 C C . GLU C 3 11 ? 27.930 34.560 25.060 1.00 0.00 ? ? ? ? ? ? 11 GLU A C 1
ATOM 590 O O . GLU C 3 11 ? 28.080 35.350 26.000 1.00 0.00 ? ? ? ? ? ? 11 GLU A O 1
ATOM 591 C CB . GLU C 3 11 ? 29.130 32.410 24.630 1.00 0.00 ? ? ? ? ? ? 11 GLU A CB 1
ATOM 592 C CG . GLU C 3 11 ? 29.550 31.070 25.250 1.00 0.00 ? ? ? ? ? ? 11 GLU A CG 1
ATOM 593 C CD . GLU C 3 11 ? 30.460 30.260 24.320 1.00 0.00 ? ? ? ? ? ? 11 GLU A CD 1
ATOM 594 O OE1 . GLU C 3 11 ? 31.520 30.790 23.920 1.00 0.00 ? ? ? ? ? ? 11 GLU A OE1 1
ATOM 595 O OE2 . GLU C 3 11 ? 30.140 29.070 24.110 1.00 0.00 ? ? ? ? ? ? 11 GLU A OE2 1
ATOM 596 H H . GLU C 3 11 ? 26.770 31.430 24.620 1.00 0.00 ? ? ? ? ? ? 11 GLU A H 1
ATOM 597 N N . TYR C 3 12 ? 27.480 34.910 23.850 1.00 0.00 ? ? ? ? ? ? 12 TYR A N 1
ATOM 598 C CA . TYR C 3 12 ? 27.310 36.280 23.350 1.00 0.00 ? ? ? ? ? ? 12 TYR A CA 1
ATOM 599 C C . TYR C 3 12 ? 26.210 37.070 24.090 1.00 0.00 ? ? ? ? ? ? 12 TYR A C 1
ATOM 600 O O . TYR C 3 12 ? 26.340 38.270 24.310 1.00 0.00 ? ? ? ? ? ? 12 TYR A O 1
ATOM 601 C CB . TYR C 3 12 ? 26.900 36.090 21.880 1.00 0.00 ? ? ? ? ? ? 12 TYR A CB 1
ATOM 602 C CG . TYR C 3 12 ? 26.840 37.380 21.060 1.00 0.00 ? ? ? ? ? ? 12 TYR A CG 1
ATOM 603 C CD1 . TYR C 3 12 ? 28.050 37.900 20.570 1.00 0.00 ? ? ? ? ? ? 12 TYR A CD1 1
ATOM 604 C CD2 . TYR C 3 12 ? 25.600 38.020 20.840 1.00 0.00 ? ? ? ? ? ? 12 TYR A CD2 1
ATOM 605 C CE1 . TYR C 3 12 ? 28.040 39.100 19.850 1.00 0.00 ? ? ? ? ? ? 12 TYR A CE1 1
ATOM 606 C CE2 . TYR C 3 12 ? 25.590 39.220 20.120 1.00 0.00 ? ? ? ? ? ? 12 TYR A CE2 1
ATOM 607 C CZ . TYR C 3 12 ? 26.800 39.740 19.620 1.00 0.00 ? ? ? ? ? ? 12 TYR A CZ 1
ATOM 608 O OH . TYR C 3 12 ? 26.750 40.740 18.710 1.00 0.00 ? ? ? ? ? ? 12 TYR A OH 1
ATOM 609 H H . TYR C 3 12 ? 27.240 34.220 23.170 1.00 0.00 ? ? ? ? ? ? 12 TYR A H 1
ATOM 610 H HH . TYR C 3 12 ? 27.690 40.830 18.270 1.00 0.00 ? ? ? ? ? ? 12 TYR A HH 1
ATOM 611 N N . ALA C 3 13 ? 25.120 36.380 24.390 1.00 0.00 ? ? ? ? ? ? 13 ALA A N 1
ATOM 612 C CA . ALA C 3 13 ? 23.940 37.010 25.030 1.00 0.00 ? ? ? ? ? ? 13 ALA A CA 1
ATOM 613 C C . ALA C 3 13 ? 24.160 37.330 26.510 1.00 0.00 ? ? ? ? ? ? 13 ALA A C 1
ATOM 614 O O . ALA C 3 13 ? 23.950 38.470 26.910 1.00 0.00 ? ? ? ? ? ? 13 ALA A O 1
ATOM 615 C CB . ALA C 3 13 ? 22.690 36.150 24.870 1.00 0.00 ? ? ? ? ? ? 13 ALA A CB 1
ATOM 616 H H . ALA C 3 13 ? 24.990 35.430 24.080 1.00 0.00 ? ? ? ? ? ? 13 ALA A H 1
ATOM 617 N N . GLY C 3 14 ? 24.790 36.410 27.240 1.00 0.00 ? ? ? ? ? ? 14 GLY A N 1
ATOM 618 C CA . GLY C 3 14 ? 24.990 36.520 28.700 1.00 0.00 ? ? ? ? ? ? 14 GLY A CA 1
ATOM 619 C C . GLY C 3 14 ? 24.240 35.450 29.520 1.00 0.00 ? ? ? ? ? ? 14 GLY A C 1
ATOM 620 O O . GLY C 3 14 ? 23.980 35.620 30.720 1.00 0.00 ? ? ? ? ? ? 14 GLY A O 1
ATOM 621 H H . GLY C 3 14 ? 25.280 35.650 26.790 1.00 0.00 ? ? ? ? ? ? 14 GLY A H 1
ATOM 622 N N . VAL C 3 15 ? 24.090 34.300 28.890 1.00 0.00 ? ? ? ? ? ? 15 VAL A N 1
ATOM 623 C CA . VAL C 3 15 ? 23.310 33.140 29.380 1.00 0.00 ? ? ? ? ? ? 15 VAL A CA 1
ATOM 624 C C . VAL C 3 15 ? 24.000 31.790 29.080 1.00 0.00 ? ? ? ? ? ? 15 VAL A C 1
ATOM 625 O O . VAL C 3 15 ? 24.890 31.670 28.240 1.00 0.00 ? ? ? ? ? ? 15 VAL A O 1
ATOM 626 C CB . VAL C 3 15 ? 21.840 33.090 28.950 1.00 0.00 ? ? ? ? ? ? 15 VAL A CB 1
ATOM 627 C CG1 . VAL C 3 15 ? 20.980 33.770 30.020 1.00 0.00 ? ? ? ? ? ? 15 VAL A CG1 1
ATOM 628 C CG2 . VAL C 3 15 ? 21.520 33.690 27.590 1.00 0.00 ? ? ? ? ? ? 15 VAL A CG2 1
ATOM 629 H H . VAL C 3 15 ? 24.640 34.100 28.070 1.00 0.00 ? ? ? ? ? ? 15 VAL A H 1
ATOM 630 N N . SER C 3 16 ? 23.540 30.790 29.820 1.00 0.00 ? ? ? ? ? ? 16 SER A N 1
ATOM 631 C CA . SER C 3 16 ? 23.980 29.400 29.670 1.00 0.00 ? ? ? ? ? ? 16 SER A CA 1
ATOM 632 C C . SER C 3 16 ? 23.200 28.720 28.530 1.00 0.00 ? ? ? ? ? ? 16 SER A C 1
ATOM 633 O O . SER C 3 16 ? 22.030 29.050 28.290 1.00 0.00 ? ? ? ? ? ? 16 SER A O 1
ATOM 634 C CB . SER C 3 16 ? 23.770 28.680 31.010 1.00 0.00 ? ? ? ? ? ? 16 SER A CB 1
ATOM 635 O OG . SER C 3 16 ? 22.420 28.260 31.230 1.00 0.00 ? ? ? ? ? ? 16 SER A OG 1
ATOM 636 H H . SER C 3 16 ? 22.890 30.940 30.580 1.00 0.00 ? ? ? ? ? ? 16 SER A H 1
ATOM 637 H HG . SER C 3 16 ? 21.820 29.050 31.450 1.00 0.00 ? ? ? ? ? ? 16 SER A HG 1
ATOM 638 N N . TYR C 3 17 ? 23.860 27.800 27.840 1.00 0.00 ? ? ? ? ? ? 17 TYR A N 1
ATOM 639 C CA . TYR C 3 17 ? 23.270 27.060 26.700 1.00 0.00 ? ? ? ? ? ? 17 TYR A CA 1
ATOM 640 C C . TYR C 3 17 ? 21.930 26.390 27.050 1.00 0.00 ? ? ? ? ? ? 17 TYR A C 1
ATOM 641 O O . TYR C 3 17 ? 21.060 26.250 26.190 1.00 0.00 ? ? ? ? ? ? 17 TYR A O 1
ATOM 642 C CB . TYR C 3 17 ? 24.330 26.080 26.170 1.00 0.00 ? ? ? ? ? ? 17 TYR A CB 1
ATOM 643 C CG . TYR C 3 17 ? 24.160 24.590 26.480 1.00 0.00 ? ? ? ? ? ? 17 TYR A CG 1
ATOM 644 C CD1 . TYR C 3 17 ? 23.380 23.870 25.560 1.00 0.00 ? ? ? ? ? ? 17 TYR A CD1 1
ATOM 645 C CD2 . TYR C 3 17 ? 24.730 23.960 27.620 1.00 0.00 ? ? ? ? ? ? 17 TYR A CD2 1
ATOM 646 C CE1 . TYR C 3 17 ? 23.130 22.510 25.790 1.00 0.00 ? ? ? ? ? ? 17 TYR A CE1 1
ATOM 647 C CE2 . TYR C 3 17 ? 24.480 22.590 27.850 1.00 0.00 ? ? ? ? ? ? 17 TYR A CE2 1
ATOM 648 C CZ . TYR C 3 17 ? 23.660 21.890 26.930 1.00 0.00 ? ? ? ? ? ? 17 TYR A CZ 1
ATOM 649 O OH . TYR C 3 17 ? 23.140 20.660 27.200 1.00 0.00 ? ? ? ? ? ? 17 TYR A OH 1
ATOM 650 H H . TYR C 3 17 ? 24.770 27.470 28.110 1.00 0.00 ? ? ? ? ? ? 17 TYR A H 1
ATOM 651 H HH . TYR C 3 17 ? 23.290 20.370 28.170 1.00 0.00 ? ? ? ? ? ? 17 TYR A HH 1
ATOM 652 N N . GLN C 3 18 ? 21.760 26.020 28.320 1.00 0.00 ? ? ? ? ? ? 18 GLN A N 1
ATOM 653 C CA . GLN C 3 18 ? 20.500 25.480 28.870 1.00 0.00 ? ? ? ? ? ? 18 GLN A CA 1
ATOM 654 C C . GLN C 3 18 ? 19.280 26.410 28.700 1.00 0.00 ? ? ? ? ? ? 18 GLN A C 1
ATOM 655 O O . GLN C 3 18 ? 18.160 25.960 28.440 1.00 0.00 ? ? ? ? ? ? 18 GLN A O 1
ATOM 656 C CB . GLN C 3 18 ? 20.760 25.220 30.350 1.00 0.00 ? ? ? ? ? ? 18 GLN A CB 1
ATOM 657 C CG . GLN C 3 18 ? 19.990 24.020 30.910 1.00 0.00 ? ? ? ? ? ? 18 GLN A CG 1
ATOM 658 C CD . GLN C 3 18 ? 20.040 22.790 30.010 1.00 0.00 ? ? ? ? ? ? 18 GLN A CD 1
ATOM 659 O OE1 . GLN C 3 18 ? 19.080 22.500 29.320 1.00 0.00 ? ? ? ? ? ? 18 GLN A OE1 1
ATOM 660 N NE2 . GLN C 3 18 ? 21.060 21.960 30.090 1.00 0.00 ? ? ? ? ? ? 18 GLN A NE2 1
ATOM 661 H H . GLN C 3 18 ? 22.550 25.950 28.940 1.00 0.00 ? ? ? ? ? ? 18 GLN A H 1
ATOM 662 H HE21 . GLN C 3 18 ? 21.950 22.290 30.490 1.00 0.00 ? ? ? ? ? ? 18 GLN A HE21 1
ATOM 663 H HE22 . GLN C 3 18 ? 21.100 21.150 29.510 1.00 0.00 ? ? ? ? ? ? 18 GLN A HE22 1
ATOM 664 N N . THR C 3 19 ? 19.530 27.640 29.120 1.00 0.00 ? ? ? ? ? ? 19 THR A N 1
ATOM 665 C CA . THR C 3 19 ? 18.600 28.790 29.200 1.00 0.00 ? ? ? ? ? ? 19 THR A CA 1
ATOM 666 C C . THR C 3 19 ? 18.180 29.210 27.780 1.00 0.00 ? ? ? ? ? ? 19 THR A C 1
ATOM 667 O O . THR C 3 19 ? 17.000 29.220 27.460 1.00 0.00 ? ? ? ? ? ? 19 THR A O 1
ATOM 668 C CB . THR C 3 19 ? 19.350 29.910 29.950 1.00 0.00 ? ? ? ? ? ? 19 THR A CB 1
ATOM 669 O OG1 . THR C 3 19 ? 19.920 29.400 31.160 1.00 0.00 ? ? ? ? ? ? 19 THR A OG1 1
ATOM 670 C CG2 . THR C 3 19 ? 18.510 31.130 30.310 1.00 0.00 ? ? ? ? ? ? 19 THR A CG2 1
ATOM 671 H H . THR C 3 19 ? 20.430 27.830 29.490 1.00 0.00 ? ? ? ? ? ? 19 THR A H 1
ATOM 672 H HG1 . THR C 3 19 ? 19.250 29.530 31.930 1.00 0.00 ? ? ? ? ? ? 19 THR A HG1 1
ATOM 673 N N . VAL C 3 20 ? 19.160 29.340 26.890 1.00 0.00 ? ? ? ? ? ? 20 VAL A N 1
ATOM 674 C CA . VAL C 3 20 ? 18.940 29.560 25.440 1.00 0.00 ? ? ? ? ? ? 20 VAL A CA 1
ATOM 675 C C . VAL C 3 20 ? 18.220 28.370 24.760 1.00 0.00 ? ? ? ? ? ? 20 VAL A C 1
ATOM 676 O O . VAL C 3 20 ? 17.330 28.580 23.940 1.00 0.00 ? ? ? ? ? ? 20 VAL A O 1
ATOM 677 C CB . VAL C 3 20 ? 20.290 30.030 24.870 1.00 0.00 ? ? ? ? ? ? 20 VAL A CB 1
ATOM 678 C CG1 . VAL C 3 20 ? 20.470 30.050 23.360 1.00 0.00 ? ? ? ? ? ? 20 VAL A CG1 1
ATOM 679 C CG2 . VAL C 3 20 ? 20.440 31.470 25.320 1.00 0.00 ? ? ? ? ? ? 20 VAL A CG2 1
ATOM 680 H H . VAL C 3 20 ? 20.120 29.440 27.170 1.00 0.00 ? ? ? ? ? ? 20 VAL A H 1
ATOM 681 N N . SER C 3 21 ? 18.480 27.170 25.260 1.00 0.00 ? ? ? ? ? ? 21 SER A N 1
ATOM 682 C CA . SER C 3 21 ? 17.640 25.970 24.980 1.00 0.00 ? ? ? ? ? ? 21 SER A CA 1
ATOM 683 C C . SER C 3 21 ? 16.190 26.120 25.450 1.00 0.00 ? ? ? ? ? ? 21 SER A C 1
ATOM 684 O O . SER C 3 21 ? 15.300 26.040 24.620 1.00 0.00 ? ? ? ? ? ? 21 SER A O 1
ATOM 685 C CB . SER C 3 21 ? 18.250 24.690 25.560 1.00 0.00 ? ? ? ? ? ? 21 SER A CB 1
ATOM 686 O OG . SER C 3 21 ? 17.380 23.580 25.340 1.00 0.00 ? ? ? ? ? ? 21 SER A OG 1
ATOM 687 H H . SER C 3 21 ? 19.360 26.990 25.730 1.00 0.00 ? ? ? ? ? ? 21 SER A H 1
ATOM 688 H HG . SER C 3 21 ? 17.280 23.470 24.320 1.00 0.00 ? ? ? ? ? ? 21 SER A HG 1
ATOM 689 N N . ARG C 3 22 ? 15.980 26.470 26.720 1.00 0.00 ? ? ? ? ? ? 22 ARG A N 1
ATOM 690 C CA . ARG C 3 22 ? 14.660 26.790 27.310 1.00 0.00 ? ? ? ? ? ? 22 ARG A CA 1
ATOM 691 C C . ARG C 3 22 ? 14.040 28.170 26.960 1.00 0.00 ? ? ? ? ? ? 22 ARG A C 1
ATOM 692 O O . ARG C 3 22 ? 13.220 28.730 27.680 1.00 0.00 ? ? ? ? ? ? 22 ARG A O 1
ATOM 693 C CB . ARG C 3 22 ? 14.840 26.590 28.810 1.00 0.00 ? ? ? ? ? ? 22 ARG A CB 1
ATOM 694 C CG . ARG C 3 22 ? 15.160 25.140 29.160 1.00 0.00 ? ? ? ? ? ? 22 ARG A CG 1
ATOM 695 C CD . ARG C 3 22 ? 14.710 24.980 30.600 1.00 0.00 ? ? ? ? ? ? 22 ARG A CD 1
ATOM 696 N NE . ARG C 3 22 ? 15.140 23.680 31.120 1.00 0.00 ? ? ? ? ? ? 22 ARG A NE 1
ATOM 697 C CZ . ARG C 3 22 ? 16.170 23.490 31.960 1.00 0.00 ? ? ? ? ? ? 22 ARG A CZ 1
ATOM 698 N NH1 . ARG C 3 22 ? 16.900 24.520 32.400 1.00 0.00 ? ? ? ? ? ? 22 ARG A NH1 1
ATOM 699 N NH2 . ARG C 3 22 ? 16.430 22.240 32.340 1.00 0.00 ? ? ? ? ? ? 22 ARG A NH2 1
ATOM 700 H H . ARG C 3 22 ? 16.680 26.290 27.420 1.00 0.00 ? ? ? ? ? ? 22 ARG A H 1
ATOM 701 H HE . ARG C 3 22 ? 14.490 22.940 30.980 1.00 0.00 ? ? ? ? ? ? 22 ARG A HE 1
ATOM 702 H HH11 . ARG C 3 22 ? 16.800 25.410 31.940 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH11 1
ATOM 703 H HH12 . ARG C 3 22 ? 17.570 24.420 33.130 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH12 1
ATOM 704 H HH21 . ARG C 3 22 ? 15.770 21.530 32.100 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH21 1
ATOM 705 H HH22 . ARG C 3 22 ? 17.200 21.980 32.930 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH22 1
ATOM 706 N N . VAL C 3 23 ? 14.620 28.800 25.950 1.00 0.00 ? ? ? ? ? ? 23 VAL A N 1
ATOM 707 C CA . VAL C 3 23 ? 13.950 29.820 25.110 1.00 0.00 ? ? ? ? ? ? 23 VAL A CA 1
ATOM 708 C C . VAL C 3 23 ? 13.140 29.160 23.970 1.00 0.00 ? ? ? ? ? ? 23 VAL A C 1
ATOM 709 O O . VAL C 3 23 ? 11.990 29.500 23.700 1.00 0.00 ? ? ? ? ? ? 23 VAL A O 1
ATOM 710 C CB . VAL C 3 23 ? 15.070 30.780 24.640 1.00 0.00 ? ? ? ? ? ? 23 VAL A CB 1
ATOM 711 C CG1 . VAL C 3 23 ? 14.740 31.620 23.400 1.00 0.00 ? ? ? ? ? ? 23 VAL A CG1 1
ATOM 712 C CG2 . VAL C 3 23 ? 15.450 31.700 25.790 1.00 0.00 ? ? ? ? ? ? 23 VAL A CG2 1
ATOM 713 H H . VAL C 3 23 ? 15.610 28.870 25.930 1.00 0.00 ? ? ? ? ? ? 23 VAL A H 1
ATOM 714 N N . VAL C 3 24 ? 13.750 28.110 23.430 1.00 0.00 ? ? ? ? ? ? 24 VAL A N 1
ATOM 715 C CA . VAL C 3 24 ? 13.250 27.320 22.290 1.00 0.00 ? ? ? ? ? ? 24 VAL A CA 1
ATOM 716 C C . VAL C 3 24 ? 12.370 26.160 22.780 1.00 0.00 ? ? ? ? ? ? 24 VAL A C 1
ATOM 717 O O . VAL C 3 24 ? 11.160 26.140 22.550 1.00 0.00 ? ? ? ? ? ? 24 VAL A O 1
ATOM 718 C CB . VAL C 3 24 ? 14.540 26.920 21.540 1.00 0.00 ? ? ? ? ? ? 24 VAL A CB 1
ATOM 719 C CG1 . VAL C 3 24 ? 14.380 25.780 20.550 1.00 0.00 ? ? ? ? ? ? 24 VAL A CG1 1
ATOM 720 C CG2 . VAL C 3 24 ? 15.180 28.150 20.870 1.00 0.00 ? ? ? ? ? ? 24 VAL A CG2 1
ATOM 721 H H . VAL C 3 24 ? 14.620 27.760 23.790 1.00 0.00 ? ? ? ? ? ? 24 VAL A H 1
ATOM 722 N N . ASN C 3 25 ? 12.970 25.240 23.540 1.00 0.00 ? ? ? ? ? ? 25 ASN A N 1
ATOM 723 C CA . ASN C 3 25 ? 12.330 24.020 24.060 1.00 0.00 ? ? ? ? ? ? 25 ASN A CA 1
ATOM 724 C C . ASN C 3 25 ? 12.630 23.770 25.540 1.00 0.00 ? ? ? ? ? ? 25 ASN A C 1
ATOM 725 O O . ASN C 3 25 ? 13.700 24.100 26.060 1.00 0.00 ? ? ? ? ? ? 25 ASN A O 1
ATOM 726 C CB . ASN C 3 25 ? 12.780 22.830 23.210 1.00 0.00 ? ? ? ? ? ? 25 ASN A CB 1
ATOM 727 C CG . ASN C 3 25 ? 11.850 22.640 22.020 1.00 0.00 ? ? ? ? ? ? 25 ASN A CG 1
ATOM 728 O OD1 . ASN C 3 25 ? 10.640 22.470 22.140 1.00 0.00 ? ? ? ? ? ? 25 ASN A OD1 1
ATOM 729 N ND2 . ASN C 3 25 ? 12.400 22.510 20.830 1.00 0.00 ? ? ? ? ? ? 25 ASN A ND2 1
ATOM 730 H H . ASN C 3 25 ? 13.940 25.330 23.800 1.00 0.00 ? ? ? ? ? ? 25 ASN A H 1
ATOM 731 H HD21 . ASN C 3 25 ? 13.410 22.470 20.780 1.00 0.00 ? ? ? ? ? ? 25 ASN A HD21 1
ATOM 732 H HD22 . ASN C 3 25 ? 11.840 22.490 20.010 1.00 0.00 ? ? ? ? ? ? 25 ASN A HD22 1
ATOM 733 N N . GLN C 3 26 ? 11.600 23.240 26.200 1.00 0.00 ? ? ? ? ? ? 26 GLN A N 1
ATOM 734 C CA . GLN C 3 26 ? 11.420 23.150 27.660 1.00 0.00 ? ? ? ? ? ? 26 GLN A CA 1
ATOM 735 C C . GLN C 3 26 ? 11.400 24.560 28.290 1.00 0.00 ? ? ? ? ? ? 26 GLN A C 1
ATOM 736 O O . GLN C 3 26 ? 11.720 24.750 29.470 1.00 0.00 ? ? ? ? ? ? 26 GLN A O 1
ATOM 737 C CB . GLN C 3 26 ? 12.440 22.210 28.330 1.00 0.00 ? ? ? ? ? ? 26 GLN A CB 1
ATOM 738 C CG . GLN C 3 26 ? 11.770 21.520 29.510 1.00 0.00 ? ? ? ? ? ? 26 GLN A CG 1
ATOM 739 C CD . GLN C 3 26 ? 12.480 21.800 30.840 1.00 0.00 ? ? ? ? ? ? 26 GLN A CD 1
ATOM 740 O OE1 . GLN C 3 26 ? 13.500 21.210 31.160 1.00 0.00 ? ? ? ? ? ? 26 GLN A OE1 1
ATOM 741 N NE2 . GLN C 3 26 ? 12.110 22.820 31.580 1.00 0.00 ? ? ? ? ? ? 26 GLN A NE2 1
ATOM 742 H H . GLN C 3 26 ? 10.810 22.890 25.690 1.00 0.00 ? ? ? ? ? ? 26 GLN A H 1
ATOM 743 H HE21 . GLN C 3 26 ? 11.500 23.540 31.230 1.00 0.00 ? ? ? ? ? ? 26 GLN A HE21 1
ATOM 744 H HE22 . GLN C 3 26 ? 12.540 22.920 32.480 1.00 0.00 ? ? ? ? ? ? 26 GLN A HE22 1
ATOM 745 N N . ALA C 3 27 ? 10.780 25.490 27.570 1.00 0.00 ? ? ? ? ? ? 27 ALA A N 1
ATOM 746 C CA . ALA C 3 27 ? 10.810 26.920 27.900 1.00 0.00 ? ? ? ? ? ? 27 ALA A CA 1
ATOM 747 C C . ALA C 3 27 ? 10.290 27.300 29.280 1.00 0.00 ? ? ? ? ? ? 27 ALA A C 1
ATOM 748 O O . ALA C 3 27 ? 9.120 27.120 29.630 1.00 0.00 ? ? ? ? ? ? 27 ALA A O 1
ATOM 749 C CB . ALA C 3 27 ? 10.130 27.710 26.780 1.00 0.00 ? ? ? ? ? ? 27 ALA A CB 1
ATOM 750 H H . ALA C 3 27 ? 10.130 25.260 26.840 1.00 0.00 ? ? ? ? ? ? 27 ALA A H 1
ATOM 751 N N . SER C 3 28 ? 11.260 27.760 30.060 1.00 0.00 ? ? ? ? ? ? 28 SER A N 1
ATOM 752 C CA . SER C 3 28 ? 11.120 28.100 31.480 1.00 0.00 ? ? ? ? ? ? 28 SER A CA 1
ATOM 753 C C . SER C 3 28 ? 12.450 28.700 31.950 1.00 0.00 ? ? ? ? ? ? 28 SER A C 1
ATOM 754 O O . SER C 3 28 ? 13.530 28.250 31.570 1.00 0.00 ? ? ? ? ? ? 28 SER A O 1
ATOM 755 C CB . SER C 3 28 ? 10.870 26.820 32.270 1.00 0.00 ? ? ? ? ? ? 28 SER A CB 1
ATOM 756 O OG . SER C 3 28 ? 10.560 27.170 33.610 1.00 0.00 ? ? ? ? ? ? 28 SER A OG 1
ATOM 757 H H . SER C 3 28 ? 12.180 27.940 29.690 1.00 0.00 ? ? ? ? ? ? 28 SER A H 1
ATOM 758 H HG . SER C 3 28 ? 9.550 27.300 33.660 1.00 0.00 ? ? ? ? ? ? 28 SER A HG 1
ATOM 759 N N . HIS C 3 29 ? 12.340 29.670 32.840 1.00 0.00 ? ? ? ? ? ? 29 HIS A N 1
ATOM 760 C CA . HIS C 3 29 ? 13.460 30.330 33.540 1.00 0.00 ? ? ? ? ? ? 29 HIS A CA 1
ATOM 761 C C . HIS C 3 29 ? 14.480 31.030 32.620 1.00 0.00 ? ? ? ? ? ? 29 HIS A C 1
ATOM 762 O O . HIS C 3 29 ? 15.660 30.710 32.560 1.00 0.00 ? ? ? ? ? ? 29 HIS A O 1
ATOM 763 C CB . HIS C 3 29 ? 14.110 29.370 34.550 1.00 0.00 ? ? ? ? ? ? 29 HIS A CB 1
ATOM 764 C CG . HIS C 3 29 ? 13.130 29.030 35.670 1.00 0.00 ? ? ? ? ? ? 29 HIS A CG 1
ATOM 765 N ND1 . HIS C 3 29 ? 12.560 29.900 36.510 1.00 0.00 ? ? ? ? ? ? 29 HIS A ND1 1
ATOM 766 C CD2 . HIS C 3 29 ? 12.530 27.860 35.800 1.00 0.00 ? ? ? ? ? ? 29 HIS A CD2 1
ATOM 767 C CE1 . HIS C 3 29 ? 11.600 29.240 37.150 1.00 0.00 ? ? ? ? ? ? 29 HIS A CE1 1
ATOM 768 N NE2 . HIS C 3 29 ? 11.570 27.990 36.700 1.00 0.00 ? ? ? ? ? ? 29 HIS A NE2 1
ATOM 769 H H . HIS C 3 29 ? 11.430 29.970 33.170 1.00 0.00 ? ? ? ? ? ? 29 HIS A H 1
ATOM 770 H HD1 . HIS C 3 29 ? 12.850 30.860 36.670 1.00 0.00 ? ? ? ? ? ? 29 HIS A HD1 1
ATOM 771 H HE2 . HIS C 3 29 ? 10.920 27.250 36.990 1.00 0.00 ? ? ? ? ? ? 29 HIS A HE2 1
ATOM 772 N N . VAL C 3 30 ? 13.920 31.970 31.870 1.00 0.00 ? ? ? ? ? ? 30 VAL A N 1
ATOM 773 C CA . VAL C 3 30 ? 14.670 32.930 31.040 1.00 0.00 ? ? ? ? ? ? 30 VAL A CA 1
ATOM 774 C C . VAL C 3 30 ? 14.070 34.320 31.210 1.00 0.00 ? ? ? ? ? ? 30 VAL A C 1
ATOM 775 O O . VAL C 3 30 ? 13.060 34.730 30.620 1.00 0.00 ? ? ? ? ? ? 30 VAL A O 1
ATOM 776 C CB . VAL C 3 30 ? 14.830 32.400 29.590 1.00 0.00 ? ? ? ? ? ? 30 VAL A CB 1
ATOM 777 C CG1 . VAL C 3 30 ? 13.550 32.440 28.740 1.00 0.00 ? ? ? ? ? ? 30 VAL A CG1 1
ATOM 778 C CG2 . VAL C 3 30 ? 15.960 33.210 28.960 1.00 0.00 ? ? ? ? ? ? 30 VAL A CG2 1
ATOM 779 H H . VAL C 3 30 ? 12.930 32.160 31.940 1.00 0.00 ? ? ? ? ? ? 30 VAL A H 1
ATOM 780 N N . SER C 3 31 ? 14.800 35.030 32.050 1.00 0.00 ? ? ? ? ? ? 31 SER A N 1
ATOM 781 C CA . SER C 3 31 ? 14.280 36.190 32.770 1.00 0.00 ? ? ? ? ? ? 31 SER A CA 1
ATOM 782 C C . SER C 3 31 ? 14.460 37.440 31.910 1.00 0.00 ? ? ? ? ? ? 31 SER A C 1
ATOM 783 O O . SER C 3 31 ? 15.030 37.370 30.830 1.00 0.00 ? ? ? ? ? ? 31 SER A O 1
ATOM 784 C CB . SER C 3 31 ? 15.010 36.310 34.110 1.00 0.00 ? ? ? ? ? ? 31 SER A CB 1
ATOM 785 O OG . SER C 3 31 ? 14.150 35.780 35.110 1.00 0.00 ? ? ? ? ? ? 31 SER A OG 1
ATOM 786 H H . SER C 3 31 ? 15.800 35.060 31.930 1.00 0.00 ? ? ? ? ? ? 31 SER A H 1
ATOM 787 H HG . SER C 3 31 ? 13.780 34.880 34.770 1.00 0.00 ? ? ? ? ? ? 31 SER A HG 1
ATOM 788 N N . ALA C 3 32 ? 13.930 38.550 32.370 1.00 0.00 ? ? ? ? ? ? 32 ALA A N 1
ATOM 789 C CA . ALA C 3 32 ? 13.670 39.730 31.520 1.00 0.00 ? ? ? ? ? ? 32 ALA A CA 1
ATOM 790 C C . ALA C 3 32 ? 14.830 40.190 30.620 1.00 0.00 ? ? ? ? ? ? 32 ALA A C 1
ATOM 791 O O . ALA C 3 32 ? 14.680 40.200 29.390 1.00 0.00 ? ? ? ? ? ? 32 ALA A O 1
ATOM 792 C CB . ALA C 3 32 ? 13.160 40.910 32.340 1.00 0.00 ? ? ? ? ? ? 32 ALA A CB 1
ATOM 793 H H . ALA C 3 32 ? 13.600 38.620 33.340 1.00 0.00 ? ? ? ? ? ? 32 ALA A H 1
ATOM 794 N N . LYS C 3 33 ? 15.920 40.640 31.220 1.00 0.00 ? ? ? ? ? ? 33 LYS A N 1
ATOM 795 C CA . LYS C 3 33 ? 17.060 41.170 30.450 1.00 0.00 ? ? ? ? ? ? 33 LYS A CA 1
ATOM 796 C C . LYS C 3 33 ? 17.850 40.050 29.760 1.00 0.00 ? ? ? ? ? ? 33 LYS A C 1
ATOM 797 O O . LYS C 3 33 ? 18.200 40.170 28.600 1.00 0.00 ? ? ? ? ? ? 33 LYS A O 1
ATOM 798 C CB . LYS C 3 33 ? 17.920 42.050 31.350 1.00 0.00 ? ? ? ? ? ? 33 LYS A CB 1
ATOM 799 C CG . LYS C 3 33 ? 19.010 42.820 30.600 1.00 0.00 ? ? ? ? ? ? 33 LYS A CG 1
ATOM 800 C CD . LYS C 3 33 ? 19.470 43.990 31.460 1.00 0.00 ? ? ? ? ? ? 33 LYS A CD 1
ATOM 801 C CE . LYS C 3 33 ? 20.500 44.840 30.720 1.00 0.00 ? ? ? ? ? ? 33 LYS A CE 1
ATOM 802 N NZ . LYS C 3 33 ? 20.830 46.030 31.500 1.00 0.00 ? ? ? ? ? ? 33 LYS A NZ 1
ATOM 803 H H . LYS C 3 33 ? 16.080 40.470 32.200 1.00 0.00 ? ? ? ? ? ? 33 LYS A H 1
ATOM 804 H HZ1 . LYS C 3 33 ? 21.100 45.810 32.450 1.00 0.00 ? ? ? ? ? ? 33 LYS A HZ1 1
ATOM 805 H HZ2 . LYS C 3 33 ? 21.560 46.540 31.060 1.00 0.00 ? ? ? ? ? ? 33 LYS A HZ2 1
ATOM 806 H HZ3 . LYS C 3 33 ? 20.030 46.630 31.550 1.00 0.00 ? ? ? ? ? ? 33 LYS A HZ3 1
ATOM 807 N N . THR C 3 34 ? 17.920 38.880 30.400 1.00 0.00 ? ? ? ? ? ? 34 THR A N 1
ATOM 808 C CA . THR C 3 34 ? 18.630 37.710 29.850 1.00 0.00 ? ? ? ? ? ? 34 THR A CA 1
ATOM 809 C C . THR C 3 34 ? 17.950 37.180 28.570 1.00 0.00 ? ? ? ? ? ? 34 THR A C 1
ATOM 810 O O . THR C 3 34 ? 18.620 36.970 27.560 1.00 0.00 ? ? ? ? ? ? 34 THR A O 1
ATOM 811 C CB . THR C 3 34 ? 18.800 36.600 30.890 1.00 0.00 ? ? ? ? ? ? 34 THR A CB 1
ATOM 812 O OG1 . THR C 3 34 ? 17.550 36.200 31.440 1.00 0.00 ? ? ? ? ? ? 34 THR A OG1 1
ATOM 813 C CG2 . THR C 3 34 ? 19.770 37.040 31.990 1.00 0.00 ? ? ? ? ? ? 34 THR A CG2 1
ATOM 814 H H . THR C 3 34 ? 17.450 38.710 31.270 1.00 0.00 ? ? ? ? ? ? 34 THR A H 1
ATOM 815 H HG1 . THR C 3 34 ? 17.750 35.500 32.170 1.00 0.00 ? ? ? ? ? ? 34 THR A HG1 1
ATOM 816 N N . ARG C 3 35 ? 16.630 37.100 28.610 1.00 0.00 ? ? ? ? ? ? 35 ARG A N 1
ATOM 817 C CA . ARG C 3 35 ? 15.740 36.850 27.460 1.00 0.00 ? ? ? ? ? ? 35 ARG A CA 1
ATOM 818 C C . ARG C 3 35 ? 15.770 37.970 26.410 1.00 0.00 ? ? ? ? ? ? 35 ARG A C 1
ATOM 819 O O . ARG C 3 35 ? 15.990 37.670 25.240 1.00 0.00 ? ? ? ? ? ? 35 ARG A O 1
ATOM 820 C CB . ARG C 3 35 ? 14.330 36.580 27.990 1.00 0.00 ? ? ? ? ? ? 35 ARG A CB 1
ATOM 821 C CG . ARG C 3 35 ? 13.380 35.960 26.960 1.00 0.00 ? ? ? ? ? ? 35 ARG A CG 1
ATOM 822 C CD . ARG C 3 35 ? 11.990 35.740 27.560 1.00 0.00 ? ? ? ? ? ? 35 ARG A CD 1
ATOM 823 N NE . ARG C 3 35 ? 11.350 37.010 27.920 1.00 0.00 ? ? ? ? ? ? 35 ARG A NE 1
ATOM 824 C CZ . ARG C 3 35 ? 10.930 37.400 29.130 1.00 0.00 ? ? ? ? ? ? 35 ARG A CZ 1
ATOM 825 N NH1 . ARG C 3 35 ? 11.110 36.700 30.250 1.00 0.00 ? ? ? ? ? ? 35 ARG A NH1 1
ATOM 826 N NH2 . ARG C 3 35 ? 10.330 38.570 29.220 1.00 0.00 ? ? ? ? ? ? 35 ARG A NH2 1
ATOM 827 H H . ARG C 3 35 ? 16.170 36.970 29.500 1.00 0.00 ? ? ? ? ? ? 35 ARG A H 1
ATOM 828 H HE . ARG C 3 35 ? 11.110 37.600 27.130 1.00 0.00 ? ? ? ? ? ? 35 ARG A HE 1
ATOM 829 H HH11 . ARG C 3 35 ? 11.760 35.940 30.320 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH11 1
ATOM 830 H HH12 . ARG C 3 35 ? 10.680 37.060 31.090 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH12 1
ATOM 831 H HH21 . ARG C 3 35 ? 10.050 39.080 28.400 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH21 1
ATOM 832 H HH22 . ARG C 3 35 ? 10.020 38.890 30.120 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH22 1
ATOM 833 N N . GLU C 3 36 ? 15.790 39.240 26.840 1.00 0.00 ? ? ? ? ? ? 36 GLU A N 1
ATOM 834 C CA . GLU C 3 36 ? 16.070 40.360 25.910 1.00 0.00 ? ? ? ? ? ? 36 GLU A CA 1
ATOM 835 C C . GLU C 3 36 ? 17.410 40.210 25.190 1.00 0.00 ? ? ? ? ? ? 36 GLU A C 1
ATOM 836 O O . GLU C 3 36 ? 17.470 40.370 23.970 1.00 0.00 ? ? ? ? ? ? 36 GLU A O 1
ATOM 837 C CB . GLU C 3 36 ? 16.030 41.740 26.550 1.00 0.00 ? ? ? ? ? ? 36 GLU A CB 1
ATOM 838 C CG . GLU C 3 36 ? 14.600 42.290 26.600 1.00 0.00 ? ? ? ? ? ? 36 GLU A CG 1
ATOM 839 C CD . GLU C 3 36 ? 14.630 43.810 26.530 1.00 0.00 ? ? ? ? ? ? 36 GLU A CD 1
ATOM 840 O OE1 . GLU C 3 36 ? 15.010 44.330 25.450 1.00 0.00 ? ? ? ? ? ? 36 GLU A OE1 1
ATOM 841 O OE2 . GLU C 3 36 ? 14.360 44.440 27.570 1.00 0.00 ? ? ? ? ? ? 36 GLU A OE2 1
ATOM 842 H H . GLU C 3 36 ? 15.630 39.480 27.810 1.00 0.00 ? ? ? ? ? ? 36 GLU A H 1
ATOM 843 N N . LYS C 3 37 ? 18.440 39.740 25.900 1.00 0.00 ? ? ? ? ? ? 37 LYS A N 1
ATOM 844 C CA . LYS C 3 37 ? 19.760 39.430 25.320 1.00 0.00 ? ? ? ? ? ? 37 LYS A CA 1
ATOM 845 C C . LYS C 3 37 ? 19.700 38.300 24.280 1.00 0.00 ? ? ? ? ? ? 37 LYS A C 1
ATOM 846 O O . LYS C 3 37 ? 20.490 38.330 23.340 1.00 0.00 ? ? ? ? ? ? 37 LYS A O 1
ATOM 847 C CB . LYS C 3 37 ? 20.740 39.020 26.420 1.00 0.00 ? ? ? ? ? ? 37 LYS A CB 1
ATOM 848 C CG . LYS C 3 37 ? 21.100 40.090 27.460 1.00 0.00 ? ? ? ? ? ? 37 LYS A CG 1
ATOM 849 C CD . LYS C 3 37 ? 22.020 41.130 26.840 1.00 0.00 ? ? ? ? ? ? 37 LYS A CD 1
ATOM 850 C CE . LYS C 3 37 ? 22.390 42.220 27.840 1.00 0.00 ? ? ? ? ? ? 37 LYS A CE 1
ATOM 851 N NZ . LYS C 3 37 ? 23.200 43.190 27.080 1.00 0.00 ? ? ? ? ? ? 37 LYS A NZ 1
ATOM 852 H H . LYS C 3 37 ? 18.390 39.650 26.910 1.00 0.00 ? ? ? ? ? ? 37 LYS A H 1
ATOM 853 H HZ1 . LYS C 3 37 ? 22.830 43.250 26.150 1.00 0.00 ? ? ? ? ? ? 37 LYS A HZ1 1
ATOM 854 H HZ2 . LYS C 3 37 ? 23.190 44.090 27.520 1.00 0.00 ? ? ? ? ? ? 37 LYS A HZ2 1
ATOM 855 H HZ3 . LYS C 3 37 ? 24.140 42.850 27.010 1.00 0.00 ? ? ? ? ? ? 37 LYS A HZ3 1
ATOM 856 N N . VAL C 3 38 ? 18.860 37.280 24.500 1.00 0.00 ? ? ? ? ? ? 38 VAL A N 1
ATOM 857 C CA . VAL C 3 38 ? 18.670 36.150 23.560 1.00 0.00 ? ? ? ? ? ? 38 VAL A CA 1
ATOM 858 C C . VAL C 3 38 ? 17.890 36.590 22.300 1.00 0.00 ? ? ? ? ? ? 38 VAL A C 1
ATOM 859 O O . VAL C 3 38 ? 18.290 36.230 21.190 1.00 0.00 ? ? ? ? ? ? 38 VAL A O 1
ATOM 860 C CB . VAL C 3 38 ? 17.980 34.920 24.210 1.00 0.00 ? ? ? ? ? ? 38 VAL A CB 1
ATOM 861 C CG1 . VAL C 3 38 ? 18.160 33.690 23.320 1.00 0.00 ? ? ? ? ? ? 38 VAL A CG1 1
ATOM 862 C CG2 . VAL C 3 38 ? 18.590 34.570 25.570 1.00 0.00 ? ? ? ? ? ? 38 VAL A CG2 1
ATOM 863 H H . VAL C 3 38 ? 18.390 37.180 25.380 1.00 0.00 ? ? ? ? ? ? 38 VAL A H 1
ATOM 864 N N . GLU C 3 39 ? 16.920 37.480 22.510 1.00 0.00 ? ? ? ? ? ? 39 GLU A N 1
ATOM 865 C CA . GLU C 3 39 ? 16.140 38.140 21.440 1.00 0.00 ? ? ? ? ? ? 39 GLU A CA 1
ATOM 866 C C . GLU C 3 39 ? 17.010 39.070 20.580 1.00 0.00 ? ? ? ? ? ? 39 GLU A C 1
ATOM 867 O O . GLU C 3 39 ? 16.880 39.080 19.360 1.00 0.00 ? ? ? ? ? ? 39 GLU A O 1
ATOM 868 C CB . GLU C 3 39 ? 14.960 38.930 22.000 1.00 0.00 ? ? ? ? ? ? 39 GLU A CB 1
ATOM 869 C CG . GLU C 3 39 ? 13.860 38.000 22.520 1.00 0.00 ? ? ? ? ? ? 39 GLU A CG 1
ATOM 870 C CD . GLU C 3 39 ? 12.600 38.760 22.950 1.00 0.00 ? ? ? ? ? ? 39 GLU A CD 1
ATOM 871 O OE1 . GLU C 3 39 ? 12.590 39.360 24.040 1.00 0.00 ? ? ? ? ? ? 39 GLU A OE1 1
ATOM 872 O OE2 . GLU C 3 39 ? 11.580 38.610 22.250 1.00 0.00 ? ? ? ? ? ? 39 GLU A OE2 1
ATOM 873 H H . GLU C 3 39 ? 16.660 37.750 23.430 1.00 0.00 ? ? ? ? ? ? 39 GLU A H 1
ATOM 874 N N . ALA C 3 40 ? 17.990 39.710 21.230 1.00 0.00 ? ? ? ? ? ? 40 ALA A N 1
ATOM 875 C CA . ALA C 3 40 ? 19.080 40.440 20.580 1.00 0.00 ? ? ? ? ? ? 40 ALA A CA 1
ATOM 876 C C . ALA C 3 40 ? 19.950 39.480 19.740 1.00 0.00 ? ? ? ? ? ? 40 ALA A C 1
ATOM 877 O O . ALA C 3 40 ? 19.930 39.520 18.510 1.00 0.00 ? ? ? ? ? ? 40 ALA A O 1
ATOM 878 C CB . ALA C 3 40 ? 19.840 41.120 21.720 1.00 0.00 ? ? ? ? ? ? 40 ALA A CB 1
ATOM 879 H H . ALA C 3 40 ? 18.030 39.750 22.240 1.00 0.00 ? ? ? ? ? ? 40 ALA A H 1
ATOM 880 N N . ALA C 3 41 ? 20.640 38.580 20.440 1.00 0.00 ? ? ? ? ? ? 41 ALA A N 1
ATOM 881 C CA . ALA C 3 41 ? 21.480 37.480 19.900 1.00 0.00 ? ? ? ? ? ? 41 ALA A CA 1
ATOM 882 C C . ALA C 3 41 ? 20.930 36.720 18.690 1.00 0.00 ? ? ? ? ? ? 41 ALA A C 1
ATOM 883 O O . ALA C 3 41 ? 21.650 36.590 17.710 1.00 0.00 ? ? ? ? ? ? 41 ALA A O 1
ATOM 884 C CB . ALA C 3 41 ? 21.820 36.470 21.000 1.00 0.00 ? ? ? ? ? ? 41 ALA A CB 1
ATOM 885 H H . ALA C 3 41 ? 20.720 38.730 21.420 1.00 0.00 ? ? ? ? ? ? 41 ALA A H 1
ATOM 886 N N . MET C 3 42 ? 19.720 36.160 18.790 1.00 0.00 ? ? ? ? ? ? 42 MET A N 1
ATOM 887 C CA . MET C 3 42 ? 19.010 35.560 17.630 1.00 0.00 ? ? ? ? ? ? 42 MET A CA 1
ATOM 888 C C . MET C 3 42 ? 19.150 36.340 16.310 1.00 0.00 ? ? ? ? ? ? 42 MET A C 1
ATOM 889 O O . MET C 3 42 ? 19.170 35.720 15.250 1.00 0.00 ? ? ? ? ? ? 42 MET A O 1
ATOM 890 C CB . MET C 3 42 ? 17.540 35.330 17.980 1.00 0.00 ? ? ? ? ? ? 42 MET A CB 1
ATOM 891 C CG . MET C 3 42 ? 17.410 34.130 18.920 1.00 0.00 ? ? ? ? ? ? 42 MET A CG 1
ATOM 892 S SD . MET C 3 42 ? 18.490 32.710 18.500 1.00 0.00 ? ? ? ? ? ? 42 MET A SD 1
ATOM 893 C CE . MET C 3 42 ? 18.800 32.080 20.130 1.00 0.00 ? ? ? ? ? ? 42 MET A CE 1
ATOM 894 H H . MET C 3 42 ? 19.280 35.990 19.670 1.00 0.00 ? ? ? ? ? ? 42 MET A H 1
ATOM 895 N N . ALA C 3 43 ? 19.270 37.660 16.410 1.00 0.00 ? ? ? ? ? ? 43 ALA A N 1
ATOM 896 C CA . ALA C 3 43 ? 19.540 38.540 15.260 1.00 0.00 ? ? ? ? ? ? 43 ALA A CA 1
ATOM 897 C C . ALA C 3 43 ? 21.040 38.850 15.050 1.00 0.00 ? ? ? ? ? ? 43 ALA A C 1
ATOM 898 O O . ALA C 3 43 ? 21.590 38.580 13.980 1.00 0.00 ? ? ? ? ? ? 43 ALA A O 1
ATOM 899 C CB . ALA C 3 43 ? 18.690 39.820 15.360 1.00 0.00 ? ? ? ? ? ? 43 ALA A CB 1
ATOM 900 H H . ALA C 3 43 ? 19.260 38.110 17.310 1.00 0.00 ? ? ? ? ? ? 43 ALA A H 1
ATOM 901 N N . GLU C 3 44 ? 21.710 39.300 16.110 1.00 0.00 ? ? ? ? ? ? 44 GLU A N 1
ATOM 902 C CA . GLU C 3 44 ? 23.170 39.550 16.110 1.00 0.00 ? ? ? ? ? ? 44 GLU A CA 1
ATOM 903 C C . GLU C 3 44 ? 24.120 38.400 15.720 1.00 0.00 ? ? ? ? ? ? 44 GLU A C 1
ATOM 904 O O . GLU C 3 44 ? 25.210 38.670 15.220 1.00 0.00 ? ? ? ? ? ? 44 GLU A O 1
ATOM 905 C CB . GLU C 3 44 ? 23.600 40.190 17.430 1.00 0.00 ? ? ? ? ? ? 44 GLU A CB 1
ATOM 906 C CG . GLU C 3 44 ? 23.720 41.710 17.230 1.00 0.00 ? ? ? ? ? ? 44 GLU A CG 1
ATOM 907 C CD . GLU C 3 44 ? 22.390 42.460 17.270 1.00 0.00 ? ? ? ? ? ? 44 GLU A CD 1
ATOM 908 O OE1 . GLU C 3 44 ? 21.650 42.290 18.260 1.00 0.00 ? ? ? ? ? ? 44 GLU A OE1 1
ATOM 909 O OE2 . GLU C 3 44 ? 22.190 43.330 16.390 1.00 0.00 ? ? ? ? ? ? 44 GLU A OE2 1
ATOM 910 H H . GLU C 3 44 ? 21.230 39.670 16.910 1.00 0.00 ? ? ? ? ? ? 44 GLU A H 1
ATOM 911 N N . LEU C 3 45 ? 23.720 37.170 16.020 1.00 0.00 ? ? ? ? ? ? 45 LEU A N 1
ATOM 912 C CA . LEU C 3 45 ? 24.250 35.940 15.390 1.00 0.00 ? ? ? ? ? ? 45 LEU A CA 1
ATOM 913 C C . LEU C 3 45 ? 23.070 35.230 14.690 1.00 0.00 ? ? ? ? ? ? 45 LEU A C 1
ATOM 914 O O . LEU C 3 45 ? 21.930 35.250 15.150 1.00 0.00 ? ? ? ? ? ? 45 LEU A O 1
ATOM 915 C CB . LEU C 3 45 ? 24.890 34.970 16.400 1.00 0.00 ? ? ? ? ? ? 45 LEU A CB 1
ATOM 916 C CG . LEU C 3 45 ? 25.900 35.590 17.380 1.00 0.00 ? ? ? ? ? ? 45 LEU A CG 1
ATOM 917 C CD1 . LEU C 3 45 ? 26.410 34.540 18.370 1.00 0.00 ? ? ? ? ? ? 45 LEU A CD1 1
ATOM 918 C CD2 . LEU C 3 45 ? 27.110 36.240 16.700 1.00 0.00 ? ? ? ? ? ? 45 LEU A CD2 1
ATOM 919 H H . LEU C 3 45 ? 23.000 37.000 16.700 1.00 0.00 ? ? ? ? ? ? 45 LEU A H 1
ATOM 920 N N . ASN C 3 46 ? 23.360 34.600 13.560 1.00 0.00 ? ? ? ? ? ? 46 ASN A N 1
ATOM 921 C CA . ASN C 3 46 ? 22.330 33.850 12.810 1.00 0.00 ? ? ? ? ? ? 46 ASN A CA 1
ATOM 922 C C . ASN C 3 46 ? 22.370 32.340 13.120 1.00 0.00 ? ? ? ? ? ? 46 ASN A C 1
ATOM 923 O O . ASN C 3 46 ? 23.110 31.550 12.540 1.00 0.00 ? ? ? ? ? ? 46 ASN A O 1
ATOM 924 C CB . ASN C 3 46 ? 22.310 34.200 11.310 1.00 0.00 ? ? ? ? ? ? 46 ASN A CB 1
ATOM 925 C CG . ASN C 3 46 ? 23.640 34.000 10.600 1.00 0.00 ? ? ? ? ? ? 46 ASN A CG 1
ATOM 926 O OD1 . ASN C 3 46 ? 23.930 32.960 10.020 1.00 0.00 ? ? ? ? ? ? 46 ASN A OD1 1
ATOM 927 N ND2 . ASN C 3 46 ? 24.500 34.970 10.720 1.00 0.00 ? ? ? ? ? ? 46 ASN A ND2 1
ATOM 928 H H . ASN C 3 46 ? 24.320 34.540 13.250 1.00 0.00 ? ? ? ? ? ? 46 ASN A H 1
ATOM 929 H HD21 . ASN C 3 46 ? 24.250 35.780 11.280 1.00 0.00 ? ? ? ? ? ? 46 ASN A HD21 1
ATOM 930 H HD22 . ASN C 3 46 ? 25.370 34.900 10.220 1.00 0.00 ? ? ? ? ? ? 46 ASN A HD22 1
ATOM 931 N N . TYR C 3 47 ? 21.760 32.080 14.270 1.00 0.00 ? ? ? ? ? ? 47 TYR A N 1
ATOM 932 C CA . TYR C 3 47 ? 21.600 30.740 14.850 1.00 0.00 ? ? ? ? ? ? 47 TYR A CA 1
ATOM 933 C C . TYR C 3 47 ? 21.060 29.670 13.890 1.00 0.00 ? ? ? ? ? ? 47 TYR A C 1
ATOM 934 O O . TYR C 3 47 ? 19.910 29.760 13.460 1.00 0.00 ? ? ? ? ? ? 47 TYR A O 1
ATOM 935 C CB . TYR C 3 47 ? 20.750 30.930 16.110 1.00 0.00 ? ? ? ? ? ? 47 TYR A CB 1
ATOM 936 C CG . TYR C 3 47 ? 20.450 29.650 16.890 1.00 0.00 ? ? ? ? ? ? 47 TYR A CG 1
ATOM 937 C CD1 . TYR C 3 47 ? 21.490 28.830 17.370 1.00 0.00 ? ? ? ? ? ? 47 TYR A CD1 1
ATOM 938 C CD2 . TYR C 3 47 ? 19.120 29.200 16.820 1.00 0.00 ? ? ? ? ? ? 47 TYR A CD2 1
ATOM 939 C CE1 . TYR C 3 47 ? 21.200 27.500 17.720 1.00 0.00 ? ? ? ? ? ? 47 TYR A CE1 1
ATOM 940 C CE2 . TYR C 3 47 ? 18.810 27.880 17.200 1.00 0.00 ? ? ? ? ? ? 47 TYR A CE2 1
ATOM 941 C CZ . TYR C 3 47 ? 19.860 27.050 17.640 1.00 0.00 ? ? ? ? ? ? 47 TYR A CZ 1
ATOM 942 O OH . TYR C 3 47 ? 19.550 25.830 18.160 1.00 0.00 ? ? ? ? ? ? 47 TYR A OH 1
ATOM 943 H H . TYR C 3 47 ? 21.640 32.820 14.930 1.00 0.00 ? ? ? ? ? ? 47 TYR A H 1
ATOM 944 H HH . TYR C 3 47 ? 20.430 25.360 18.360 1.00 0.00 ? ? ? ? ? ? 47 TYR A HH 1
ATOM 945 N N . ILE C 3 48 ? 21.780 28.540 13.950 1.00 0.00 ? ? ? ? ? ? 48 ILE A N 1
ATOM 946 C CA . ILE C 3 48 ? 21.520 27.310 13.180 1.00 0.00 ? ? ? ? ? ? 48 ILE A CA 1
ATOM 947 C C . ILE C 3 48 ? 21.020 26.220 14.160 1.00 0.00 ? ? ? ? ? ? 48 ILE A C 1
ATOM 948 O O . ILE C 3 48 ? 21.830 25.610 14.860 1.00 0.00 ? ? ? ? ? ? 48 ILE A O 1
ATOM 949 C CB . ILE C 3 48 ? 22.690 26.740 12.360 1.00 0.00 ? ? ? ? ? ? 48 ILE A CB 1
ATOM 950 C CG1 . ILE C 3 48 ? 23.290 27.810 11.440 1.00 0.00 ? ? ? ? ? ? 48 ILE A CG1 1
ATOM 951 C CG2 . ILE C 3 48 ? 22.190 25.530 11.530 1.00 0.00 ? ? ? ? ? ? 48 ILE A CG2 1
ATOM 952 C CD1 . ILE C 3 48 ? 24.590 27.340 10.790 1.00 0.00 ? ? ? ? ? ? 48 ILE A CD1 1
ATOM 953 H H . ILE C 3 48 ? 22.490 28.450 14.670 1.00 0.00 ? ? ? ? ? ? 48 ILE A H 1
ATOM 954 N N . PRO C 3 49 ? 19.710 25.990 14.170 1.00 0.00 ? ? ? ? ? ? 49 PRO A N 1
ATOM 955 C CA . PRO C 3 49 ? 19.060 24.890 14.910 1.00 0.00 ? ? ? ? ? ? 49 PRO A CA 1
ATOM 956 C C . PRO C 3 49 ? 19.640 23.510 14.600 1.00 0.00 ? ? ? ? ? ? 49 PRO A C 1
ATOM 957 O O . PRO C 3 49 ? 19.760 23.140 13.430 1.00 0.00 ? ? ? ? ? ? 49 PRO A O 1
ATOM 958 C CB . PRO C 3 49 ? 17.610 24.990 14.460 1.00 0.00 ? ? ? ? ? ? 49 PRO A CB 1
ATOM 959 C CG . PRO C 3 49 ? 17.390 26.490 14.310 1.00 0.00 ? ? ? ? ? ? 49 PRO A CG 1
ATOM 960 C CD . PRO C 3 49 ? 18.690 26.910 13.630 1.00 0.00 ? ? ? ? ? ? 49 PRO A CD 1
ATOM 961 N N . ASN C 3 50 ? 20.220 22.920 15.650 1.00 0.00 ? ? ? ? ? ? 50 ASN A N 1
ATOM 962 C CA . ASN C 3 50 ? 20.850 21.580 15.700 1.00 0.00 ? ? ? ? ? ? 50 ASN A CA 1
ATOM 963 C C . ASN C 3 50 ? 22.360 21.540 15.390 1.00 0.00 ? ? ? ? ? ? 50 ASN A C 1
ATOM 964 O O . ASN C 3 50 ? 22.980 20.500 15.630 1.00 0.00 ? ? ? ? ? ? 50 ASN A O 1
ATOM 965 C CB . ASN C 3 50 ? 20.150 20.440 14.940 1.00 0.00 ? ? ? ? ? ? 50 ASN A CB 1
ATOM 966 C CG . ASN C 3 50 ? 18.800 20.030 15.540 1.00 0.00 ? ? ? ? ? ? 50 ASN A CG 1
ATOM 967 O OD1 . ASN C 3 50 ? 17.740 20.340 15.010 1.00 0.00 ? ? ? ? ? ? 50 ASN A OD1 1
ATOM 968 N ND2 . ASN C 3 50 ? 18.790 19.260 16.610 1.00 0.00 ? ? ? ? ? ? 50 ASN A ND2 1
ATOM 969 H H . ASN C 3 50 ? 20.430 23.470 16.470 1.00 0.00 ? ? ? ? ? ? 50 ASN A H 1
ATOM 970 H HD21 . ASN C 3 50 ? 19.610 19.040 17.130 1.00 0.00 ? ? ? ? ? ? 50 ASN A HD21 1
ATOM 971 H HD22 . ASN C 3 50 ? 17.880 18.990 16.950 1.00 0.00 ? ? ? ? ? ? 50 ASN A HD22 1
ATOM 972 N N . ARG C 3 51 ? 22.930 22.590 14.800 1.00 0.00 ? ? ? ? ? ? 51 ARG A N 1
ATOM 973 C CA . ARG C 3 51 ? 24.390 22.580 14.560 1.00 0.00 ? ? ? ? ? ? 51 ARG A CA 1
ATOM 974 C C . ARG C 3 51 ? 25.100 23.850 15.040 1.00 0.00 ? ? ? ? ? ? 51 ARG A C 1
ATOM 975 O O . ARG C 3 51 ? 26.320 23.720 15.290 1.00 0.00 ? ? ? ? ? ? 51 ARG A O 1
ATOM 976 C CB . ARG C 3 51 ? 24.730 22.340 13.080 1.00 0.00 ? ? ? ? ? ? 51 ARG A CB 1
ATOM 977 C CG . ARG C 3 51 ? 24.750 20.870 12.630 1.00 0.00 ? ? ? ? ? ? 51 ARG A CG 1
ATOM 978 C CD . ARG C 3 51 ? 25.740 19.980 13.390 1.00 0.00 ? ? ? ? ? ? 51 ARG A CD 1
ATOM 979 N NE . ARG C 3 51 ? 27.140 20.390 13.220 1.00 0.00 ? ? ? ? ? ? 51 ARG A NE 1
ATOM 980 C CZ . ARG C 3 51 ? 28.150 19.870 13.950 1.00 0.00 ? ? ? ? ? ? 51 ARG A CZ 1
ATOM 981 N NH1 . ARG C 3 51 ? 27.950 18.830 14.750 1.00 0.00 ? ? ? ? ? ? 51 ARG A NH1 1
ATOM 982 N NH2 . ARG C 3 51 ? 29.390 20.340 13.830 1.00 0.00 ? ? ? ? ? ? 51 ARG A NH2 1
ATOM 983 O OXT . ARG C 3 51 ? 24.530 24.930 14.790 1.00 0.00 ? ? ? ? ? ? 51 ARG A OXT 1
ATOM 984 H H . ARG C 3 51 ? 22.470 23.450 14.570 1.00 0.00 ? ? ? ? ? ? 51 ARG A H 1
ATOM 985 H HE . ARG C 3 51 ? 27.330 21.010 12.450 1.00 0.00 ? ? ? ? ? ? 51 ARG A HE 1
ATOM 986 H HH11 . ARG C 3 51 ? 27.040 18.440 14.940 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH11 1
ATOM 987 H HH12 . ARG C 3 51 ? 28.740 18.400 15.210 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH12 1
ATOM 988 H HH21 . ARG C 3 51 ? 29.650 21.100 13.230 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH21 1
ATOM 989 H HH22 . ARG C 3 51 ? 30.100 19.980 14.450 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH22 1
HETATM 990 NA NA . NA D 4 . ? 16.260 23.720 18.910 1.00 0.00 ? ? ? ? ? ? 12 NA C NA 1
HETATM 991 O O . HOH E 5 . ? 21.650 18.570 17.310 1.00 0.00 ? ? ? ? ? ? 52 HOH A O 1
HETATM 992 H H1 . HOH E 5 . ? 21.560 18.800 18.280 1.00 0.00 ? ? ? ? ? ? 52 HOH A H1 1
HETATM 993 H H2 . HOH E 5 . ? 22.420 19.070 16.930 1.00 0.00 ? ? ? ? ? ? 52 HOH A H2 1
HETATM 994 O O . HOH E 5 . ? 14.510 23.890 17.760 1.00 0.00 ? ? ? ? ? ? 53 HOH A O 1
HETATM 995 H H1 . HOH E 5 . ? 14.790 24.370 16.920 1.00 0.00 ? ? ? ? ? ? 53 HOH A H1 1
HETATM 996 H H2 . HOH E 5 . ? 13.570 24.160 17.990 1.00 0.00 ? ? ? ? ? ? 53 HOH A H2 1
HETATM 997 O O . HOH E 5 . ? 10.250 25.780 40.110 1.00 0.00 ? ? ? ? ? ? 54 HOH A O 1
HETATM 998 H H1 . HOH E 5 . ? 10.970 25.150 40.390 1.00 0.00 ? ? ? ? ? ? 54 HOH A H1 1
HETATM 999 H H2 . HOH E 5 . ? 10.190 26.530 40.770 1.00 0.00 ? ? ? ? ? ? 54 HOH A H2 1
HETATM 1000 O O . HOH E 5 . ? 16.680 22.390 27.940 1.00 0.00 ? ? ? ? ? ? 55 HOH A O 1
HETATM 1001 H H1 . HOH E 5 . ? 17.560 22.710 28.300 1.00 0.00 ? ? ? ? ? ? 55 HOH A H1 1
HETATM 1002 H H2 . HOH E 5 . ? 16.640 22.580 26.960 1.00 0.00 ? ? ? ? ? ? 55 HOH A H2 1
HETATM 1003 O O . HOH E 5 . ? 9.310 22.490 24.900 1.00 0.00 ? ? ? ? ? ? 56 HOH A O 1
HETATM 1004 H H1 . HOH E 5 . ? 8.430 22.400 24.440 1.00 0.00 ? ? ? ? ? ? 56 HOH A H1 1
HETATM 1005 H H2 . HOH E 5 . ? 9.960 21.840 24.510 1.00 0.00 ? ? ? ? ? ? 56 HOH A H2 1
HETATM 1006 O O . HOH E 5 . ? 16.660 21.960 17.620 1.00 0.00 ? ? ? ? ? ? 57 HOH A O 1
HETATM 1007 H H1 . HOH E 5 . ? 17.390 21.990 16.940 1.00 0.00 ? ? ? ? ? ? 57 HOH A H1 1
HETATM 1008 H H2 . HOH E 5 . ? 16.500 21.010 17.900 1.00 0.00 ? ? ? ? ? ? 57 HOH A H2 1
HETATM 1009 O O . HOH E 5 . ? 16.590 18.980 18.620 1.00 0.00 ? ? ? ? ? ? 58 HOH A O 1
HETATM 1010 H H1 . HOH E 5 . ? 15.840 18.530 18.130 1.00 0.00 ? ? ? ? ? ? 58 HOH A H1 1
HETATM 1011 H H2 . HOH E 5 . ? 16.290 19.200 19.550 1.00 0.00 ? ? ? ? ? ? 58 HOH A H2 1
HETATM 1012 O O . HOH E 5 . ? 17.560 33.900 32.820 1.00 0.00 ? ? ? ? ? ? 59 HOH A O 1
HETATM 1013 H H1 . HOH E 5 . ? 16.850 33.260 33.120 1.00 0.00 ? ? ? ? ? ? 59 HOH A H1 1
HETATM 1014 H H2 . HOH E 5 . ? 18.430 33.410 32.720 1.00 0.00 ? ? ? ? ? ? 59 HOH A H2 1
HETATM 1015 O O . HOH E 5 . ? 16.400 27.600 32.270 1.00 0.00 ? ? ? ? ? ? 60 HOH A O 1
HETATM 1016 H H1 . HOH E 5 . ? 15.860 28.370 31.940 1.00 0.00 ? ? ? ? ? ? 60 HOH A H1 1
HETATM 1017 H H2 . HOH E 5 . ? 17.170 27.950 32.820 1.00 0.00 ? ? ? ? ? ? 60 HOH A H2 1
HETATM 1018 O O . HOH E 5 . ? 11.430 22.110 34.630 1.00 0.00 ? ? ? ? ? ? 61 HOH A O 1
HETATM 1019 H H1 . HOH E 5 . ? 11.250 21.740 35.540 1.00 0.00 ? ? ? ? ? ? 61 HOH A H1 1
HETATM 1020 H H2 . HOH E 5 . ? 10.950 21.550 33.950 1.00 0.00 ? ? ? ? ? ? 61 HOH A H2 1
HETATM 1021 O O . HOH E 5 . ? 13.340 25.120 37.320 1.00 0.00 ? ? ? ? ? ? 62 HOH A O 1
HETATM 1022 H H1 . HOH E 5 . ? 14.120 25.130 36.690 1.00 0.00 ? ? ? ? ? ? 62 HOH A H1 1
HETATM 1023 H H2 . HOH E 5 . ? 12.500 25.170 36.790 1.00 0.00 ? ? ? ? ? ? 62 HOH A H2 1
HETATM 1024 O O . HOH E 5 . ? 12.950 33.600 34.310 1.00 0.00 ? ? ? ? ? ? 63 HOH A O 1
HETATM 1025 H H1 . HOH E 5 . ? 12.010 33.640 33.970 1.00 0.00 ? ? ? ? ? ? 63 HOH A H1 1
HETATM 1026 H H2 . HOH E 5 . ? 12.950 33.200 35.230 1.00 0.00 ? ? ? ? ? ? 63 HOH A H2 1
HETATM 1027 O O . HOH E 5 . ? 30.670 19.500 16.170 1.00 0.00 ? ? ? ? ? ? 64 HOH A O 1
HETATM 1028 H H1 . HOH E 5 . ? 30.080 20.050 16.760 1.00 0.00 ? ? ? ? ? ? 64 HOH A H1 1
HETATM 1029 H H2 . HOH E 5 . ? 30.480 18.530 16.320 1.00 0.00 ? ? ? ? ? ? 64 HOH A H2 1
HETATM 1030 O O . HOH E 5 . ? 33.140 20.790 16.330 1.00 0.00 ? ? ? ? ? ? 65 HOH A O 1
HETATM 1031 H H1 . HOH E 5 . ? 32.310 20.230 16.410 1.00 0.00 ? ? ? ? ? ? 65 HOH A H1 1
HETATM 1032 H H2 . HOH E 5 . ? 32.960 21.700 16.700 1.00 0.00 ? ? ? ? ? ? 65 HOH A H2 1
HETATM 1033 O O . HOH E 5 . ? 25.770 17.510 15.790 1.00 0.00 ? ? ? ? ? ? 66 HOH A O 1
HETATM 1034 H H1 . HOH E 5 . ? 25.390 18.010 16.580 1.00 0.00 ? ? ? ? ? ? 66 HOH A H1 1
HETATM 1035 H H2 . HOH E 5 . ? 25.370 16.590 15.770 1.00 0.00 ? ? ? ? ? ? 66 HOH A H2 1
HETATM 1036 O O . HOH E 5 . ? 25.870 20.080 26.020 1.00 0.00 ? ? ? ? ? ? 67 HOH A O 1
HETATM 1037 H H1 . HOH E 5 . ? 25.250 20.440 25.330 1.00 0.00 ? ? ? ? ? ? 67 HOH A H1 1
HETATM 1038 H H2 . HOH E 5 . ? 26.210 19.180 25.720 1.00 0.00 ? ? ? ? ? ? 67 HOH A H2 1
HETATM 1039 O O . HOH E 5 . ? 23.280 19.710 29.590 1.00 0.00 ? ? ? ? ? ? 68 HOH A O 1
HETATM 1040 H H1 . HOH E 5 . ? 24.260 19.560 29.690 1.00 0.00 ? ? ? ? ? ? 68 HOH A H1 1
HETATM 1041 H H2 . HOH E 5 . ? 22.850 19.660 30.500 1.00 0.00 ? ? ? ? ? ? 68 HOH A H2 1
HETATM 1042 O O . HOH E 5 . ? 13.660 26.110 33.530 1.00 0.00 ? ? ? ? ? ? 69 HOH A O 1
HETATM 1043 H H1 . HOH E 5 . ? 12.660 26.140 33.590 1.00 0.00 ? ? ? ? ? ? 69 HOH A H1 1
HETATM 1044 H H2 . HOH E 5 . ? 13.990 26.950 33.090 1.00 0.00 ? ? ? ? ? ? 69 HOH A H2 1
HETATM 1045 O O . HOH E 5 . ? 23.390 23.170 30.810 1.00 0.00 ? ? ? ? ? ? 70 HOH A O 1
HETATM 1046 H H1 . HOH E 5 . ? 23.570 24.040 30.350 1.00 0.00 ? ? ? ? ? ? 70 HOH A H1 1
HETATM 1047 H H2 . HOH E 5 . ? 24.080 23.030 31.520 1.00 0.00 ? ? ? ? ? ? 70 HOH A H2 1
HETATM 1048 O O . HOH E 5 . ? 22.150 31.070 32.160 1.00 0.00 ? ? ? ? ? ? 71 HOH A O 1
HETATM 1049 H H1 . HOH E 5 . ? 21.270 31.180 32.640 1.00 0.00 ? ? ? ? ? ? 71 HOH A H1 1
HETATM 1050 H H2 . HOH E 5 . ? 22.860 31.560 32.660 1.00 0.00 ? ? ? ? ? ? 71 HOH A H2 1
HETATM 1051 O O . HOH E 5 . ? 30.140 25.470 20.070 1.00 0.00 ? ? ? ? ? ? 72 HOH A O 1
HETATM 1052 H H1 . HOH E 5 . ? 30.270 26.220 20.720 1.00 0.00 ? ? ? ? ? ? 72 HOH A H1 1
HETATM 1053 H H2 . HOH E 5 . ? 29.180 25.430 19.800 1.00 0.00 ? ? ? ? ? ? 72 HOH A H2 1
HETATM 1054 O O . HOH E 5 . ? 29.660 20.790 22.690 1.00 0.00 ? ? ? ? ? ? 73 HOH A O 1
HETATM 1055 H H1 . HOH E 5 . ? 29.290 21.250 21.880 1.00 0.00 ? ? ? ? ? ? 73 HOH A H1 1
HETATM 1056 H H2 . HOH E 5 . ? 29.030 20.930 23.460 1.00 0.00 ? ? ? ? ? ? 73 HOH A H2 1
HETATM 1057 O O . HOH E 5 . ? 24.720 20.740 23.650 1.00 0.00 ? ? ? ? ? ? 74 HOH A O 1
HETATM 1058 H H1 . HOH E 5 . ? 25.450 20.660 22.980 1.00 0.00 ? ? ? ? ? ? 74 HOH A H1 1
HETATM 1059 H H2 . HOH E 5 . ? 24.130 21.510 23.410 1.00 0.00 ? ? ? ? ? ? 74 HOH A H2 1
HETATM 1060 O O . HOH E 5 . ? 11.330 24.730 35.270 1.00 0.00 ? ? ? ? ? ? 75 HOH A O 1
HETATM 1061 H H1 . HOH E 5 . ? 11.210 23.740 35.300 1.00 0.00 ? ? ? ? ? ? 75 HOH A H1 1
HETATM 1062 H H2 . HOH E 5 . ? 10.450 25.170 35.090 1.00 0.00 ? ? ? ? ? ? 75 HOH A H2 1
HETATM 1063 O O . HOH E 5 . ? 16.550 37.270 38.760 1.00 0.00 ? ? ? ? ? ? 76 HOH A O 1
HETATM 1064 H H1 . HOH E 5 . ? 15.770 37.560 38.210 1.00 0.00 ? ? ? ? ? ? 76 HOH A H1 1
HETATM 1065 H H2 . HOH E 5 . ? 16.690 36.290 38.640 1.00 0.00 ? ? ? ? ? ? 76 HOH A H2 1
HETATM 1066 O O . HOH E 5 . ? 14.290 37.710 37.220 1.00 0.00 ? ? ? ? ? ? 77 HOH A O 1
HETATM 1067 H H1 . HOH E 5 . ? 13.730 37.200 37.870 1.00 0.00 ? ? ? ? ? ? 77 HOH A H1 1
HETATM 1068 H H2 . HOH E 5 . ? 14.340 37.220 36.350 1.00 0.00 ? ? ? ? ? ? 77 HOH A H2 1
HETATM 1069 O O . HOH F 5 . ? 19.850 26.680 33.020 1.00 0.00 ? ? ? ? ? ? 835 HOH B O 1
HETATM 1070 H H1 . HOH F 5 . ? 20.310 27.550 32.820 1.00 0.00 ? ? ? ? ? ? 835 HOH B H1 1
HETATM 1071 H H2 . HOH F 5 . ? 20.450 26.110 33.580 1.00 0.00 ? ? ? ? ? ? 835 HOH B H2 1
HETATM 1072 O O . HOH F 5 . ? 8.460 29.650 39.060 1.00 0.00 ? ? ? ? ? ? 1026 HOH B O 1
HETATM 1073 H H1 . HOH F 5 . ? 7.740 30.120 38.550 1.00 0.00 ? ? ? ? ? ? 1026 HOH B H1 1
HETATM 1074 H H2 . HOH F 5 . ? 8.660 30.160 39.900 1.00 0.00 ? ? ? ? ? ? 1026 HOH B H2 1
HETATM 1075 O O . HOH F 5 . ? 11.340 36.480 36.160 1.00 0.00 ? ? ? ? ? ? 1417 HOH B O 1
HETATM 1076 H H1 . HOH F 5 . ? 11.830 35.700 36.560 1.00 0.00 ? ? ? ? ? ? 1417 HOH B H1 1
HETATM 1077 H H2 . HOH F 5 . ? 11.000 37.060 36.900 1.00 0.00 ? ? ? ? ? ? 1417 HOH B H2 1
HETATM 1078 O O . HOH F 5 . ? 9.240 32.250 36.410 1.00 0.00 ? ? ? ? ? ? 1632 HOH B O 1
HETATM 1079 H H1 . HOH F 5 . ? 8.260 32.430 36.340 1.00 0.00 ? ? ? ? ? ? 1632 HOH B H1 1
HETATM 1080 H H2 . HOH F 5 . ? 9.630 32.830 37.120 1.00 0.00 ? ? ? ? ? ? 1632 HOH B H2 1
HETATM 1081 O O . HOH F 5 . ? 17.300 15.020 16.580 1.00 0.00 ? ? ? ? ? ? 1924 HOH B O 1
HETATM 1082 H H1 . HOH F 5 . ? 17.310 15.610 15.770 1.00 0.00 ? ? ? ? ? ? 1924 HOH B H1 1
HETATM 1083 H H2 . HOH F 5 . ? 18.220 14.670 16.760 1.00 0.00 ? ? ? ? ? ? 1924 HOH B H2 1
HETATM 1084 O O . HOH F 5 . ? 25.040 25.940 32.620 1.00 0.00 ? ? ? ? ? ? 2488 HOH B O 1
HETATM 1085 H H1 . HOH F 5 . ? 25.500 26.460 33.340 1.00 0.00 ? ? ? ? ? ? 2488 HOH B H1 1
HETATM 1086 H H2 . HOH F 5 . ? 25.510 25.070 32.490 1.00 0.00 ? ? ? ? ? ? 2488 HOH B H2 1
HETATM 1087 O O . HOH F 5 . ? 10.230 33.610 38.760 1.00 0.00 ? ? ? ? ? ? 2504 HOH B O 1
HETATM 1088 H H1 . HOH F 5 . ? 11.090 33.110 38.900 1.00 0.00 ? ? ? ? ? ? 2504 HOH B H1 1
HETATM 1089 H H2 . HOH F 5 . ? 10.230 34.420 39.350 1.00 0.00 ? ? ? ? ? ? 2504 HOH B H2 1
HETATM 1090 O O . HOH F 5 . ? 24.170 31.850 33.870 1.00 0.00 ? ? ? ? ? ? 2561 HOH B O 1
HETATM 1091 H H1 . HOH F 5 . ? 24.070 30.860 33.800 1.00 0.00 ? ? ? ? ? ? 2561 HOH B H1 1
HETATM 1092 H H2 . HOH F 5 . ? 25.120 32.080 34.090 1.00 0.00 ? ? ? ? ? ? 2561 HOH B H2 1
HETATM 1093 O O . HOH F 5 . ? 20.330 34.690 34.970 1.00 0.00 ? ? ? ? ? ? 2639 HOH B O 1
HETATM 1094 H H1 . HOH F 5 . ? 19.610 35.290 34.620 1.00 0.00 ? ? ? ? ? ? 2639 HOH B H1 1
HETATM 1095 H H2 . HOH F 5 . ? 20.310 33.820 34.480 1.00 0.00 ? ? ? ? ? ? 2639 HOH B H2 1
HETATM 1096 O O . HOH F 5 . ? 20.450 15.490 17.620 1.00 0.00 ? ? ? ? ? ? 2869 HOH B O 1
HETATM 1097 H H1 . HOH F 5 . ? 19.830 16.270 17.740 1.00 0.00 ? ? ? ? ? ? 2869 HOH B H1 1
HETATM 1098 H H2 . HOH F 5 . ? 21.050 15.420 18.410 1.00 0.00 ? ? ? ? ? ? 2869 HOH B H2 1
HETATM 1099 O O . HOH F 5 . ? 27.210 30.220 31.760 1.00 0.00 ? ? ? ? ? ? 3222 HOH B O 1
HETATM 1100 H H1 . HOH F 5 . ? 26.570 29.800 32.400 1.00 0.00 ? ? ? ? ? ? 3222 HOH B H1 1
HETATM 1101 H H2 . HOH F 5 . ? 27.970 30.630 32.260 1.00 0.00 ? ? ? ? ? ? 3222 HOH B H2 1
HETATM 1102 O O . HOH F 5 . ? 17.620 35.240 36.380 1.00 0.00 ? ? ? ? ? ? 3293 HOH B O 1
HETATM 1103 H H1 . HOH F 5 . ? 16.710 34.810 36.390 1.00 0.00 ? ? ? ? ? ? 3293 HOH B H1 1
HETATM 1104 H H2 . HOH F 5 . ? 18.310 34.550 36.540 1.00 0.00 ? ? ? ? ? ? 3293 HOH B H2 1
HETATM 1105 O O . HOH G 5 . ? 19.190 17.630 19.270 1.00 0.00 ? ? ? ? ? ? 327 HOH C O 1
HETATM 1106 H H1 . HOH G 5 . ? 18.230 17.890 19.180 1.00 0.00 ? ? ? ? ? ? 327 HOH C H1 1
HETATM 1107 H H2 . HOH G 5 . ? 19.660 18.260 19.890 1.00 0.00 ? ? ? ? ? ? 327 HOH C H2 1
HETATM 1108 O O . HOH G 5 . ? 10.030 19.550 21.880 1.00 0.00 ? ? ? ? ? ? 827 HOH C O 1
HETATM 1109 H H1 . HOH G 5 . ? 9.960 18.970 22.690 1.00 0.00 ? ? ? ? ? ? 827 HOH C H1 1
HETATM 1110 H H2 . HOH G 5 . ? 10.360 20.450 22.140 1.00 0.00 ? ? ? ? ? ? 827 HOH C H2 1
HETATM 1111 O O . HOH G 5 . ? 17.630 24.770 20.160 1.00 0.00 ? ? ? ? ? ? 923 HOH C O 1
HETATM 1112 H H1 . HOH G 5 . ? 18.510 25.250 20.070 1.00 0.00 ? ? ? ? ? ? 923 HOH C H1 1
HETATM 1113 H H2 . HOH G 5 . ? 17.540 24.430 21.090 1.00 0.00 ? ? ? ? ? ? 923 HOH C H2 1
HETATM 1114 O O . HOH G 5 . ? 9.720 20.420 33.120 1.00 0.00 ? ? ? ? ? ? 1041 HOH C O 1
HETATM 1115 H H1 . HOH G 5 . ? 10.090 19.830 32.400 1.00 0.00 ? ? ? ? ? ? 1041 HOH C H1 1
HETATM 1116 H H2 . HOH G 5 . ? 9.200 19.860 33.760 1.00 0.00 ? ? ? ? ? ? 1041 HOH C H2 1
HETATM 1117 O O . HOH G 5 . ? 13.770 23.410 34.090 1.00 0.00 ? ? ? ? ? ? 1046 HOH C O 1
HETATM 1118 H H1 . HOH G 5 . ? 13.830 24.400 34.050 1.00 0.00 ? ? ? ? ? ? 1046 HOH C H1 1
HETATM 1119 H H2 . HOH G 5 . ? 12.840 23.150 34.380 1.00 0.00 ? ? ? ? ? ? 1046 HOH C H2 1
HETATM 1120 O O . HOH G 5 . ? 29.220 23.780 15.410 1.00 0.00 ? ? ? ? ? ? 1830 HOH C O 1
HETATM 1121 H H1 . HOH G 5 . ? 29.420 23.320 16.270 1.00 0.00 ? ? ? ? ? ? 1830 HOH C H1 1
HETATM 1122 H H2 . HOH G 5 . ? 28.230 23.840 15.280 1.00 0.00 ? ? ? ? ? ? 1830 HOH C H2 1
HETATM 1123 O O . HOH G 5 . ? 26.820 17.410 25.340 1.00 0.00 ? ? ? ? ? ? 1959 HOH C O 1
HETATM 1124 H H1 . HOH G 5 . ? 26.870 16.650 24.690 1.00 0.00 ? ? ? ? ? ? 1959 HOH C H1 1
HETATM 1125 H H2 . HOH G 5 . ? 26.640 17.060 26.250 1.00 0.00 ? ? ? ? ? ? 1959 HOH C H2 1
HETATM 1126 O O . HOH G 5 . ? 30.970 23.530 22.110 1.00 0.00 ? ? ? ? ? ? 1993 HOH C O 1
HETATM 1127 H H1 . HOH G 5 . ? 30.730 24.140 21.360 1.00 0.00 ? ? ? ? ? ? 1993 HOH C H1 1
HETATM 1128 H H2 . HOH G 5 . ? 30.670 22.600 21.890 1.00 0.00 ? ? ? ? ? ? 1993 HOH C H2 1
HETATM 1129 O O . HOH G 5 . ? 22.920 22.570 22.780 1.00 0.00 ? ? ? ? ? ? 2471 HOH C O 1
HETATM 1130 H H1 . HOH G 5 . ? 23.070 23.190 22.010 1.00 0.00 ? ? ? ? ? ? 2471 HOH C H1 1
HETATM 1131 H H2 . HOH G 5 . ? 22.310 21.830 22.500 1.00 0.00 ? ? ? ? ? ? 2471 HOH C H2 1
HETATM 1132 O O . HOH G 5 . ? 8.990 20.940 27.510 1.00 0.00 ? ? ? ? ? ? 2518 HOH C O 1
HETATM 1133 H H1 . HOH G 5 . ? 8.800 19.970 27.630 1.00 0.00 ? ? ? ? ? ? 2518 HOH C H1 1
HETATM 1134 H H2 . HOH G 5 . ? 9.700 21.060 26.820 1.00 0.00 ? ? ? ? ? ? 2518 HOH C H2 1
HETATM 1135 O O . HOH G 5 . ? 26.760 20.210 21.950 1.00 0.00 ? ? ? ? ? ? 2570 HOH C O 1
HETATM 1136 H H1 . HOH G 5 . ? 27.690 20.310 22.290 1.00 0.00 ? ? ? ? ? ? 2570 HOH C H1 1
HETATM 1137 H H2 . HOH G 5 . ? 26.710 20.540 21.000 1.00 0.00 ? ? ? ? ? ? 2570 HOH C H2 1
ATOM 1138 O "O5'" . DA A 1 1 ? 7.900 34.300 47.200 1.00 0.00 ? ? ? ? ? ? 1 DA B "O5'" 2
ATOM 1139 C "C5'" . DA A 1 1 ? 8.090 33.680 45.920 1.00 0.00 ? ? ? ? ? ? 1 DA B "C5'" 2
ATOM 1140 C "C4'" . DA A 1 1 ? 9.560 33.570 45.550 1.00 0.00 ? ? ? ? ? ? 1 DA B "C4'" 2
ATOM 1141 O "O4'" . DA A 1 1 ? 10.240 32.680 46.480 1.00 0.00 ? ? ? ? ? ? 1 DA B "O4'" 2
ATOM 1142 C "C3'" . DA A 1 1 ? 9.700 32.900 44.190 1.00 0.00 ? ? ? ? ? ? 1 DA B "C3'" 2
ATOM 1143 O "O3'" . DA A 1 1 ? 10.560 33.600 43.250 1.00 0.00 ? ? ? ? ? ? 1 DA B "O3'" 2
ATOM 1144 C "C2'" . DA A 1 1 ? 10.150 31.500 44.510 1.00 0.00 ? ? ? ? ? ? 1 DA B "C2'" 2
ATOM 1145 C "C1'" . DA A 1 1 ? 11.070 31.870 45.640 1.00 0.00 ? ? ? ? ? ? 1 DA B "C1'" 2
ATOM 1146 N N9 . DA A 1 1 ? 11.670 30.720 46.360 1.00 0.00 ? ? ? ? ? ? 1 DA B N9 2
ATOM 1147 C C8 . DA A 1 1 ? 10.990 29.700 46.830 1.00 0.00 ? ? ? ? ? ? 1 DA B C8 2
ATOM 1148 N N7 . DA A 1 1 ? 11.810 28.780 47.370 1.00 0.00 ? ? ? ? ? ? 1 DA B N7 2
ATOM 1149 C C5 . DA A 1 1 ? 13.050 29.250 47.200 1.00 0.00 ? ? ? ? ? ? 1 DA B C5 2
ATOM 1150 C C6 . DA A 1 1 ? 14.350 28.810 47.490 1.00 0.00 ? ? ? ? ? ? 1 DA B C6 2
ATOM 1151 N N6 . DA A 1 1 ? 14.560 27.820 48.320 1.00 0.00 ? ? ? ? ? ? 1 DA B N6 2
ATOM 1152 N N1 . DA A 1 1 ? 15.430 29.500 47.080 1.00 0.00 ? ? ? ? ? ? 1 DA B N1 2
ATOM 1153 C C2 . DA A 1 1 ? 15.300 30.660 46.440 1.00 0.00 ? ? ? ? ? ? 1 DA B C2 2
ATOM 1154 N N3 . DA A 1 1 ? 14.080 31.150 46.200 1.00 0.00 ? ? ? ? ? ? 1 DA B N3 2
ATOM 1155 C C4 . DA A 1 1 ? 12.960 30.480 46.550 1.00 0.00 ? ? ? ? ? ? 1 DA B C4 2
ATOM 1156 H H61 . DA A 1 1 ? 15.510 27.610 48.570 1.00 0.00 ? ? ? ? ? ? 1 DA B H61 2
ATOM 1157 H H62 . DA A 1 1 ? 13.810 27.230 48.630 1.00 0.00 ? ? ? ? ? ? 1 DA B H62 2
ATOM 1158 H "HO5'" . DA A 1 1 ? 8.540 35.110 47.220 1.00 0.00 ? ? ? ? ? ? 1 DA B "HO5'" 2
ATOM 1159 P P . DA A 1 2 ? 9.940 34.790 42.370 1.00 0.00 ? ? ? ? ? ? 2 DA B P 2
ATOM 1160 O OP1 . DA A 1 2 ? 9.750 35.990 43.220 1.00 0.00 ? ? ? ? ? ? 2 DA B OP1 2
ATOM 1161 O OP2 . DA A 1 2 ? 8.760 34.230 41.670 1.00 0.00 ? ? ? ? ? ? 2 DA B OP2 2
ATOM 1162 O "O5'" . DA A 1 2 ? 10.990 35.100 41.200 1.00 0.00 ? ? ? ? ? ? 2 DA B "O5'" 2
ATOM 1163 C "C5'" . DA A 1 2 ? 12.310 35.610 41.490 1.00 0.00 ? ? ? ? ? ? 2 DA B "C5'" 2
ATOM 1164 C "C4'" . DA A 1 2 ? 13.370 34.550 41.300 1.00 0.00 ? ? ? ? ? ? 2 DA B "C4'" 2
ATOM 1165 O "O4'" . DA A 1 2 ? 13.240 33.470 42.230 1.00 0.00 ? ? ? ? ? ? 2 DA B "O4'" 2
ATOM 1166 C "C3'" . DA A 1 2 ? 13.320 33.940 39.900 1.00 0.00 ? ? ? ? ? ? 2 DA B "C3'" 2
ATOM 1167 O "O3'" . DA A 1 2 ? 14.290 34.540 38.990 1.00 0.00 ? ? ? ? ? ? 2 DA B "O3'" 2
ATOM 1168 C "C2'" . DA A 1 2 ? 13.530 32.470 40.140 1.00 0.00 ? ? ? ? ? ? 2 DA B "C2'" 2
ATOM 1169 C "C1'" . DA A 1 2 ? 14.020 32.470 41.580 1.00 0.00 ? ? ? ? ? ? 2 DA B "C1'" 2
ATOM 1170 N N9 . DA A 1 2 ? 13.910 31.210 42.320 1.00 0.00 ? ? ? ? ? ? 2 DA B N9 2
ATOM 1171 C C8 . DA A 1 2 ? 12.820 30.480 42.470 1.00 0.00 ? ? ? ? ? ? 2 DA B C8 2
ATOM 1172 N N7 . DA A 1 2 ? 13.150 29.270 42.920 1.00 0.00 ? ? ? ? ? ? 2 DA B N7 2
ATOM 1173 C C5 . DA A 1 2 ? 14.480 29.250 43.070 1.00 0.00 ? ? ? ? ? ? 2 DA B C5 2
ATOM 1174 C C6 . DA A 1 2 ? 15.470 28.330 43.460 1.00 0.00 ? ? ? ? ? ? 2 DA B C6 2
ATOM 1175 N N6 . DA A 1 2 ? 15.220 27.080 43.710 1.00 0.00 ? ? ? ? ? ? 2 DA B N6 2
ATOM 1176 N N1 . DA A 1 2 ? 16.780 28.670 43.520 1.00 0.00 ? ? ? ? ? ? 2 DA B N1 2
ATOM 1177 C C2 . DA A 1 2 ? 17.180 29.880 43.150 1.00 0.00 ? ? ? ? ? ? 2 DA B C2 2
ATOM 1178 N N3 . DA A 1 2 ? 16.280 30.780 42.730 1.00 0.00 ? ? ? ? ? ? 2 DA B N3 2
ATOM 1179 C C4 . DA A 1 2 ? 14.960 30.500 42.690 1.00 0.00 ? ? ? ? ? ? 2 DA B C4 2
ATOM 1180 H H61 . DA A 1 2 ? 15.980 26.440 43.790 1.00 0.00 ? ? ? ? ? ? 2 DA B H61 2
ATOM 1181 H H62 . DA A 1 2 ? 14.300 26.840 44.050 1.00 0.00 ? ? ? ? ? ? 2 DA B H62 2
ATOM 1182 P P . DT A 1 3 ? 13.810 35.070 37.550 1.00 0.00 ? ? ? ? ? ? 3 DT B P 2
ATOM 1183 O OP1 . DT A 1 3 ? 13.210 36.410 37.690 1.00 0.00 ? ? ? ? ? ? 3 DT B OP1 2
ATOM 1184 O OP2 . DT A 1 3 ? 13.000 33.990 36.940 1.00 0.00 ? ? ? ? ? ? 3 DT B OP2 2
ATOM 1185 O "O5'" . DT A 1 3 ? 15.170 35.260 36.720 1.00 0.00 ? ? ? ? ? ? 3 DT B "O5'" 2
ATOM 1186 C "C5'" . DT A 1 3 ? 15.760 34.190 35.960 1.00 0.00 ? ? ? ? ? ? 3 DT B "C5'" 2
ATOM 1187 C "C4'" . DT A 1 3 ? 16.530 33.120 36.740 1.00 0.00 ? ? ? ? ? ? 3 DT B "C4'" 2
ATOM 1188 O "O4'" . DT A 1 3 ? 15.910 32.240 37.690 1.00 0.00 ? ? ? ? ? ? 3 DT B "O4'" 2
ATOM 1189 C "C3'" . DT A 1 3 ? 17.220 32.220 35.750 1.00 0.00 ? ? ? ? ? ? 3 DT B "C3'" 2
ATOM 1190 O "O3'" . DT A 1 3 ? 18.440 32.850 35.280 1.00 0.00 ? ? ? ? ? ? 3 DT B "O3'" 2
ATOM 1191 C "C2'" . DT A 1 3 ? 17.520 30.980 36.550 1.00 0.00 ? ? ? ? ? ? 3 DT B "C2'" 2
ATOM 1192 C "C1'" . DT A 1 3 ? 17.040 31.360 37.930 1.00 0.00 ? ? ? ? ? ? 3 DT B "C1'" 2
ATOM 1193 N N1 . DT A 1 3 ? 16.710 30.160 38.750 1.00 0.00 ? ? ? ? ? ? 3 DT B N1 2
ATOM 1194 C C2 . DT A 1 3 ? 17.730 29.450 39.420 1.00 0.00 ? ? ? ? ? ? 3 DT B C2 2
ATOM 1195 O O2 . DT A 1 3 ? 18.910 29.610 39.150 1.00 0.00 ? ? ? ? ? ? 3 DT B O2 2
ATOM 1196 N N3 . DT A 1 3 ? 17.410 28.320 40.170 1.00 0.00 ? ? ? ? ? ? 3 DT B N3 2
ATOM 1197 C C4 . DT A 1 3 ? 16.090 27.860 40.200 1.00 0.00 ? ? ? ? ? ? 3 DT B C4 2
ATOM 1198 O O4 . DT A 1 3 ? 15.910 26.770 40.740 1.00 0.00 ? ? ? ? ? ? 3 DT B O4 2
ATOM 1199 C C5 . DT A 1 3 ? 15.060 28.540 39.540 1.00 0.00 ? ? ? ? ? ? 3 DT B C5 2
ATOM 1200 C C7 . DT A 1 3 ? 13.590 28.120 39.660 1.00 0.00 ? ? ? ? ? ? 3 DT B C7 2
ATOM 1201 C C6 . DT A 1 3 ? 15.380 29.700 38.830 1.00 0.00 ? ? ? ? ? ? 3 DT B C6 2
ATOM 1202 H H3 . DT A 1 3 ? 18.080 27.970 40.840 1.00 0.00 ? ? ? ? ? ? 3 DT B H3 2
ATOM 1203 P P . DT A 1 4 ? 19.340 32.370 34.040 1.00 0.00 ? ? ? ? ? ? 4 DT B P 2
ATOM 1204 O OP1 . DT A 1 4 ? 20.000 33.580 33.490 1.00 0.00 ? ? ? ? ? ? 4 DT B OP1 2
ATOM 1205 O OP2 . DT A 1 4 ? 18.630 31.460 33.110 1.00 0.00 ? ? ? ? ? ? 4 DT B OP2 2
ATOM 1206 O "O5'" . DT A 1 4 ? 20.470 31.440 34.690 1.00 0.00 ? ? ? ? ? ? 4 DT B "O5'" 2
ATOM 1207 C "C5'" . DT A 1 4 ? 21.550 32.010 35.460 1.00 0.00 ? ? ? ? ? ? 4 DT B "C5'" 2
ATOM 1208 C "C4'" . DT A 1 4 ? 22.290 30.950 36.270 1.00 0.00 ? ? ? ? ? ? 4 DT B "C4'" 2
ATOM 1209 O "O4'" . DT A 1 4 ? 21.350 30.090 36.940 1.00 0.00 ? ? ? ? ? ? 4 DT B "O4'" 2
ATOM 1210 C "C3'" . DT A 1 4 ? 23.170 29.980 35.480 1.00 0.00 ? ? ? ? ? ? 4 DT B "C3'" 2
ATOM 1211 O "O3'" . DT A 1 4 ? 24.410 29.890 36.230 1.00 0.00 ? ? ? ? ? ? 4 DT B "O3'" 2
ATOM 1212 C "C2'" . DT A 1 4 ? 22.440 28.670 35.400 1.00 0.00 ? ? ? ? ? ? 4 DT B "C2'" 2
ATOM 1213 C "C1'" . DT A 1 4 ? 21.760 28.720 36.750 1.00 0.00 ? ? ? ? ? ? 4 DT B "C1'" 2
ATOM 1214 N N1 . DT A 1 4 ? 20.540 27.900 36.770 1.00 0.00 ? ? ? ? ? ? 4 DT B N1 2
ATOM 1215 C C2 . DT A 1 4 ? 20.340 26.960 37.810 1.00 0.00 ? ? ? ? ? ? 4 DT B C2 2
ATOM 1216 O O2 . DT A 1 4 ? 21.210 26.640 38.620 1.00 0.00 ? ? ? ? ? ? 4 DT B O2 2
ATOM 1217 N N3 . DT A 1 4 ? 19.110 26.330 37.920 1.00 0.00 ? ? ? ? ? ? 4 DT B N3 2
ATOM 1218 C C4 . DT A 1 4 ? 18.070 26.630 37.030 1.00 0.00 ? ? ? ? ? ? 4 DT B C4 2
ATOM 1219 O O4 . DT A 1 4 ? 16.970 26.210 37.340 1.00 0.00 ? ? ? ? ? ? 4 DT B O4 2
ATOM 1220 C C5 . DT A 1 4 ? 18.260 27.540 35.980 1.00 0.00 ? ? ? ? ? ? 4 DT B C5 2
ATOM 1221 C C7 . DT A 1 4 ? 17.150 27.860 34.980 1.00 0.00 ? ? ? ? ? ? 4 DT B C7 2
ATOM 1222 C C6 . DT A 1 4 ? 19.500 28.160 35.850 1.00 0.00 ? ? ? ? ? ? 4 DT B C6 2
ATOM 1223 H H3 . DT A 1 4 ? 19.010 25.610 38.610 1.00 0.00 ? ? ? ? ? ? 4 DT B H3 2
ATOM 1224 P P . DG A 1 5 ? 25.700 29.160 35.640 1.00 0.00 ? ? ? ? ? ? 5 DG B P 2
ATOM 1225 O OP1 . DG A 1 5 ? 26.910 29.640 36.350 1.00 0.00 ? ? ? ? ? ? 5 DG B OP1 2
ATOM 1226 O OP2 . DG A 1 5 ? 25.710 29.280 34.170 1.00 0.00 ? ? ? ? ? ? 5 DG B OP2 2
ATOM 1227 O "O5'" . DG A 1 5 ? 25.450 27.610 35.940 1.00 0.00 ? ? ? ? ? ? 5 DG B "O5'" 2
ATOM 1228 C "C5'" . DG A 1 5 ? 25.510 27.120 37.290 1.00 0.00 ? ? ? ? ? ? 5 DG B "C5'" 2
ATOM 1229 C "C4'" . DG A 1 5 ? 24.950 25.710 37.370 1.00 0.00 ? ? ? ? ? ? 5 DG B "C4'" 2
ATOM 1230 O "O4'" . DG A 1 5 ? 23.540 25.570 37.200 1.00 0.00 ? ? ? ? ? ? 5 DG B "O4'" 2
ATOM 1231 C "C3'" . DG A 1 5 ? 25.640 24.800 36.380 1.00 0.00 ? ? ? ? ? ? 5 DG B "C3'" 2
ATOM 1232 O "O3'" . DG A 1 5 ? 26.510 23.920 37.090 1.00 0.00 ? ? ? ? ? ? 5 DG B "O3'" 2
ATOM 1233 C "C2'" . DG A 1 5 ? 24.530 24.010 35.740 1.00 0.00 ? ? ? ? ? ? 5 DG B "C2'" 2
ATOM 1234 C "C1'" . DG A 1 5 ? 23.370 24.230 36.700 1.00 0.00 ? ? ? ? ? ? 5 DG B "C1'" 2
ATOM 1235 N N9 . DG A 1 5 ? 22.110 24.240 35.950 1.00 0.00 ? ? ? ? ? ? 5 DG B N9 2
ATOM 1236 C C8 . DG A 1 5 ? 21.820 25.160 35.050 1.00 0.00 ? ? ? ? ? ? 5 DG B C8 2
ATOM 1237 N N7 . DG A 1 5 ? 20.510 25.190 34.800 1.00 0.00 ? ? ? ? ? ? 5 DG B N7 2
ATOM 1238 C C5 . DG A 1 5 ? 19.960 24.220 35.530 1.00 0.00 ? ? ? ? ? ? 5 DG B C5 2
ATOM 1239 C C6 . DG A 1 5 ? 18.680 23.650 35.550 1.00 0.00 ? ? ? ? ? ? 5 DG B C6 2
ATOM 1240 O O6 . DG A 1 5 ? 17.730 24.150 34.950 1.00 0.00 ? ? ? ? ? ? 5 DG B O6 2
ATOM 1241 N N1 . DG A 1 5 ? 18.480 22.470 36.270 1.00 0.00 ? ? ? ? ? ? 5 DG B N1 2
ATOM 1242 C C2 . DG A 1 5 ? 19.550 21.900 36.940 1.00 0.00 ? ? ? ? ? ? 5 DG B C2 2
ATOM 1243 N N2 . DG A 1 5 ? 19.400 20.810 37.640 1.00 0.00 ? ? ? ? ? ? 5 DG B N2 2
ATOM 1244 N N3 . DG A 1 5 ? 20.770 22.460 36.920 1.00 0.00 ? ? ? ? ? ? 5 DG B N3 2
ATOM 1245 C C4 . DG A 1 5 ? 20.990 23.600 36.250 1.00 0.00 ? ? ? ? ? ? 5 DG B C4 2
ATOM 1246 H H1 . DG A 1 5 ? 17.570 22.080 36.400 1.00 0.00 ? ? ? ? ? ? 5 DG B H1 2
ATOM 1247 H H21 . DG A 1 5 ? 18.500 20.400 37.820 1.00 0.00 ? ? ? ? ? ? 5 DG B H21 2
ATOM 1248 H H22 . DG A 1 5 ? 20.220 20.410 38.070 1.00 0.00 ? ? ? ? ? ? 5 DG B H22 2
ATOM 1249 P P . DT A 1 6 ? 27.570 22.980 36.320 1.00 0.00 ? ? ? ? ? ? 6 DT B P 2
ATOM 1250 O OP1 . DT A 1 6 ? 28.840 23.090 37.070 1.00 0.00 ? ? ? ? ? ? 6 DT B OP1 2
ATOM 1251 O OP2 . DT A 1 6 ? 27.550 23.320 34.880 1.00 0.00 ? ? ? ? ? ? 6 DT B OP2 2
ATOM 1252 O "O5'" . DT A 1 6 ? 26.970 21.500 36.460 1.00 0.00 ? ? ? ? ? ? 6 DT B "O5'" 2
ATOM 1253 C "C5'" . DT A 1 6 ? 26.660 21.010 37.780 1.00 0.00 ? ? ? ? ? ? 6 DT B "C5'" 2
ATOM 1254 C "C4'" . DT A 1 6 ? 25.480 20.060 37.830 1.00 0.00 ? ? ? ? ? ? 6 DT B "C4'" 2
ATOM 1255 O "O4'" . DT A 1 6 ? 24.270 20.590 37.250 1.00 0.00 ? ? ? ? ? ? 6 DT B "O4'" 2
ATOM 1256 C "C3'" . DT A 1 6 ? 25.870 18.830 37.050 1.00 0.00 ? ? ? ? ? ? 6 DT B "C3'" 2
ATOM 1257 O "O3'" . DT A 1 6 ? 26.180 17.750 37.970 1.00 0.00 ? ? ? ? ? ? 6 DT B "O3'" 2
ATOM 1258 C "C2'" . DT A 1 6 ? 24.730 18.570 36.110 1.00 0.00 ? ? ? ? ? ? 6 DT B "C2'" 2
ATOM 1259 C "C1'" . DT A 1 6 ? 23.620 19.470 36.650 1.00 0.00 ? ? ? ? ? ? 6 DT B "C1'" 2
ATOM 1260 N N1 . DT A 1 6 ? 22.770 19.970 35.540 1.00 0.00 ? ? ? ? ? ? 6 DT B N1 2
ATOM 1261 C C2 . DT A 1 6 ? 21.450 19.520 35.410 1.00 0.00 ? ? ? ? ? ? 6 DT B C2 2
ATOM 1262 O O2 . DT A 1 6 ? 21.040 18.520 35.990 1.00 0.00 ? ? ? ? ? ? 6 DT B O2 2
ATOM 1263 N N3 . DT A 1 6 ? 20.620 20.080 34.450 1.00 0.00 ? ? ? ? ? ? 6 DT B N3 2
ATOM 1264 C C4 . DT A 1 6 ? 21.110 21.080 33.610 1.00 0.00 ? ? ? ? ? ? 6 DT B C4 2
ATOM 1265 O O4 . DT A 1 6 ? 20.250 21.610 32.900 1.00 0.00 ? ? ? ? ? ? 6 DT B O4 2
ATOM 1266 C C5 . DT A 1 6 ? 22.430 21.530 33.690 1.00 0.00 ? ? ? ? ? ? 6 DT B C5 2
ATOM 1267 C C7 . DT A 1 6 ? 23.010 22.560 32.720 1.00 0.00 ? ? ? ? ? ? 6 DT B C7 2
ATOM 1268 C C6 . DT A 1 6 ? 23.260 20.950 34.660 1.00 0.00 ? ? ? ? ? ? 6 DT B C6 2
ATOM 1269 H H3 . DT A 1 6 ? 19.690 19.760 34.330 1.00 0.00 ? ? ? ? ? ? 6 DT B H3 2
ATOM 1270 P P . DG A 1 7 ? 26.940 16.410 37.520 1.00 0.00 ? ? ? ? ? ? 7 DG B P 2
ATOM 1271 O OP1 . DG A 1 7 ? 27.300 15.670 38.750 1.00 0.00 ? ? ? ? ? ? 7 DG B OP1 2
ATOM 1272 O OP2 . DG A 1 7 ? 27.980 16.660 36.490 1.00 0.00 ? ? ? ? ? ? 7 DG B OP2 2
ATOM 1273 O "O5'" . DG A 1 7 ? 25.760 15.610 36.810 1.00 0.00 ? ? ? ? ? ? 7 DG B "O5'" 2
ATOM 1274 C "C5'" . DG A 1 7 ? 24.810 14.940 37.670 1.00 0.00 ? ? ? ? ? ? 7 DG B "C5'" 2
ATOM 1275 C "C4'" . DG A 1 7 ? 23.600 14.400 36.950 1.00 0.00 ? ? ? ? ? ? 7 DG B "C4'" 2
ATOM 1276 O "O4'" . DG A 1 7 ? 23.010 15.470 36.210 1.00 0.00 ? ? ? ? ? ? 7 DG B "O4'" 2
ATOM 1277 C "C3'" . DG A 1 7 ? 24.030 13.350 35.960 1.00 0.00 ? ? ? ? ? ? 7 DG B "C3'" 2
ATOM 1278 O "O3'" . DG A 1 7 ? 23.420 12.100 36.330 1.00 0.00 ? ? ? ? ? ? 7 DG B "O3'" 2
ATOM 1279 C "C2'" . DG A 1 7 ? 23.660 13.880 34.610 1.00 0.00 ? ? ? ? ? ? 7 DG B "C2'" 2
ATOM 1280 C "C1'" . DG A 1 7 ? 22.540 14.850 35.010 1.00 0.00 ? ? ? ? ? ? 7 DG B "C1'" 2
ATOM 1281 N N9 . DG A 1 7 ? 22.230 15.850 33.980 1.00 0.00 ? ? ? ? ? ? 7 DG B N9 2
ATOM 1282 C C8 . DG A 1 7 ? 23.070 16.740 33.480 1.00 0.00 ? ? ? ? ? ? 7 DG B C8 2
ATOM 1283 N N7 . DG A 1 7 ? 22.410 17.670 32.800 1.00 0.00 ? ? ? ? ? ? 7 DG B N7 2
ATOM 1284 C C5 . DG A 1 7 ? 21.130 17.310 32.800 1.00 0.00 ? ? ? ? ? ? 7 DG B C5 2
ATOM 1285 C C6 . DG A 1 7 ? 20.000 17.790 32.140 1.00 0.00 ? ? ? ? ? ? 7 DG B C6 2
ATOM 1286 O O6 . DG A 1 7 ? 19.960 18.950 31.720 1.00 0.00 ? ? ? ? ? ? 7 DG B O6 2
ATOM 1287 N N1 . DG A 1 7 ? 18.810 17.070 32.210 1.00 0.00 ? ? ? ? ? ? 7 DG B N1 2
ATOM 1288 C C2 . DG A 1 7 ? 18.740 15.960 33.030 1.00 0.00 ? ? ? ? ? ? 7 DG B C2 2
ATOM 1289 N N2 . DG A 1 7 ? 17.560 15.540 33.390 1.00 0.00 ? ? ? ? ? ? 7 DG B N2 2
ATOM 1290 N N3 . DG A 1 7 ? 19.820 15.510 33.670 1.00 0.00 ? ? ? ? ? ? 7 DG B N3 2
ATOM 1291 C C4 . DG A 1 7 ? 21.010 16.150 33.560 1.00 0.00 ? ? ? ? ? ? 7 DG B C4 2
ATOM 1292 H H1 . DG A 1 7 ? 18.110 17.200 31.510 1.00 0.00 ? ? ? ? ? ? 7 DG B H1 2
ATOM 1293 H H21 . DG A 1 7 ? 16.720 15.890 32.970 1.00 0.00 ? ? ? ? ? ? 7 DG B H21 2
ATOM 1294 H H22 . DG A 1 7 ? 17.510 14.780 34.050 1.00 0.00 ? ? ? ? ? ? 7 DG B H22 2
ATOM 1295 P P . DA A 1 8 ? 23.780 10.720 35.610 1.00 0.00 ? ? ? ? ? ? 8 DA B P 2
ATOM 1296 O OP1 . DA A 1 8 ? 23.750 9.670 36.660 1.00 0.00 ? ? ? ? ? ? 8 DA B OP1 2
ATOM 1297 O OP2 . DA A 1 8 ? 25.000 10.920 34.800 1.00 0.00 ? ? ? ? ? ? 8 DA B OP2 2
ATOM 1298 O "O5'" . DA A 1 8 ? 22.510 10.570 34.640 1.00 0.00 ? ? ? ? ? ? 8 DA B "O5'" 2
ATOM 1299 C "C5'" . DA A 1 8 ? 21.190 10.840 35.170 1.00 0.00 ? ? ? ? ? ? 8 DA B "C5'" 2
ATOM 1300 C "C4'" . DA A 1 8 ? 20.100 11.090 34.130 1.00 0.00 ? ? ? ? ? ? 8 DA B "C4'" 2
ATOM 1301 O "O4'" . DA A 1 8 ? 20.340 12.330 33.460 1.00 0.00 ? ? ? ? ? ? 8 DA B "O4'" 2
ATOM 1302 C "C3'" . DA A 1 8 ? 20.100 10.000 33.080 1.00 0.00 ? ? ? ? ? ? 8 DA B "C3'" 2
ATOM 1303 O "O3'" . DA A 1 8 ? 18.760 9.510 32.870 1.00 0.00 ? ? ? ? ? ? 8 DA B "O3'" 2
ATOM 1304 C "C2'" . DA A 1 8 ? 20.780 10.680 31.900 1.00 0.00 ? ? ? ? ? ? 8 DA B "C2'" 2
ATOM 1305 C "C1'" . DA A 1 8 ? 20.130 12.040 32.070 1.00 0.00 ? ? ? ? ? ? 8 DA B "C1'" 2
ATOM 1306 N N9 . DA A 1 8 ? 20.790 13.120 31.320 1.00 0.00 ? ? ? ? ? ? 8 DA B N9 2
ATOM 1307 C C8 . DA A 1 8 ? 22.080 13.410 31.300 1.00 0.00 ? ? ? ? ? ? 8 DA B C8 2
ATOM 1308 N N7 . DA A 1 8 ? 22.300 14.550 30.630 1.00 0.00 ? ? ? ? ? ? 8 DA B N7 2
ATOM 1309 C C5 . DA A 1 8 ? 21.110 14.940 30.180 1.00 0.00 ? ? ? ? ? ? 8 DA B C5 2
ATOM 1310 C C6 . DA A 1 8 ? 20.640 15.950 29.340 1.00 0.00 ? ? ? ? ? ? 8 DA B C6 2
ATOM 1311 N N6 . DA A 1 8 ? 21.420 16.930 28.940 1.00 0.00 ? ? ? ? ? ? 8 DA B N6 2
ATOM 1312 N N1 . DA A 1 8 ? 19.370 15.960 28.910 1.00 0.00 ? ? ? ? ? ? 8 DA B N1 2
ATOM 1313 C C2 . DA A 1 8 ? 18.490 15.020 29.280 1.00 0.00 ? ? ? ? ? ? 8 DA B C2 2
ATOM 1314 N N3 . DA A 1 8 ? 18.880 14.080 30.130 1.00 0.00 ? ? ? ? ? ? 8 DA B N3 2
ATOM 1315 C C4 . DA A 1 8 ? 20.160 14.020 30.580 1.00 0.00 ? ? ? ? ? ? 8 DA B C4 2
ATOM 1316 H H61 . DA A 1 8 ? 21.040 17.710 28.440 1.00 0.00 ? ? ? ? ? ? 8 DA B H61 2
ATOM 1317 H H62 . DA A 1 8 ? 22.400 16.850 29.120 1.00 0.00 ? ? ? ? ? ? 8 DA B H62 2
ATOM 1318 P P . DG A 1 9 ? 18.500 8.090 32.190 1.00 0.00 ? ? ? ? ? ? 9 DG B P 2
ATOM 1319 O OP1 . DG A 1 9 ? 17.370 7.460 32.890 1.00 0.00 ? ? ? ? ? ? 9 DG B OP1 2
ATOM 1320 O OP2 . DG A 1 9 ? 19.770 7.340 32.050 1.00 0.00 ? ? ? ? ? ? 9 DG B OP2 2
ATOM 1321 O "O5'" . DG A 1 9 ? 17.940 8.490 30.750 1.00 0.00 ? ? ? ? ? ? 9 DG B "O5'" 2
ATOM 1322 C "C5'" . DG A 1 9 ? 16.660 9.140 30.600 1.00 0.00 ? ? ? ? ? ? 9 DG B "C5'" 2
ATOM 1323 C "C4'" . DG A 1 9 ? 16.600 9.790 29.230 1.00 0.00 ? ? ? ? ? ? 9 DG B "C4'" 2
ATOM 1324 O "O4'" . DG A 1 9 ? 17.530 10.880 29.010 1.00 0.00 ? ? ? ? ? ? 9 DG B "O4'" 2
ATOM 1325 C "C3'" . DG A 1 9 ? 16.920 8.750 28.180 1.00 0.00 ? ? ? ? ? ? 9 DG B "C3'" 2
ATOM 1326 O "O3'" . DG A 1 9 ? 15.740 8.540 27.370 1.00 0.00 ? ? ? ? ? ? 9 DG B "O3'" 2
ATOM 1327 C "C2'" . DG A 1 9 ? 18.230 9.180 27.600 1.00 0.00 ? ? ? ? ? ? 9 DG B "C2'" 2
ATOM 1328 C "C1'" . DG A 1 9 ? 18.080 10.690 27.680 1.00 0.00 ? ? ? ? ? ? 9 DG B "C1'" 2
ATOM 1329 N N9 . DG A 1 9 ? 19.340 11.420 27.560 1.00 0.00 ? ? ? ? ? ? 9 DG B N9 2
ATOM 1330 C C8 . DG A 1 9 ? 20.420 11.200 28.300 1.00 0.00 ? ? ? ? ? ? 9 DG B C8 2
ATOM 1331 N N7 . DG A 1 9 ? 21.340 12.130 28.060 1.00 0.00 ? ? ? ? ? ? 9 DG B N7 2
ATOM 1332 C C5 . DG A 1 9 ? 20.830 12.960 27.150 1.00 0.00 ? ? ? ? ? ? 9 DG B C5 2
ATOM 1333 C C6 . DG A 1 9 ? 21.240 14.180 26.620 1.00 0.00 ? ? ? ? ? ? 9 DG B C6 2
ATOM 1334 O O6 . DG A 1 9 ? 22.390 14.590 26.760 1.00 0.00 ? ? ? ? ? ? 9 DG B O6 2
ATOM 1335 N N1 . DG A 1 9 ? 20.360 14.940 25.860 1.00 0.00 ? ? ? ? ? ? 9 DG B N1 2
ATOM 1336 C C2 . DG A 1 9 ? 19.090 14.440 25.580 1.00 0.00 ? ? ? ? ? ? 9 DG B C2 2
ATOM 1337 N N2 . DG A 1 9 ? 18.250 15.210 24.940 1.00 0.00 ? ? ? ? ? ? 9 DG B N2 2
ATOM 1338 N N3 . DG A 1 9 ? 18.710 13.240 26.040 1.00 0.00 ? ? ? ? ? ? 9 DG B N3 2
ATOM 1339 C C4 . DG A 1 9 ? 19.540 12.510 26.820 1.00 0.00 ? ? ? ? ? ? 9 DG B C4 2
ATOM 1340 H H1 . DG A 1 9 ? 20.570 15.910 25.730 1.00 0.00 ? ? ? ? ? ? 9 DG B H1 2
ATOM 1341 H H21 . DG A 1 9 ? 18.610 16.090 24.620 1.00 0.00 ? ? ? ? ? ? 9 DG B H21 2
ATOM 1342 H H22 . DG A 1 9 ? 17.280 14.980 24.850 1.00 0.00 ? ? ? ? ? ? 9 DG B H22 2
ATOM 1343 P P . DC A 1 10 ? 15.730 7.600 26.080 1.00 0.00 ? ? ? ? ? ? 10 DC B P 2
ATOM 1344 O OP1 . DC A 1 10 ? 14.330 7.280 25.720 1.00 0.00 ? ? ? ? ? ? 10 DC B OP1 2
ATOM 1345 O OP2 . DC A 1 10 ? 16.670 6.470 26.320 1.00 0.00 ? ? ? ? ? ? 10 DC B OP2 2
ATOM 1346 O "O5'" . DC A 1 10 ? 16.290 8.620 24.970 1.00 0.00 ? ? ? ? ? ? 10 DC B "O5'" 2
ATOM 1347 C "C5'" . DC A 1 10 ? 15.340 9.470 24.320 1.00 0.00 ? ? ? ? ? ? 10 DC B "C5'" 2
ATOM 1348 C "C4'" . DC A 1 10 ? 15.820 10.070 23.010 1.00 0.00 ? ? ? ? ? ? 10 DC B "C4'" 2
ATOM 1349 O "O4'" . DC A 1 10 ? 16.890 11.010 23.240 1.00 0.00 ? ? ? ? ? ? 10 DC B "O4'" 2
ATOM 1350 C "C3'" . DC A 1 10 ? 16.310 8.970 22.090 1.00 0.00 ? ? ? ? ? ? 10 DC B "C3'" 2
ATOM 1351 O "O3'" . DC A 1 10 ? 15.690 9.130 20.800 1.00 0.00 ? ? ? ? ? ? 10 DC B "O3'" 2
ATOM 1352 C "C2'" . DC A 1 10 ? 17.810 9.110 22.140 1.00 0.00 ? ? ? ? ? ? 10 DC B "C2'" 2
ATOM 1353 C "C1'" . DC A 1 10 ? 17.940 10.620 22.340 1.00 0.00 ? ? ? ? ? ? 10 DC B "C1'" 2
ATOM 1354 N N1 . DC A 1 10 ? 19.210 10.960 23.030 1.00 0.00 ? ? ? ? ? ? 10 DC B N1 2
ATOM 1355 C C2 . DC A 1 10 ? 19.840 12.200 22.840 1.00 0.00 ? ? ? ? ? ? 10 DC B C2 2
ATOM 1356 O O2 . DC A 1 10 ? 19.430 12.980 21.980 1.00 0.00 ? ? ? ? ? ? 10 DC B O2 2
ATOM 1357 N N3 . DC A 1 10 ? 20.970 12.490 23.530 1.00 0.00 ? ? ? ? ? ? 10 DC B N3 2
ATOM 1358 C C4 . DC A 1 10 ? 21.520 11.600 24.370 1.00 0.00 ? ? ? ? ? ? 10 DC B C4 2
ATOM 1359 N N4 . DC A 1 10 ? 22.740 11.850 24.800 1.00 0.00 ? ? ? ? ? ? 10 DC B N4 2
ATOM 1360 C C5 . DC A 1 10 ? 20.940 10.340 24.620 1.00 0.00 ? ? ? ? ? ? 10 DC B C5 2
ATOM 1361 C C6 . DC A 1 10 ? 19.790 10.030 23.910 1.00 0.00 ? ? ? ? ? ? 10 DC B C6 2
ATOM 1362 H H41 . DC A 1 10 ? 23.290 12.590 24.420 1.00 0.00 ? ? ? ? ? ? 10 DC B H41 2
ATOM 1363 H H42 . DC A 1 10 ? 23.190 11.230 25.480 1.00 0.00 ? ? ? ? ? ? 10 DC B H42 2
ATOM 1364 P P . DG A 1 11 ? 15.990 8.210 19.520 1.00 0.00 ? ? ? ? ? ? 11 DG B P 2
ATOM 1365 O OP1 . DG A 1 11 ? 14.760 8.240 18.690 1.00 0.00 ? ? ? ? ? ? 11 DG B OP1 2
ATOM 1366 O OP2 . DG A 1 11 ? 16.470 6.880 19.990 1.00 0.00 ? ? ? ? ? ? 11 DG B OP2 2
ATOM 1367 O "O5'" . DG A 1 11 ? 17.250 8.920 18.800 1.00 0.00 ? ? ? ? ? ? 11 DG B "O5'" 2
ATOM 1368 C "C5'" . DG A 1 11 ? 17.210 9.990 17.830 1.00 0.00 ? ? ? ? ? ? 11 DG B "C5'" 2
ATOM 1369 C "C4'" . DG A 1 11 ? 18.630 10.490 17.530 1.00 0.00 ? ? ? ? ? ? 11 DG B "C4'" 2
ATOM 1370 O "O4'" . DG A 1 11 ? 19.330 10.890 18.730 1.00 0.00 ? ? ? ? ? ? 11 DG B "O4'" 2
ATOM 1371 C "C3'" . DG A 1 11 ? 19.540 9.440 16.910 1.00 0.00 ? ? ? ? ? ? 11 DG B "C3'" 2
ATOM 1372 O "O3'" . DG A 1 11 ? 19.610 9.540 15.490 1.00 0.00 ? ? ? ? ? ? 11 DG B "O3'" 2
ATOM 1373 C "C2'" . DG A 1 11 ? 20.930 9.760 17.400 1.00 0.00 ? ? ? ? ? ? 11 DG B "C2'" 2
ATOM 1374 C "C1'" . DG A 1 11 ? 20.690 10.950 18.310 1.00 0.00 ? ? ? ? ? ? 11 DG B "C1'" 2
ATOM 1375 N N9 . DG A 1 11 ? 21.650 10.960 19.440 1.00 0.00 ? ? ? ? ? ? 11 DG B N9 2
ATOM 1376 C C8 . DG A 1 11 ? 21.820 10.040 20.380 1.00 0.00 ? ? ? ? ? ? 11 DG B C8 2
ATOM 1377 N N7 . DG A 1 11 ? 22.680 10.500 21.300 1.00 0.00 ? ? ? ? ? ? 11 DG B N7 2
ATOM 1378 C C5 . DG A 1 11 ? 23.100 11.700 20.890 1.00 0.00 ? ? ? ? ? ? 11 DG B C5 2
ATOM 1379 C C6 . DG A 1 11 ? 24.120 12.570 21.280 1.00 0.00 ? ? ? ? ? ? 11 DG B C6 2
ATOM 1380 O O6 . DG A 1 11 ? 24.870 12.330 22.220 1.00 0.00 ? ? ? ? ? ? 11 DG B O6 2
ATOM 1381 N N1 . DG A 1 11 ? 24.460 13.650 20.470 1.00 0.00 ? ? ? ? ? ? 11 DG B N1 2
ATOM 1382 C C2 . DG A 1 11 ? 23.760 13.860 19.280 1.00 0.00 ? ? ? ? ? ? 11 DG B C2 2
ATOM 1383 N N2 . DG A 1 11 ? 24.220 14.690 18.390 1.00 0.00 ? ? ? ? ? ? 11 DG B N2 2
ATOM 1384 N N3 . DG A 1 11 ? 22.760 13.050 18.930 1.00 0.00 ? ? ? ? ? ? 11 DG B N3 2
ATOM 1385 C C4 . DG A 1 11 ? 22.430 11.990 19.700 1.00 0.00 ? ? ? ? ? ? 11 DG B C4 2
ATOM 1386 H "HO3'" . DG A 1 11 ? 20.280 8.910 15.000 1.00 0.00 ? ? ? ? ? ? 11 DG B "HO3'" 2
ATOM 1387 H H1 . DG A 1 11 ? 25.240 14.220 20.700 1.00 0.00 ? ? ? ? ? ? 11 DG B H1 2
ATOM 1388 H H21 . DG A 1 11 ? 25.030 15.270 18.540 1.00 0.00 ? ? ? ? ? ? 11 DG B H21 2
ATOM 1389 H H22 . DG A 1 11 ? 23.670 14.920 17.570 1.00 0.00 ? ? ? ? ? ? 11 DG B H22 2
ATOM 1390 O "O5'" . DC B 2 1 ? 33.320 17.310 20.690 1.00 0.00 ? ? ? ? ? ? 1 DC C "O5'" 2
ATOM 1391 C "C5'" . DC B 2 1 ? 32.290 18.300 20.720 1.00 0.00 ? ? ? ? ? ? 1 DC C "C5'" 2
ATOM 1392 C "C4'" . DC B 2 1 ? 31.090 17.790 19.950 1.00 0.00 ? ? ? ? ? ? 1 DC C "C4'" 2
ATOM 1393 O "O4'" . DC B 2 1 ? 30.630 16.570 20.570 1.00 0.00 ? ? ? ? ? ? 1 DC C "O4'" 2
ATOM 1394 C "C3'" . DC B 2 1 ? 29.960 18.800 20.020 1.00 0.00 ? ? ? ? ? ? 1 DC C "C3'" 2
ATOM 1395 O "O3'" . DC B 2 1 ? 29.530 19.110 18.680 1.00 0.00 ? ? ? ? ? ? 1 DC C "O3'" 2
ATOM 1396 C "C2'" . DC B 2 1 ? 28.910 18.110 20.820 1.00 0.00 ? ? ? ? ? ? 1 DC C "C2'" 2
ATOM 1397 C "C1'" . DC B 2 1 ? 29.200 16.680 20.500 1.00 0.00 ? ? ? ? ? ? 1 DC C "C1'" 2
ATOM 1398 N N1 . DC B 2 1 ? 28.600 15.780 21.490 1.00 0.00 ? ? ? ? ? ? 1 DC C N1 2
ATOM 1399 C C2 . DC B 2 1 ? 27.590 14.850 21.150 1.00 0.00 ? ? ? ? ? ? 1 DC C C2 2
ATOM 1400 O O2 . DC B 2 1 ? 26.910 15.000 20.140 1.00 0.00 ? ? ? ? ? ? 1 DC C O2 2
ATOM 1401 N N3 . DC B 2 1 ? 27.060 14.100 22.140 1.00 0.00 ? ? ? ? ? ? 1 DC C N3 2
ATOM 1402 C C4 . DC B 2 1 ? 27.430 14.280 23.410 1.00 0.00 ? ? ? ? ? ? 1 DC C C4 2
ATOM 1403 N N4 . DC B 2 1 ? 26.640 13.680 24.250 1.00 0.00 ? ? ? ? ? ? 1 DC C N4 2
ATOM 1404 C C5 . DC B 2 1 ? 28.380 15.230 23.830 1.00 0.00 ? ? ? ? ? ? 1 DC C C5 2
ATOM 1405 C C6 . DC B 2 1 ? 28.990 15.960 22.830 1.00 0.00 ? ? ? ? ? ? 1 DC C C6 2
ATOM 1406 H H41 . DC B 2 1 ? 25.710 13.520 23.930 1.00 0.00 ? ? ? ? ? ? 1 DC C H41 2
ATOM 1407 H H42 . DC B 2 1 ? 26.780 13.740 25.260 1.00 0.00 ? ? ? ? ? ? 1 DC C H42 2
ATOM 1408 H "HO5'" . DC B 2 1 ? 34.100 17.690 21.200 1.00 0.00 ? ? ? ? ? ? 1 DC C "HO5'" 2
ATOM 1409 P P . DG B 2 2 ? 28.950 20.560 18.340 1.00 0.00 ? ? ? ? ? ? 2 DG C P 2
ATOM 1410 O OP1 . DG B 2 2 ? 29.030 20.690 16.870 1.00 0.00 ? ? ? ? ? ? 2 DG C OP1 2
ATOM 1411 O OP2 . DG B 2 2 ? 29.690 21.550 19.160 1.00 0.00 ? ? ? ? ? ? 2 DG C OP2 2
ATOM 1412 O "O5'" . DG B 2 2 ? 27.440 20.410 18.850 1.00 0.00 ? ? ? ? ? ? 2 DG C "O5'" 2
ATOM 1413 C "C5'" . DG B 2 2 ? 26.370 20.150 17.910 1.00 0.00 ? ? ? ? ? ? 2 DG C "C5'" 2
ATOM 1414 C "C4'" . DG B 2 2 ? 25.070 19.960 18.660 1.00 0.00 ? ? ? ? ? ? 2 DG C "C4'" 2
ATOM 1415 O "O4'" . DG B 2 2 ? 25.120 18.750 19.420 1.00 0.00 ? ? ? ? ? ? 2 DG C "O4'" 2
ATOM 1416 C "C3'" . DG B 2 2 ? 24.780 21.120 19.620 1.00 0.00 ? ? ? ? ? ? 2 DG C "C3'" 2
ATOM 1417 O "O3'" . DG B 2 2 ? 23.740 21.980 19.110 1.00 0.00 ? ? ? ? ? ? 2 DG C "O3'" 2
ATOM 1418 C "C2'" . DG B 2 2 ? 24.370 20.440 20.910 1.00 0.00 ? ? ? ? ? ? 2 DG C "C2'" 2
ATOM 1419 C "C1'" . DG B 2 2 ? 24.180 19.010 20.460 1.00 0.00 ? ? ? ? ? ? 2 DG C "C1'" 2
ATOM 1420 N N9 . DG B 2 2 ? 24.460 18.080 21.560 1.00 0.00 ? ? ? ? ? ? 2 DG C N9 2
ATOM 1421 C C8 . DG B 2 2 ? 25.530 18.060 22.360 1.00 0.00 ? ? ? ? ? ? 2 DG C C8 2
ATOM 1422 N N7 . DG B 2 2 ? 25.390 17.080 23.260 1.00 0.00 ? ? ? ? ? ? 2 DG C N7 2
ATOM 1423 C C5 . DG B 2 2 ? 24.210 16.500 23.040 1.00 0.00 ? ? ? ? ? ? 2 DG C C5 2
ATOM 1424 C C6 . DG B 2 2 ? 23.490 15.490 23.660 1.00 0.00 ? ? ? ? ? ? 2 DG C C6 2
ATOM 1425 O O6 . DG B 2 2 ? 23.980 14.750 24.510 1.00 0.00 ? ? ? ? ? ? 2 DG C O6 2
ATOM 1426 N N1 . DG B 2 2 ? 22.210 15.160 23.210 1.00 0.00 ? ? ? ? ? ? 2 DG C N1 2
ATOM 1427 C C2 . DG B 2 2 ? 21.690 15.840 22.110 1.00 0.00 ? ? ? ? ? ? 2 DG C C2 2
ATOM 1428 N N2 . DG B 2 2 ? 20.600 15.390 21.560 1.00 0.00 ? ? ? ? ? ? 2 DG C N2 2
ATOM 1429 N N3 . DG B 2 2 ? 22.360 16.830 21.520 1.00 0.00 ? ? ? ? ? ? 2 DG C N3 2
ATOM 1430 C C4 . DG B 2 2 ? 23.610 17.150 21.960 1.00 0.00 ? ? ? ? ? ? 2 DG C C4 2
ATOM 1431 H H1 . DG B 2 2 ? 21.710 14.430 23.660 1.00 0.00 ? ? ? ? ? ? 2 DG C H1 2
ATOM 1432 H H21 . DG B 2 2 ? 20.220 14.510 21.850 1.00 0.00 ? ? ? ? ? ? 2 DG C H21 2
ATOM 1433 H H22 . DG B 2 2 ? 20.070 15.980 20.940 1.00 0.00 ? ? ? ? ? ? 2 DG C H22 2
ATOM 1434 P P . DC B 2 3 ? 23.090 23.250 19.860 1.00 0.00 ? ? ? ? ? ? 3 DC C P 2
ATOM 1435 O OP1 . DC B 2 3 ? 22.510 24.150 18.830 1.00 0.00 ? ? ? ? ? ? 3 DC C OP1 2
ATOM 1436 O OP2 . DC B 2 3 ? 24.020 23.820 20.840 1.00 0.00 ? ? ? ? ? ? 3 DC C OP2 2
ATOM 1437 O "O5'" . DC B 2 3 ? 21.920 22.640 20.770 1.00 0.00 ? ? ? ? ? ? 3 DC C "O5'" 2
ATOM 1438 C "C5'" . DC B 2 3 ? 20.840 21.960 20.140 1.00 0.00 ? ? ? ? ? ? 3 DC C "C5'" 2
ATOM 1439 C "C4'" . DC B 2 3 ? 20.060 21.050 21.060 1.00 0.00 ? ? ? ? ? ? 3 DC C "C4'" 2
ATOM 1440 O "O4'" . DC B 2 3 ? 20.890 20.160 21.830 1.00 0.00 ? ? ? ? ? ? 3 DC C "O4'" 2
ATOM 1441 C "C3'" . DC B 2 3 ? 19.230 21.870 22.030 1.00 0.00 ? ? ? ? ? ? 3 DC C "C3'" 2
ATOM 1442 O "O3'" . DC B 2 3 ? 17.830 21.700 21.770 1.00 0.00 ? ? ? ? ? ? 3 DC C "O3'" 2
ATOM 1443 C "C2'" . DC B 2 3 ? 19.690 21.370 23.390 1.00 0.00 ? ? ? ? ? ? 3 DC C "C2'" 2
ATOM 1444 C "C1'" . DC B 2 3 ? 20.150 19.960 23.050 1.00 0.00 ? ? ? ? ? ? 3 DC C "C1'" 2
ATOM 1445 N N1 . DC B 2 3 ? 20.980 19.350 24.090 1.00 0.00 ? ? ? ? ? ? 3 DC C N1 2
ATOM 1446 C C2 . DC B 2 3 ? 20.530 18.250 24.870 1.00 0.00 ? ? ? ? ? ? 3 DC C C2 2
ATOM 1447 O O2 . DC B 2 3 ? 19.390 17.790 24.760 1.00 0.00 ? ? ? ? ? ? 3 DC C O2 2
ATOM 1448 N N3 . DC B 2 3 ? 21.310 17.780 25.860 1.00 0.00 ? ? ? ? ? ? 3 DC C N3 2
ATOM 1449 C C4 . DC B 2 3 ? 22.510 18.330 26.120 1.00 0.00 ? ? ? ? ? ? 3 DC C C4 2
ATOM 1450 N N4 . DC B 2 3 ? 23.390 17.580 26.740 1.00 0.00 ? ? ? ? ? ? 3 DC C N4 2
ATOM 1451 C C5 . DC B 2 3 ? 22.990 19.440 25.410 1.00 0.00 ? ? ? ? ? ? 3 DC C C5 2
ATOM 1452 C C6 . DC B 2 3 ? 22.220 19.930 24.380 1.00 0.00 ? ? ? ? ? ? 3 DC C C6 2
ATOM 1453 H H41 . DC B 2 3 ? 23.210 16.610 26.920 1.00 0.00 ? ? ? ? ? ? 3 DC C H41 2
ATOM 1454 H H42 . DC B 2 3 ? 24.280 17.960 27.030 1.00 0.00 ? ? ? ? ? ? 3 DC C H42 2
ATOM 1455 P P . DT B 2 4 ? 16.730 22.600 22.510 1.00 0.00 ? ? ? ? ? ? 4 DT C P 2
ATOM 1456 O OP1 . DT B 2 4 ? 15.940 23.190 21.420 1.00 0.00 ? ? ? ? ? ? 4 DT C OP1 2
ATOM 1457 O OP2 . DT B 2 4 ? 17.390 23.530 23.450 1.00 0.00 ? ? ? ? ? ? 4 DT C OP2 2
ATOM 1458 O "O5'" . DT B 2 4 ? 15.940 21.460 23.310 1.00 0.00 ? ? ? ? ? ? 4 DT C "O5'" 2
ATOM 1459 C "C5'" . DT B 2 4 ? 15.200 20.450 22.600 1.00 0.00 ? ? ? ? ? ? 4 DT C "C5'" 2
ATOM 1460 C "C4'" . DT B 2 4 ? 14.530 19.450 23.540 1.00 0.00 ? ? ? ? ? ? 4 DT C "C4'" 2
ATOM 1461 O "O4'" . DT B 2 4 ? 15.580 18.840 24.320 1.00 0.00 ? ? ? ? ? ? 4 DT C "O4'" 2
ATOM 1462 C "C3'" . DT B 2 4 ? 13.590 20.020 24.600 1.00 0.00 ? ? ? ? ? ? 4 DT C "C3'" 2
ATOM 1463 O "O3'" . DT B 2 4 ? 12.530 19.040 24.730 1.00 0.00 ? ? ? ? ? ? 4 DT C "O3'" 2
ATOM 1464 C "C2'" . DT B 2 4 ? 14.410 20.280 25.820 1.00 0.00 ? ? ? ? ? ? 4 DT C "C2'" 2
ATOM 1465 C "C1'" . DT B 2 4 ? 15.270 19.030 25.700 1.00 0.00 ? ? ? ? ? ? 4 DT C "C1'" 2
ATOM 1466 N N1 . DT B 2 4 ? 16.570 19.160 26.390 1.00 0.00 ? ? ? ? ? ? 4 DT C N1 2
ATOM 1467 C C2 . DT B 2 4 ? 17.090 18.020 27.020 1.00 0.00 ? ? ? ? ? ? 4 DT C C2 2
ATOM 1468 O O2 . DT B 2 4 ? 16.400 17.030 27.240 1.00 0.00 ? ? ? ? ? ? 4 DT C O2 2
ATOM 1469 N N3 . DT B 2 4 ? 18.340 18.120 27.610 1.00 0.00 ? ? ? ? ? ? 4 DT C N3 2
ATOM 1470 C C4 . DT B 2 4 ? 19.070 19.310 27.600 1.00 0.00 ? ? ? ? ? ? 4 DT C C4 2
ATOM 1471 O O4 . DT B 2 4 ? 19.980 19.380 28.420 1.00 0.00 ? ? ? ? ? ? 4 DT C O4 2
ATOM 1472 C C5 . DT B 2 4 ? 18.570 20.450 26.950 1.00 0.00 ? ? ? ? ? ? 4 DT C C5 2
ATOM 1473 C C7 . DT B 2 4 ? 19.320 21.780 26.980 1.00 0.00 ? ? ? ? ? ? 4 DT C C7 2
ATOM 1474 C C6 . DT B 2 4 ? 17.300 20.360 26.350 1.00 0.00 ? ? ? ? ? ? 4 DT C C6 2
ATOM 1475 H H3 . DT B 2 4 ? 18.710 17.320 28.090 1.00 0.00 ? ? ? ? ? ? 4 DT C H3 2
ATOM 1476 P P . DC B 2 5 ? 11.090 19.350 25.360 1.00 0.00 ? ? ? ? ? ? 5 DC C P 2
ATOM 1477 O OP1 . DC B 2 5 ? 10.040 18.610 24.610 1.00 0.00 ? ? ? ? ? ? 5 DC C OP1 2
ATOM 1478 O OP2 . DC B 2 5 ? 10.920 20.800 25.570 1.00 0.00 ? ? ? ? ? ? 5 DC C OP2 2
ATOM 1479 O "O5'" . DC B 2 5 ? 11.160 18.700 26.830 1.00 0.00 ? ? ? ? ? ? 5 DC C "O5'" 2
ATOM 1480 C "C5'" . DC B 2 5 ? 11.450 17.300 27.010 1.00 0.00 ? ? ? ? ? ? 5 DC C "C5'" 2
ATOM 1481 C "C4'" . DC B 2 5 ? 12.190 17.020 28.310 1.00 0.00 ? ? ? ? ? ? 5 DC C "C4'" 2
ATOM 1482 O "O4'" . DC B 2 5 ? 13.490 17.630 28.380 1.00 0.00 ? ? ? ? ? ? 5 DC C "O4'" 2
ATOM 1483 C "C3'" . DC B 2 5 ? 11.430 17.570 29.490 1.00 0.00 ? ? ? ? ? ? 5 DC C "C3'" 2
ATOM 1484 O "O3'" . DC B 2 5 ? 10.670 16.480 30.030 1.00 0.00 ? ? ? ? ? ? 5 DC C "O3'" 2
ATOM 1485 C "C2'" . DC B 2 5 ? 12.460 18.170 30.410 1.00 0.00 ? ? ? ? ? ? 5 DC C "C2'" 2
ATOM 1486 C "C1'" . DC B 2 5 ? 13.780 17.670 29.790 1.00 0.00 ? ? ? ? ? ? 5 DC C "C1'" 2
ATOM 1487 N N1 . DC B 2 5 ? 14.900 18.610 29.950 1.00 0.00 ? ? ? ? ? ? 5 DC C N1 2
ATOM 1488 C C2 . DC B 2 5 ? 16.100 18.220 30.570 1.00 0.00 ? ? ? ? ? ? 5 DC C C2 2
ATOM 1489 O O2 . DC B 2 5 ? 16.230 17.100 31.070 1.00 0.00 ? ? ? ? ? ? 5 DC C O2 2
ATOM 1490 N N3 . DC B 2 5 ? 17.120 19.100 30.670 1.00 0.00 ? ? ? ? ? ? 5 DC C N3 2
ATOM 1491 C C4 . DC B 2 5 ? 16.970 20.360 30.230 1.00 0.00 ? ? ? ? ? ? 5 DC C C4 2
ATOM 1492 N N4 . DC B 2 5 ? 18.070 21.070 30.130 1.00 0.00 ? ? ? ? ? ? 5 DC C N4 2
ATOM 1493 C C5 . DC B 2 5 ? 15.810 20.840 29.610 1.00 0.00 ? ? ? ? ? ? 5 DC C C5 2
ATOM 1494 C C6 . DC B 2 5 ? 14.780 19.920 29.440 1.00 0.00 ? ? ? ? ? ? 5 DC C C6 2
ATOM 1495 H H41 . DC B 2 5 ? 18.940 20.560 30.090 1.00 0.00 ? ? ? ? ? ? 5 DC C H41 2
ATOM 1496 H H42 . DC B 2 5 ? 17.980 22.060 29.950 1.00 0.00 ? ? ? ? ? ? 5 DC C H42 2
ATOM 1497 P P . DA B 2 6 ? 9.320 16.700 30.860 1.00 0.00 ? ? ? ? ? ? 6 DA C P 2
ATOM 1498 O OP1 . DA B 2 6 ? 8.590 15.430 30.730 1.00 0.00 ? ? ? ? ? ? 6 DA C OP1 2
ATOM 1499 O OP2 . DA B 2 6 ? 8.630 17.980 30.570 1.00 0.00 ? ? ? ? ? ? 6 DA C OP2 2
ATOM 1500 O "O5'" . DA B 2 6 ? 9.900 16.830 32.340 1.00 0.00 ? ? ? ? ? ? 6 DA C "O5'" 2
ATOM 1501 C "C5'" . DA B 2 6 ? 10.480 15.640 32.900 1.00 0.00 ? ? ? ? ? ? 6 DA C "C5'" 2
ATOM 1502 C "C4'" . DA B 2 6 ? 11.440 15.990 34.010 1.00 0.00 ? ? ? ? ? ? 6 DA C "C4'" 2
ATOM 1503 O "O4'" . DA B 2 6 ? 12.550 16.780 33.560 1.00 0.00 ? ? ? ? ? ? 6 DA C "O4'" 2
ATOM 1504 C "C3'" . DA B 2 6 ? 10.750 16.800 35.070 1.00 0.00 ? ? ? ? ? ? 6 DA C "C3'" 2
ATOM 1505 O "O3'" . DA B 2 6 ? 10.150 15.830 35.940 1.00 0.00 ? ? ? ? ? ? 6 DA C "O3'" 2
ATOM 1506 C "C2'" . DA B 2 6 ? 11.790 17.780 35.560 1.00 0.00 ? ? ? ? ? ? 6 DA C "C2'" 2
ATOM 1507 C "C1'" . DA B 2 6 ? 13.030 17.410 34.760 1.00 0.00 ? ? ? ? ? ? 6 DA C "C1'" 2
ATOM 1508 N N9 . DA B 2 6 ? 13.800 18.580 34.290 1.00 0.00 ? ? ? ? ? ? 6 DA C N9 2
ATOM 1509 C C8 . DA B 2 6 ? 13.320 19.620 33.620 1.00 0.00 ? ? ? ? ? ? 6 DA C C8 2
ATOM 1510 N N7 . DA B 2 6 ? 14.310 20.410 33.210 1.00 0.00 ? ? ? ? ? ? 6 DA C N7 2
ATOM 1511 C C5 . DA B 2 6 ? 15.450 19.880 33.660 1.00 0.00 ? ? ? ? ? ? 6 DA C C5 2
ATOM 1512 C C6 . DA B 2 6 ? 16.810 20.230 33.710 1.00 0.00 ? ? ? ? ? ? 6 DA C C6 2
ATOM 1513 N N6 . DA B 2 6 ? 17.380 21.210 33.020 1.00 0.00 ? ? ? ? ? ? 6 DA C N6 2
ATOM 1514 N N1 . DA B 2 6 ? 17.700 19.520 34.430 1.00 0.00 ? ? ? ? ? ? 6 DA C N1 2
ATOM 1515 C C2 . DA B 2 6 ? 17.320 18.460 35.130 1.00 0.00 ? ? ? ? ? ? 6 DA C C2 2
ATOM 1516 N N3 . DA B 2 6 ? 16.040 18.060 35.100 1.00 0.00 ? ? ? ? ? ? 6 DA C N3 2
ATOM 1517 C C4 . DA B 2 6 ? 15.110 18.730 34.380 1.00 0.00 ? ? ? ? ? ? 6 DA C C4 2
ATOM 1518 H H61 . DA B 2 6 ? 18.360 21.360 33.170 1.00 0.00 ? ? ? ? ? ? 6 DA C H61 2
ATOM 1519 H H62 . DA B 2 6 ? 17.010 21.550 32.170 1.00 0.00 ? ? ? ? ? ? 6 DA C H62 2
ATOM 1520 P P . DC B 2 7 ? 9.770 16.120 37.460 1.00 0.00 ? ? ? ? ? ? 7 DC C P 2
ATOM 1521 O OP1 . DC B 2 7 ? 9.000 14.970 37.960 1.00 0.00 ? ? ? ? ? ? 7 DC C OP1 2
ATOM 1522 O OP2 . DC B 2 7 ? 9.160 17.460 37.550 1.00 0.00 ? ? ? ? ? ? 7 DC C OP2 2
ATOM 1523 O "O5'" . DC B 2 7 ? 11.200 16.200 38.190 1.00 0.00 ? ? ? ? ? ? 7 DC C "O5'" 2
ATOM 1524 C "C5'" . DC B 2 7 ? 12.190 15.160 38.260 1.00 0.00 ? ? ? ? ? ? 7 DC C "C5'" 2
ATOM 1525 C "C4'" . DC B 2 7 ? 13.530 15.800 38.650 1.00 0.00 ? ? ? ? ? ? 7 DC C "C4'" 2
ATOM 1526 O "O4'" . DC B 2 7 ? 14.030 16.930 37.890 1.00 0.00 ? ? ? ? ? ? 7 DC C "O4'" 2
ATOM 1527 C "C3'" . DC B 2 7 ? 13.490 16.250 40.080 1.00 0.00 ? ? ? ? ? ? 7 DC C "C3'" 2
ATOM 1528 O "O3'" . DC B 2 7 ? 14.470 15.440 40.750 1.00 0.00 ? ? ? ? ? ? 7 DC C "O3'" 2
ATOM 1529 C "C2'" . DC B 2 7 ? 13.730 17.750 40.060 1.00 0.00 ? ? ? ? ? ? 7 DC C "C2'" 2
ATOM 1530 C "C1'" . DC B 2 7 ? 14.630 17.850 38.850 1.00 0.00 ? ? ? ? ? ? 7 DC C "C1'" 2
ATOM 1531 N N1 . DC B 2 7 ? 14.790 19.210 38.280 1.00 0.00 ? ? ? ? ? ? 7 DC C N1 2
ATOM 1532 C C2 . DC B 2 7 ? 16.080 19.660 37.950 1.00 0.00 ? ? ? ? ? ? 7 DC C C2 2
ATOM 1533 O O2 . DC B 2 7 ? 17.070 19.030 38.300 1.00 0.00 ? ? ? ? ? ? 7 DC C O2 2
ATOM 1534 N N3 . DC B 2 7 ? 16.250 20.780 37.200 1.00 0.00 ? ? ? ? ? ? 7 DC C N3 2
ATOM 1535 C C4 . DC B 2 7 ? 15.190 21.500 36.780 1.00 0.00 ? ? ? ? ? ? 7 DC C C4 2
ATOM 1536 N N4 . DC B 2 7 ? 15.430 22.550 36.010 1.00 0.00 ? ? ? ? ? ? 7 DC C N4 2
ATOM 1537 C C5 . DC B 2 7 ? 13.870 21.130 37.100 1.00 0.00 ? ? ? ? ? ? 7 DC C C5 2
ATOM 1538 C C6 . DC B 2 7 ? 13.680 19.970 37.870 1.00 0.00 ? ? ? ? ? ? 7 DC C C6 2
ATOM 1539 H H41 . DC B 2 7 ? 16.340 22.900 35.780 1.00 0.00 ? ? ? ? ? ? 7 DC C H41 2
ATOM 1540 H H42 . DC B 2 7 ? 14.630 23.080 35.670 1.00 0.00 ? ? ? ? ? ? 7 DC C H42 2
ATOM 1541 P P . DA B 2 8 ? 14.530 15.310 42.350 1.00 0.00 ? ? ? ? ? ? 8 DA C P 2
ATOM 1542 O OP1 . DA B 2 8 ? 15.100 13.980 42.700 1.00 0.00 ? ? ? ? ? ? 8 DA C OP1 2
ATOM 1543 O OP2 . DA B 2 8 ? 13.200 15.660 42.910 1.00 0.00 ? ? ? ? ? ? 8 DA C OP2 2
ATOM 1544 O "O5'" . DA B 2 8 ? 15.620 16.420 42.710 1.00 0.00 ? ? ? ? ? ? 8 DA C "O5'" 2
ATOM 1545 C "C5'" . DA B 2 8 ? 16.960 16.100 42.280 1.00 0.00 ? ? ? ? ? ? 8 DA C "C5'" 2
ATOM 1546 C "C4'" . DA B 2 8 ? 18.070 17.130 42.440 1.00 0.00 ? ? ? ? ? ? 8 DA C "C4'" 2
ATOM 1547 O "O4'" . DA B 2 8 ? 17.960 18.250 41.550 1.00 0.00 ? ? ? ? ? ? 8 DA C "O4'" 2
ATOM 1548 C "C3'" . DA B 2 8 ? 18.180 17.680 43.840 1.00 0.00 ? ? ? ? ? ? 8 DA C "C3'" 2
ATOM 1549 O "O3'" . DA B 2 8 ? 19.530 17.380 44.280 1.00 0.00 ? ? ? ? ? ? 8 DA C "O3'" 2
ATOM 1550 C "C2'" . DA B 2 8 ? 17.950 19.160 43.670 1.00 0.00 ? ? ? ? ? ? 8 DA C "C2'" 2
ATOM 1551 C "C1'" . DA B 2 8 ? 18.490 19.400 42.270 1.00 0.00 ? ? ? ? ? ? 8 DA C "C1'" 2
ATOM 1552 N N9 . DA B 2 8 ? 17.880 20.580 41.590 1.00 0.00 ? ? ? ? ? ? 8 DA C N9 2
ATOM 1553 C C8 . DA B 2 8 ? 16.560 20.710 41.530 1.00 0.00 ? ? ? ? ? ? 8 DA C C8 2
ATOM 1554 N N7 . DA B 2 8 ? 16.210 21.700 40.710 1.00 0.00 ? ? ? ? ? ? 8 DA C N7 2
ATOM 1555 C C5 . DA B 2 8 ? 17.340 22.210 40.250 1.00 0.00 ? ? ? ? ? ? 8 DA C C5 2
ATOM 1556 C C6 . DA B 2 8 ? 17.630 23.370 39.530 1.00 0.00 ? ? ? ? ? ? 8 DA C C6 2
ATOM 1557 N N6 . DA B 2 8 ? 16.630 24.080 39.070 1.00 0.00 ? ? ? ? ? ? 8 DA C N6 2
ATOM 1558 N N1 . DA B 2 8 ? 18.890 23.840 39.400 1.00 0.00 ? ? ? ? ? ? 8 DA C N1 2
ATOM 1559 C C2 . DA B 2 8 ? 19.900 23.190 39.990 1.00 0.00 ? ? ? ? ? ? 8 DA C C2 2
ATOM 1560 N N3 . DA B 2 8 ? 19.670 22.060 40.680 1.00 0.00 ? ? ? ? ? ? 8 DA C N3 2
ATOM 1561 C C4 . DA B 2 8 ? 18.420 21.540 40.830 1.00 0.00 ? ? ? ? ? ? 8 DA C C4 2
ATOM 1562 H H61 . DA B 2 8 ? 16.760 24.970 38.610 1.00 0.00 ? ? ? ? ? ? 8 DA C H61 2
ATOM 1563 H H62 . DA B 2 8 ? 15.700 23.730 39.150 1.00 0.00 ? ? ? ? ? ? 8 DA C H62 2
ATOM 1564 P P . DA B 2 9 ? 20.060 17.430 45.800 1.00 0.00 ? ? ? ? ? ? 9 DA C P 2
ATOM 1565 O OP1 . DA B 2 9 ? 20.990 16.280 45.900 1.00 0.00 ? ? ? ? ? ? 9 DA C OP1 2
ATOM 1566 O OP2 . DA B 2 9 ? 18.920 17.430 46.730 1.00 0.00 ? ? ? ? ? ? 9 DA C OP2 2
ATOM 1567 O "O5'" . DA B 2 9 ? 20.840 18.830 45.970 1.00 0.00 ? ? ? ? ? ? 9 DA C "O5'" 2
ATOM 1568 C "C5'" . DA B 2 9 ? 22.080 19.110 45.300 1.00 0.00 ? ? ? ? ? ? 9 DA C "C5'" 2
ATOM 1569 C "C4'" . DA B 2 9 ? 22.540 20.570 45.260 1.00 0.00 ? ? ? ? ? ? 9 DA C "C4'" 2
ATOM 1570 O "O4'" . DA B 2 9 ? 21.590 21.340 44.490 1.00 0.00 ? ? ? ? ? ? 9 DA C "O4'" 2
ATOM 1571 C "C3'" . DA B 2 9 ? 22.680 21.250 46.620 1.00 0.00 ? ? ? ? ? ? 9 DA C "C3'" 2
ATOM 1572 O "O3'" . DA B 2 9 ? 24.020 21.810 46.760 1.00 0.00 ? ? ? ? ? ? 9 DA C "O3'" 2
ATOM 1573 C "C2'" . DA B 2 9 ? 21.470 22.140 46.660 1.00 0.00 ? ? ? ? ? ? 9 DA C "C2'" 2
ATOM 1574 C "C1'" . DA B 2 9 ? 21.360 22.570 45.190 1.00 0.00 ? ? ? ? ? ? 9 DA C "C1'" 2
ATOM 1575 N N9 . DA B 2 9 ? 20.000 23.020 44.810 1.00 0.00 ? ? ? ? ? ? 9 DA C N9 2
ATOM 1576 C C8 . DA B 2 9 ? 18.900 22.330 45.060 1.00 0.00 ? ? ? ? ? ? 9 DA C C8 2
ATOM 1577 N N7 . DA B 2 9 ? 17.840 22.900 44.470 1.00 0.00 ? ? ? ? ? ? 9 DA C N7 2
ATOM 1578 C C5 . DA B 2 9 ? 18.300 23.970 43.840 1.00 0.00 ? ? ? ? ? ? 9 DA C C5 2
ATOM 1579 C C6 . DA B 2 9 ? 17.750 24.930 42.980 1.00 0.00 ? ? ? ? ? ? 9 DA C C6 2
ATOM 1580 N N6 . DA B 2 9 ? 16.510 24.780 42.580 1.00 0.00 ? ? ? ? ? ? 9 DA C N6 2
ATOM 1581 N N1 . DA B 2 9 ? 18.500 25.860 42.350 1.00 0.00 ? ? ? ? ? ? 9 DA C N1 2
ATOM 1582 C C2 . DA B 2 9 ? 19.820 25.870 42.530 1.00 0.00 ? ? ? ? ? ? 9 DA C C2 2
ATOM 1583 N N3 . DA B 2 9 ? 20.400 24.990 43.360 1.00 0.00 ? ? ? ? ? ? 9 DA C N3 2
ATOM 1584 C C4 . DA B 2 9 ? 19.680 24.040 44.020 1.00 0.00 ? ? ? ? ? ? 9 DA C C4 2
ATOM 1585 H H61 . DA B 2 9 ? 16.130 25.440 41.930 1.00 0.00 ? ? ? ? ? ? 9 DA C H61 2
ATOM 1586 H H62 . DA B 2 9 ? 16.030 23.950 42.850 1.00 0.00 ? ? ? ? ? ? 9 DA C H62 2
ATOM 1587 P P . DT B 2 10 ? 24.700 22.330 48.140 1.00 0.00 ? ? ? ? ? ? 10 DT C P 2
ATOM 1588 O OP1 . DT B 2 10 ? 26.170 22.130 48.190 1.00 0.00 ? ? ? ? ? ? 10 DT C OP1 2
ATOM 1589 O OP2 . DT B 2 10 ? 23.930 21.860 49.310 1.00 0.00 ? ? ? ? ? ? 10 DT C OP2 2
ATOM 1590 O "O5'" . DT B 2 10 ? 24.490 23.900 47.970 1.00 0.00 ? ? ? ? ? ? 10 DT C "O5'" 2
ATOM 1591 C "C5'" . DT B 2 10 ? 25.050 24.590 46.850 1.00 0.00 ? ? ? ? ? ? 10 DT C "C5'" 2
ATOM 1592 C "C4'" . DT B 2 10 ? 24.180 25.810 46.560 1.00 0.00 ? ? ? ? ? ? 10 DT C "C4'" 2
ATOM 1593 O "O4'" . DT B 2 10 ? 22.790 25.540 46.310 1.00 0.00 ? ? ? ? ? ? 10 DT C "O4'" 2
ATOM 1594 C "C3'" . DT B 2 10 ? 24.220 26.890 47.630 1.00 0.00 ? ? ? ? ? ? 10 DT C "C3'" 2
ATOM 1595 O "O3'" . DT B 2 10 ? 25.030 27.970 47.110 1.00 0.00 ? ? ? ? ? ? 10 DT C "O3'" 2
ATOM 1596 C "C2'" . DT B 2 10 ? 22.790 27.360 47.730 1.00 0.00 ? ? ? ? ? ? 10 DT C "C2'" 2
ATOM 1597 C "C1'" . DT B 2 10 ? 22.240 26.870 46.430 1.00 0.00 ? ? ? ? ? ? 10 DT C "C1'" 2
ATOM 1598 N N1 . DT B 2 10 ? 20.750 26.810 46.490 1.00 0.00 ? ? ? ? ? ? 10 DT C N1 2
ATOM 1599 C C2 . DT B 2 10 ? 19.920 27.750 45.860 1.00 0.00 ? ? ? ? ? ? 10 DT C C2 2
ATOM 1600 O O2 . DT B 2 10 ? 20.360 28.690 45.200 1.00 0.00 ? ? ? ? ? ? 10 DT C O2 2
ATOM 1601 N N3 . DT B 2 10 ? 18.530 27.580 45.900 1.00 0.00 ? ? ? ? ? ? 10 DT C N3 2
ATOM 1602 C C4 . DT B 2 10 ? 17.980 26.480 46.580 1.00 0.00 ? ? ? ? ? ? 10 DT C C4 2
ATOM 1603 O O4 . DT B 2 10 ? 16.810 26.210 46.330 1.00 0.00 ? ? ? ? ? ? 10 DT C O4 2
ATOM 1604 C C5 . DT B 2 10 ? 18.800 25.570 47.260 1.00 0.00 ? ? ? ? ? ? 10 DT C C5 2
ATOM 1605 C C7 . DT B 2 10 ? 18.260 24.440 48.130 1.00 0.00 ? ? ? ? ? ? 10 DT C C7 2
ATOM 1606 C C6 . DT B 2 10 ? 20.180 25.750 47.190 1.00 0.00 ? ? ? ? ? ? 10 DT C C6 2
ATOM 1607 H H3 . DT B 2 10 ? 17.940 28.160 45.340 1.00 0.00 ? ? ? ? ? ? 10 DT C H3 2
ATOM 1608 P P . DT B 2 11 ? 25.820 29.030 48.030 1.00 0.00 ? ? ? ? ? ? 11 DT C P 2
ATOM 1609 O OP1 . DT B 2 11 ? 26.890 29.650 47.210 1.00 0.00 ? ? ? ? ? ? 11 DT C OP1 2
ATOM 1610 O OP2 . DT B 2 11 ? 26.200 28.380 49.300 1.00 0.00 ? ? ? ? ? ? 11 DT C OP2 2
ATOM 1611 O "O5'" . DT B 2 11 ? 24.720 30.140 48.340 1.00 0.00 ? ? ? ? ? ? 11 DT C "O5'" 2
ATOM 1612 C "C5'" . DT B 2 11 ? 24.140 30.860 47.240 1.00 0.00 ? ? ? ? ? ? 11 DT C "C5'" 2
ATOM 1613 C "C4'" . DT B 2 11 ? 22.750 31.380 47.550 1.00 0.00 ? ? ? ? ? ? 11 DT C "C4'" 2
ATOM 1614 O "O4'" . DT B 2 11 ? 21.760 30.360 47.680 1.00 0.00 ? ? ? ? ? ? 11 DT C "O4'" 2
ATOM 1615 C "C3'" . DT B 2 11 ? 22.740 32.100 48.870 1.00 0.00 ? ? ? ? ? ? 11 DT C "C3'" 2
ATOM 1616 O "O3'" . DT B 2 11 ? 22.750 33.520 48.640 1.00 0.00 ? ? ? ? ? ? 11 DT C "O3'" 2
ATOM 1617 C "C2'" . DT B 2 11 ? 21.450 31.730 49.550 1.00 0.00 ? ? ? ? ? ? 11 DT C "C2'" 2
ATOM 1618 C "C1'" . DT B 2 11 ? 20.740 31.060 48.390 1.00 0.00 ? ? ? ? ? ? 11 DT C "C1'" 2
ATOM 1619 N N1 . DT B 2 11 ? 19.750 30.060 48.830 1.00 0.00 ? ? ? ? ? ? 11 DT C N1 2
ATOM 1620 C C2 . DT B 2 11 ? 18.380 30.370 48.750 1.00 0.00 ? ? ? ? ? ? 11 DT C C2 2
ATOM 1621 O O2 . DT B 2 11 ? 17.980 31.340 48.110 1.00 0.00 ? ? ? ? ? ? 11 DT C O2 2
ATOM 1622 N N3 . DT B 2 11 ? 17.470 29.460 49.270 1.00 0.00 ? ? ? ? ? ? 11 DT C N3 2
ATOM 1623 C C4 . DT B 2 11 ? 17.890 28.240 49.790 1.00 0.00 ? ? ? ? ? ? 11 DT C C4 2
ATOM 1624 O O4 . DT B 2 11 ? 17.040 27.350 49.810 1.00 0.00 ? ? ? ? ? ? 11 DT C O4 2
ATOM 1625 C C5 . DT B 2 11 ? 19.250 27.940 49.910 1.00 0.00 ? ? ? ? ? ? 11 DT C C5 2
ATOM 1626 C C7 . DT B 2 11 ? 19.740 26.800 50.820 1.00 0.00 ? ? ? ? ? ? 11 DT C C7 2
ATOM 1627 C C6 . DT B 2 11 ? 20.170 28.870 49.430 1.00 0.00 ? ? ? ? ? ? 11 DT C C6 2
ATOM 1628 H "HO3'" . DT B 2 11 ? 22.760 33.950 49.590 1.00 0.00 ? ? ? ? ? ? 11 DT C "HO3'" 2
ATOM 1629 H H3 . DT B 2 11 ? 16.540 29.780 49.510 1.00 0.00 ? ? ? ? ? ? 11 DT C H3 2
ATOM 1630 N N . MET C 3 1 ? 32.840 26.300 6.980 1.00 0.00 ? ? ? ? ? ? 1 MET A N 2
ATOM 1631 C CA . MET C 3 1 ? 32.290 27.380 7.830 1.00 0.00 ? ? ? ? ? ? 1 MET A CA 2
ATOM 1632 C C . MET C 3 1 ? 32.050 26.990 9.300 1.00 0.00 ? ? ? ? ? ? 1 MET A C 2
ATOM 1633 O O . MET C 3 1 ? 31.550 25.910 9.630 1.00 0.00 ? ? ? ? ? ? 1 MET A O 2
ATOM 1634 C CB . MET C 3 1 ? 30.980 27.820 7.190 1.00 0.00 ? ? ? ? ? ? 1 MET A CB 2
ATOM 1635 C CG . MET C 3 1 ? 31.140 28.320 5.740 1.00 0.00 ? ? ? ? ? ? 1 MET A CG 2
ATOM 1636 S SD . MET C 3 1 ? 32.060 29.890 5.590 1.00 0.00 ? ? ? ? ? ? 1 MET A SD 2
ATOM 1637 C CE . MET C 3 1 ? 31.010 30.940 6.560 1.00 0.00 ? ? ? ? ? ? 1 MET A CE 2
ATOM 1638 H H1 . MET C 3 1 ? 33.660 25.890 7.390 1.00 0.00 ? ? ? ? ? ? 1 MET A H1 2
ATOM 1639 H H2 . MET C 3 1 ? 32.130 25.600 6.880 1.00 0.00 ? ? ? ? ? ? 1 MET A H2 2
ATOM 1640 H H3 . MET C 3 1 ? 33.070 26.700 6.090 1.00 0.00 ? ? ? ? ? ? 1 MET A H3 2
ATOM 1641 N N . LYS C 3 2 ? 32.520 27.880 10.170 1.00 0.00 ? ? ? ? ? ? 2 LYS A N 2
ATOM 1642 C CA . LYS C 3 2 ? 32.550 27.760 11.640 1.00 0.00 ? ? ? ? ? ? 2 LYS A CA 2
ATOM 1643 C C . LYS C 3 2 ? 31.120 27.820 12.230 1.00 0.00 ? ? ? ? ? ? 2 LYS A C 2
ATOM 1644 O O . LYS C 3 2 ? 30.510 28.900 12.200 1.00 0.00 ? ? ? ? ? ? 2 LYS A O 2
ATOM 1645 C CB . LYS C 3 2 ? 33.400 28.950 12.100 1.00 0.00 ? ? ? ? ? ? 2 LYS A CB 2
ATOM 1646 C CG . LYS C 3 2 ? 34.030 28.730 13.460 1.00 0.00 ? ? ? ? ? ? 2 LYS A CG 2
ATOM 1647 C CD . LYS C 3 2 ? 33.750 29.870 14.440 1.00 0.00 ? ? ? ? ? ? 2 LYS A CD 2
ATOM 1648 C CE . LYS C 3 2 ? 34.470 29.480 15.720 1.00 0.00 ? ? ? ? ? ? 2 LYS A CE 2
ATOM 1649 N NZ . LYS C 3 2 ? 33.960 30.250 16.850 1.00 0.00 ? ? ? ? ? ? 2 LYS A NZ 2
ATOM 1650 H H . LYS C 3 2 ? 32.940 28.740 9.830 1.00 0.00 ? ? ? ? ? ? 2 LYS A H 2
ATOM 1651 H HZ1 . LYS C 3 2 ? 32.960 30.190 16.880 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ1 2
ATOM 1652 H HZ2 . LYS C 3 2 ? 34.320 29.900 17.710 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ2 2
ATOM 1653 H HZ3 . LYS C 3 2 ? 34.220 31.230 16.770 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ3 2
ATOM 1654 N N . PRO C 3 3 ? 30.580 26.720 12.790 1.00 0.00 ? ? ? ? ? ? 3 PRO A N 2
ATOM 1655 C CA . PRO C 3 3 ? 29.180 26.690 13.240 1.00 0.00 ? ? ? ? ? ? 3 PRO A CA 2
ATOM 1656 C C . PRO C 3 3 ? 28.980 27.400 14.580 1.00 0.00 ? ? ? ? ? ? 3 PRO A C 2
ATOM 1657 O O . PRO C 3 3 ? 29.920 27.540 15.370 1.00 0.00 ? ? ? ? ? ? 3 PRO A O 2
ATOM 1658 C CB . PRO C 3 3 ? 28.830 25.210 13.360 1.00 0.00 ? ? ? ? ? ? 3 PRO A CB 2
ATOM 1659 C CG . PRO C 3 3 ? 30.170 24.570 13.740 1.00 0.00 ? ? ? ? ? ? 3 PRO A CG 2
ATOM 1660 C CD . PRO C 3 3 ? 31.220 25.390 12.980 1.00 0.00 ? ? ? ? ? ? 3 PRO A CD 2
ATOM 1661 N N . VAL C 3 4 ? 27.750 27.800 14.830 1.00 0.00 ? ? ? ? ? ? 4 VAL A N 2
ATOM 1662 C CA . VAL C 3 4 ? 27.430 28.430 16.110 1.00 0.00 ? ? ? ? ? ? 4 VAL A CA 2
ATOM 1663 C C . VAL C 3 4 ? 26.360 27.620 16.860 1.00 0.00 ? ? ? ? ? ? 4 VAL A C 2
ATOM 1664 O O . VAL C 3 4 ? 25.190 27.640 16.500 1.00 0.00 ? ? ? ? ? ? 4 VAL A O 2
ATOM 1665 C CB . VAL C 3 4 ? 27.060 29.900 15.840 1.00 0.00 ? ? ? ? ? ? 4 VAL A CB 2
ATOM 1666 C CG1 . VAL C 3 4 ? 26.430 30.610 17.050 1.00 0.00 ? ? ? ? ? ? 4 VAL A CG1 2
ATOM 1667 C CG2 . VAL C 3 4 ? 28.280 30.690 15.360 1.00 0.00 ? ? ? ? ? ? 4 VAL A CG2 2
ATOM 1668 H H . VAL C 3 4 ? 27.040 27.890 14.130 1.00 0.00 ? ? ? ? ? ? 4 VAL A H 2
ATOM 1669 N N . THR C 3 5 ? 26.890 27.040 17.940 1.00 0.00 ? ? ? ? ? ? 5 THR A N 2
ATOM 1670 C CA . THR C 3 5 ? 26.190 26.210 18.950 1.00 0.00 ? ? ? ? ? ? 5 THR A CA 2
ATOM 1671 C C . THR C 3 5 ? 25.400 27.100 19.920 1.00 0.00 ? ? ? ? ? ? 5 THR A C 2
ATOM 1672 O O . THR C 3 5 ? 25.630 28.310 19.970 1.00 0.00 ? ? ? ? ? ? 5 THR A O 2
ATOM 1673 C CB . THR C 3 5 ? 27.220 25.450 19.820 1.00 0.00 ? ? ? ? ? ? 5 THR A CB 2
ATOM 1674 O OG1 . THR C 3 5 ? 28.110 26.350 20.480 1.00 0.00 ? ? ? ? ? ? 5 THR A OG1 2
ATOM 1675 C CG2 . THR C 3 5 ? 27.990 24.370 19.050 1.00 0.00 ? ? ? ? ? ? 5 THR A CG2 2
ATOM 1676 H H . THR C 3 5 ? 27.850 27.230 18.150 1.00 0.00 ? ? ? ? ? ? 5 THR A H 2
ATOM 1677 H HG1 . THR C 3 5 ? 28.900 26.570 19.860 1.00 0.00 ? ? ? ? ? ? 5 THR A HG1 2
ATOM 1678 N N . LEU C 3 6 ? 24.590 26.490 20.780 1.00 0.00 ? ? ? ? ? ? 6 LEU A N 2
ATOM 1679 C CA . LEU C 3 6 ? 24.010 27.210 21.940 1.00 0.00 ? ? ? ? ? ? 6 LEU A CA 2
ATOM 1680 C C . LEU C 3 6 ? 25.100 27.830 22.840 1.00 0.00 ? ? ? ? ? ? 6 LEU A C 2
ATOM 1681 O O . LEU C 3 6 ? 25.030 29.020 23.120 1.00 0.00 ? ? ? ? ? ? 6 LEU A O 2
ATOM 1682 C CB . LEU C 3 6 ? 23.150 26.370 22.880 1.00 0.00 ? ? ? ? ? ? 6 LEU A CB 2
ATOM 1683 C CG . LEU C 3 6 ? 21.800 25.900 22.330 1.00 0.00 ? ? ? ? ? ? 6 LEU A CG 2
ATOM 1684 C CD1 . LEU C 3 6 ? 21.280 24.920 23.370 1.00 0.00 ? ? ? ? ? ? 6 LEU A CD1 2
ATOM 1685 C CD2 . LEU C 3 6 ? 20.780 27.020 22.090 1.00 0.00 ? ? ? ? ? ? 6 LEU A CD2 2
ATOM 1686 H H . LEU C 3 6 ? 24.320 25.520 20.670 1.00 0.00 ? ? ? ? ? ? 6 LEU A H 2
ATOM 1687 N N . TYR C 3 7 ? 26.180 27.080 23.090 1.00 0.00 ? ? ? ? ? ? 7 TYR A N 2
ATOM 1688 C CA . TYR C 3 7 ? 27.320 27.520 23.910 1.00 0.00 ? ? ? ? ? ? 7 TYR A CA 2
ATOM 1689 C C . TYR C 3 7 ? 27.890 28.830 23.370 1.00 0.00 ? ? ? ? ? ? 7 TYR A C 2
ATOM 1690 O O . TYR C 3 7 ? 27.820 29.850 24.050 1.00 0.00 ? ? ? ? ? ? 7 TYR A O 2
ATOM 1691 C CB . TYR C 3 7 ? 28.420 26.460 23.950 1.00 0.00 ? ? ? ? ? ? 7 TYR A CB 2
ATOM 1692 C CG . TYR C 3 7 ? 27.930 25.140 24.560 1.00 0.00 ? ? ? ? ? ? 7 TYR A CG 2
ATOM 1693 C CD1 . TYR C 3 7 ? 27.170 24.280 23.740 1.00 0.00 ? ? ? ? ? ? 7 TYR A CD1 2
ATOM 1694 C CD2 . TYR C 3 7 ? 28.070 24.930 25.940 1.00 0.00 ? ? ? ? ? ? 7 TYR A CD2 2
ATOM 1695 C CE1 . TYR C 3 7 ? 26.510 23.200 24.330 1.00 0.00 ? ? ? ? ? ? 7 TYR A CE1 2
ATOM 1696 C CE2 . TYR C 3 7 ? 27.410 23.830 26.530 1.00 0.00 ? ? ? ? ? ? 7 TYR A CE2 2
ATOM 1697 C CZ . TYR C 3 7 ? 26.650 22.960 25.710 1.00 0.00 ? ? ? ? ? ? 7 TYR A CZ 2
ATOM 1698 O OH . TYR C 3 7 ? 26.370 21.720 26.200 1.00 0.00 ? ? ? ? ? ? 7 TYR A OH 2
ATOM 1699 H H . TYR C 3 7 ? 26.350 26.230 22.580 1.00 0.00 ? ? ? ? ? ? 7 TYR A H 2
ATOM 1700 H HH . TYR C 3 7 ? 26.040 21.150 25.390 1.00 0.00 ? ? ? ? ? ? 7 TYR A HH 2
ATOM 1701 N N . ASP C 3 8 ? 28.140 28.840 22.060 1.00 0.00 ? ? ? ? ? ? 8 ASP A N 2
ATOM 1702 C CA . ASP C 3 8 ? 28.650 30.020 21.340 1.00 0.00 ? ? ? ? ? ? 8 ASP A CA 2
ATOM 1703 C C . ASP C 3 8 ? 27.800 31.280 21.570 1.00 0.00 ? ? ? ? ? ? 8 ASP A C 2
ATOM 1704 O O . ASP C 3 8 ? 28.260 32.210 22.230 1.00 0.00 ? ? ? ? ? ? 8 ASP A O 2
ATOM 1705 C CB . ASP C 3 8 ? 28.730 29.720 19.840 1.00 0.00 ? ? ? ? ? ? 8 ASP A CB 2
ATOM 1706 C CG . ASP C 3 8 ? 29.900 28.830 19.410 1.00 0.00 ? ? ? ? ? ? 8 ASP A CG 2
ATOM 1707 O OD1 . ASP C 3 8 ? 31.060 29.240 19.590 1.00 0.00 ? ? ? ? ? ? 8 ASP A OD1 2
ATOM 1708 O OD2 . ASP C 3 8 ? 29.640 27.820 18.730 1.00 0.00 ? ? ? ? ? ? 8 ASP A OD2 2
ATOM 1709 H H . ASP C 3 8 ? 28.000 28.020 21.480 1.00 0.00 ? ? ? ? ? ? 8 ASP A H 2
ATOM 1710 N N . VAL C 3 9 ? 26.520 31.220 21.210 1.00 0.00 ? ? ? ? ? ? 9 VAL A N 2
ATOM 1711 C CA . VAL C 3 9 ? 25.620 32.410 21.350 1.00 0.00 ? ? ? ? ? ? 9 VAL A CA 2
ATOM 1712 C C . VAL C 3 9 ? 25.410 32.860 22.800 1.00 0.00 ? ? ? ? ? ? 9 VAL A C 2
ATOM 1713 O O . VAL C 3 9 ? 25.400 34.050 23.120 1.00 0.00 ? ? ? ? ? ? 9 VAL A O 2
ATOM 1714 C CB . VAL C 3 9 ? 24.250 32.260 20.670 1.00 0.00 ? ? ? ? ? ? 9 VAL A CB 2
ATOM 1715 C CG1 . VAL C 3 9 ? 24.370 32.660 19.200 1.00 0.00 ? ? ? ? ? ? 9 VAL A CG1 2
ATOM 1716 C CG2 . VAL C 3 9 ? 23.580 30.890 20.860 1.00 0.00 ? ? ? ? ? ? 9 VAL A CG2 2
ATOM 1717 H H . VAL C 3 9 ? 26.080 30.350 20.970 1.00 0.00 ? ? ? ? ? ? 9 VAL A H 2
ATOM 1718 N N . ALA C 3 10 ? 25.370 31.840 23.650 1.00 0.00 ? ? ? ? ? ? 10 ALA A N 2
ATOM 1719 C CA . ALA C 3 10 ? 25.290 31.940 25.120 1.00 0.00 ? ? ? ? ? ? 10 ALA A CA 2
ATOM 1720 C C . ALA C 3 10 ? 26.490 32.680 25.750 1.00 0.00 ? ? ? ? ? ? 10 ALA A C 2
ATOM 1721 O O . ALA C 3 10 ? 26.320 33.600 26.540 1.00 0.00 ? ? ? ? ? ? 10 ALA A O 2
ATOM 1722 C CB . ALA C 3 10 ? 25.170 30.570 25.790 1.00 0.00 ? ? ? ? ? ? 10 ALA A CB 2
ATOM 1723 H H . ALA C 3 10 ? 25.310 30.910 23.280 1.00 0.00 ? ? ? ? ? ? 10 ALA A H 2
ATOM 1724 N N . GLU C 3 11 ? 27.690 32.310 25.310 1.00 0.00 ? ? ? ? ? ? 11 GLU A N 2
ATOM 1725 C CA . GLU C 3 11 ? 28.940 33.020 25.670 1.00 0.00 ? ? ? ? ? ? 11 GLU A CA 2
ATOM 1726 C C . GLU C 3 11 ? 28.910 34.480 25.200 1.00 0.00 ? ? ? ? ? ? 11 GLU A C 2
ATOM 1727 O O . GLU C 3 11 ? 28.840 35.370 26.050 1.00 0.00 ? ? ? ? ? ? 11 GLU A O 2
ATOM 1728 C CB . GLU C 3 11 ? 30.190 32.330 25.130 1.00 0.00 ? ? ? ? ? ? 11 GLU A CB 2
ATOM 1729 C CG . GLU C 3 11 ? 30.450 30.980 25.810 1.00 0.00 ? ? ? ? ? ? 11 GLU A CG 2
ATOM 1730 C CD . GLU C 3 11 ? 31.550 30.180 25.090 1.00 0.00 ? ? ? ? ? ? 11 GLU A CD 2
ATOM 1731 O OE1 . GLU C 3 11 ? 32.740 30.480 25.290 1.00 0.00 ? ? ? ? ? ? 11 GLU A OE1 2
ATOM 1732 O OE2 . GLU C 3 11 ? 31.200 29.230 24.360 1.00 0.00 ? ? ? ? ? ? 11 GLU A OE2 2
ATOM 1733 H H . GLU C 3 11 ? 27.800 31.450 24.800 1.00 0.00 ? ? ? ? ? ? 11 GLU A H 2
ATOM 1734 N N . TYR C 3 12 ? 28.570 34.680 23.920 1.00 0.00 ? ? ? ? ? ? 12 TYR A N 2
ATOM 1735 C CA . TYR C 3 12 ? 28.560 36.020 23.290 1.00 0.00 ? ? ? ? ? ? 12 TYR A CA 2
ATOM 1736 C C . TYR C 3 12 ? 27.530 36.980 23.920 1.00 0.00 ? ? ? ? ? ? 12 TYR A C 2
ATOM 1737 O O . TYR C 3 12 ? 27.690 38.200 23.860 1.00 0.00 ? ? ? ? ? ? 12 TYR A O 2
ATOM 1738 C CB . TYR C 3 12 ? 28.340 35.890 21.770 1.00 0.00 ? ? ? ? ? ? 12 TYR A CB 2
ATOM 1739 C CG . TYR C 3 12 ? 28.800 37.120 20.950 1.00 0.00 ? ? ? ? ? ? 12 TYR A CG 2
ATOM 1740 C CD1 . TYR C 3 12 ? 28.010 38.290 20.930 1.00 0.00 ? ? ? ? ? ? 12 TYR A CD1 2
ATOM 1741 C CD2 . TYR C 3 12 ? 29.930 37.000 20.120 1.00 0.00 ? ? ? ? ? ? 12 TYR A CD2 2
ATOM 1742 C CE1 . TYR C 3 12 ? 28.340 39.350 20.070 1.00 0.00 ? ? ? ? ? ? 12 TYR A CE1 2
ATOM 1743 C CE2 . TYR C 3 12 ? 30.270 38.050 19.240 1.00 0.00 ? ? ? ? ? ? 12 TYR A CE2 2
ATOM 1744 C CZ . TYR C 3 12 ? 29.450 39.200 19.220 1.00 0.00 ? ? ? ? ? ? 12 TYR A CZ 2
ATOM 1745 O OH . TYR C 3 12 ? 29.580 40.070 18.190 1.00 0.00 ? ? ? ? ? ? 12 TYR A OH 2
ATOM 1746 H H . TYR C 3 12 ? 28.260 33.910 23.350 1.00 0.00 ? ? ? ? ? ? 12 TYR A H 2
ATOM 1747 H HH . TYR C 3 12 ? 30.200 39.590 17.490 1.00 0.00 ? ? ? ? ? ? 12 TYR A HH 2
ATOM 1748 N N . ALA C 3 13 ? 26.400 36.450 24.370 1.00 0.00 ? ? ? ? ? ? 13 ALA A N 2
ATOM 1749 C CA . ALA C 3 13 ? 25.420 37.240 25.150 1.00 0.00 ? ? ? ? ? ? 13 ALA A CA 2
ATOM 1750 C C . ALA C 3 13 ? 25.800 37.490 26.620 1.00 0.00 ? ? ? ? ? ? 13 ALA A C 2
ATOM 1751 O O . ALA C 3 13 ? 25.430 38.520 27.200 1.00 0.00 ? ? ? ? ? ? 13 ALA A O 2
ATOM 1752 C CB . ALA C 3 13 ? 24.060 36.560 25.090 1.00 0.00 ? ? ? ? ? ? 13 ALA A CB 2
ATOM 1753 H H . ALA C 3 13 ? 26.050 35.580 24.000 1.00 0.00 ? ? ? ? ? ? 13 ALA A H 2
ATOM 1754 N N . GLY C 3 14 ? 26.590 36.590 27.200 1.00 0.00 ? ? ? ? ? ? 14 GLY A N 2
ATOM 1755 C CA . GLY C 3 14 ? 26.840 36.560 28.660 1.00 0.00 ? ? ? ? ? ? 14 GLY A CA 2
ATOM 1756 C C . GLY C 3 14 ? 25.650 35.910 29.360 1.00 0.00 ? ? ? ? ? ? 14 GLY A C 2
ATOM 1757 O O . GLY C 3 14 ? 24.830 36.590 29.970 1.00 0.00 ? ? ? ? ? ? 14 GLY A O 2
ATOM 1758 H H . GLY C 3 14 ? 27.200 35.990 26.660 1.00 0.00 ? ? ? ? ? ? 14 GLY A H 2
ATOM 1759 N N . VAL C 3 15 ? 25.570 34.610 29.090 1.00 0.00 ? ? ? ? ? ? 15 VAL A N 2
ATOM 1760 C CA . VAL C 3 15 ? 24.550 33.650 29.560 1.00 0.00 ? ? ? ? ? ? 15 VAL A CA 2
ATOM 1761 C C . VAL C 3 15 ? 25.070 32.200 29.510 1.00 0.00 ? ? ? ? ? ? 15 VAL A C 2
ATOM 1762 O O . VAL C 3 15 ? 26.070 31.880 28.880 1.00 0.00 ? ? ? ? ? ? 15 VAL A O 2
ATOM 1763 C CB . VAL C 3 15 ? 23.210 33.730 28.790 1.00 0.00 ? ? ? ? ? ? 15 VAL A CB 2
ATOM 1764 C CG1 . VAL C 3 15 ? 22.240 34.640 29.540 1.00 0.00 ? ? ? ? ? ? 15 VAL A CG1 2
ATOM 1765 C CG2 . VAL C 3 15 ? 23.270 34.170 27.330 1.00 0.00 ? ? ? ? ? ? 15 VAL A CG2 2
ATOM 1766 H H . VAL C 3 15 ? 26.210 34.210 28.430 1.00 0.00 ? ? ? ? ? ? 15 VAL A H 2
ATOM 1767 N N . SER C 3 16 ? 24.320 31.340 30.180 1.00 0.00 ? ? ? ? ? ? 16 SER A N 2
ATOM 1768 C CA . SER C 3 16 ? 24.430 29.880 30.100 1.00 0.00 ? ? ? ? ? ? 16 SER A CA 2
ATOM 1769 C C . SER C 3 16 ? 23.660 29.380 28.870 1.00 0.00 ? ? ? ? ? ? 16 SER A C 2
ATOM 1770 O O . SER C 3 16 ? 22.730 30.010 28.370 1.00 0.00 ? ? ? ? ? ? 16 SER A O 2
ATOM 1771 C CB . SER C 3 16 ? 23.870 29.220 31.360 1.00 0.00 ? ? ? ? ? ? 16 SER A CB 2
ATOM 1772 O OG . SER C 3 16 ? 23.780 27.810 31.130 1.00 0.00 ? ? ? ? ? ? 16 SER A OG 2
ATOM 1773 H H . SER C 3 16 ? 23.570 31.680 30.780 1.00 0.00 ? ? ? ? ? ? 16 SER A H 2
ATOM 1774 H HG . SER C 3 16 ? 23.790 27.330 32.060 1.00 0.00 ? ? ? ? ? ? 16 SER A HG 2
ATOM 1775 N N . TYR C 3 17 ? 24.070 28.200 28.420 1.00 0.00 ? ? ? ? ? ? 17 TYR A N 2
ATOM 1776 C CA . TYR C 3 17 ? 23.430 27.400 27.380 1.00 0.00 ? ? ? ? ? ? 17 TYR A CA 2
ATOM 1777 C C . TYR C 3 17 ? 22.050 26.900 27.830 1.00 0.00 ? ? ? ? ? ? 17 TYR A C 2
ATOM 1778 O O . TYR C 3 17 ? 21.180 26.690 26.980 1.00 0.00 ? ? ? ? ? ? 17 TYR A O 2
ATOM 1779 C CB . TYR C 3 17 ? 24.410 26.280 26.960 1.00 0.00 ? ? ? ? ? ? 17 TYR A CB 2
ATOM 1780 C CG . TYR C 3 17 ? 24.100 24.840 27.390 1.00 0.00 ? ? ? ? ? ? 17 TYR A CG 2
ATOM 1781 C CD1 . TYR C 3 17 ? 24.440 24.360 28.680 1.00 0.00 ? ? ? ? ? ? 17 TYR A CD1 2
ATOM 1782 C CD2 . TYR C 3 17 ? 23.350 24.050 26.490 1.00 0.00 ? ? ? ? ? ? 17 TYR A CD2 2
ATOM 1783 C CE1 . TYR C 3 17 ? 24.000 23.080 29.070 1.00 0.00 ? ? ? ? ? ? 17 TYR A CE1 2
ATOM 1784 C CE2 . TYR C 3 17 ? 22.900 22.780 26.880 1.00 0.00 ? ? ? ? ? ? 17 TYR A CE2 2
ATOM 1785 C CZ . TYR C 3 17 ? 23.220 22.310 28.170 1.00 0.00 ? ? ? ? ? ? 17 TYR A CZ 2
ATOM 1786 O OH . TYR C 3 17 ? 22.790 21.070 28.480 1.00 0.00 ? ? ? ? ? ? 17 TYR A OH 2
ATOM 1787 H H . TYR C 3 17 ? 24.850 27.740 28.900 1.00 0.00 ? ? ? ? ? ? 17 TYR A H 2
ATOM 1788 H HH . TYR C 3 17 ? 23.270 20.760 29.350 1.00 0.00 ? ? ? ? ? ? 17 TYR A HH 2
ATOM 1789 N N . GLN C 3 18 ? 21.830 26.780 29.140 1.00 0.00 ? ? ? ? ? ? 18 GLN A N 2
ATOM 1790 C CA . GLN C 3 18 ? 20.490 26.450 29.660 1.00 0.00 ? ? ? ? ? ? 18 GLN A CA 2
ATOM 1791 C C . GLN C 3 18 ? 19.540 27.630 29.420 1.00 0.00 ? ? ? ? ? ? 18 GLN A C 2
ATOM 1792 O O . GLN C 3 18 ? 18.470 27.460 28.830 1.00 0.00 ? ? ? ? ? ? 18 GLN A O 2
ATOM 1793 C CB . GLN C 3 18 ? 20.570 26.050 31.140 1.00 0.00 ? ? ? ? ? ? 18 GLN A CB 2
ATOM 1794 C CG . GLN C 3 18 ? 19.270 25.460 31.720 1.00 0.00 ? ? ? ? ? ? 18 GLN A CG 2
ATOM 1795 C CD . GLN C 3 18 ? 18.770 24.160 31.090 1.00 0.00 ? ? ? ? ? ? 18 GLN A CD 2
ATOM 1796 O OE1 . GLN C 3 18 ? 17.590 23.830 31.120 1.00 0.00 ? ? ? ? ? ? 18 GLN A OE1 2
ATOM 1797 N NE2 . GLN C 3 18 ? 19.690 23.320 30.650 1.00 0.00 ? ? ? ? ? ? 18 GLN A NE2 2
ATOM 1798 H H . GLN C 3 18 ? 22.490 27.100 29.820 1.00 0.00 ? ? ? ? ? ? 18 GLN A H 2
ATOM 1799 H HE21 . GLN C 3 18 ? 20.640 23.490 30.920 1.00 0.00 ? ? ? ? ? ? 18 GLN A HE21 2
ATOM 1800 H HE22 . GLN C 3 18 ? 19.470 22.460 30.210 1.00 0.00 ? ? ? ? ? ? 18 GLN A HE22 2
ATOM 1801 N N . THR C 3 19 ? 19.930 28.820 29.880 1.00 0.00 ? ? ? ? ? ? 19 THR A N 2
ATOM 1802 C CA . THR C 3 19 ? 19.270 30.110 29.590 1.00 0.00 ? ? ? ? ? ? 19 THR A CA 2
ATOM 1803 C C . THR C 3 19 ? 18.930 30.310 28.090 1.00 0.00 ? ? ? ? ? ? 19 THR A C 2
ATOM 1804 O O . THR C 3 19 ? 17.770 30.560 27.750 1.00 0.00 ? ? ? ? ? ? 19 THR A O 2
ATOM 1805 C CB . THR C 3 19 ? 20.210 31.200 30.110 1.00 0.00 ? ? ? ? ? ? 19 THR A CB 2
ATOM 1806 O OG1 . THR C 3 19 ? 20.740 30.790 31.380 1.00 0.00 ? ? ? ? ? ? 19 THR A OG1 2
ATOM 1807 C CG2 . THR C 3 19 ? 19.510 32.550 30.250 1.00 0.00 ? ? ? ? ? ? 19 THR A CG2 2
ATOM 1808 H H . THR C 3 19 ? 20.510 28.900 30.690 1.00 0.00 ? ? ? ? ? ? 19 THR A H 2
ATOM 1809 H HG1 . THR C 3 19 ? 20.030 30.960 32.100 1.00 0.00 ? ? ? ? ? ? 19 THR A HG1 2
ATOM 1810 N N . VAL C 3 20 ? 19.890 30.000 27.220 1.00 0.00 ? ? ? ? ? ? 20 VAL A N 2
ATOM 1811 C CA . VAL C 3 20 ? 19.740 30.060 25.750 1.00 0.00 ? ? ? ? ? ? 20 VAL A CA 2
ATOM 1812 C C . VAL C 3 20 ? 18.840 28.940 25.150 1.00 0.00 ? ? ? ? ? ? 20 VAL A C 2
ATOM 1813 O O . VAL C 3 20 ? 17.940 29.240 24.380 1.00 0.00 ? ? ? ? ? ? 20 VAL A O 2
ATOM 1814 C CB . VAL C 3 20 ? 21.170 30.240 25.180 1.00 0.00 ? ? ? ? ? ? 20 VAL A CB 2
ATOM 1815 C CG1 . VAL C 3 20 ? 21.350 30.030 23.690 1.00 0.00 ? ? ? ? ? ? 20 VAL A CG1 2
ATOM 1816 C CG2 . VAL C 3 20 ? 21.640 31.660 25.470 1.00 0.00 ? ? ? ? ? ? 20 VAL A CG2 2
ATOM 1817 H H . VAL C 3 20 ? 20.820 29.830 27.550 1.00 0.00 ? ? ? ? ? ? 20 VAL A H 2
ATOM 1818 N N . SER C 3 21 ? 19.000 27.690 25.600 1.00 0.00 ? ? ? ? ? ? 21 SER A N 2
ATOM 1819 C CA . SER C 3 21 ? 18.010 26.600 25.390 1.00 0.00 ? ? ? ? ? ? 21 SER A CA 2
ATOM 1820 C C . SER C 3 21 ? 16.580 27.040 25.720 1.00 0.00 ? ? ? ? ? ? 21 SER A C 2
ATOM 1821 O O . SER C 3 21 ? 15.740 27.080 24.830 1.00 0.00 ? ? ? ? ? ? 21 SER A O 2
ATOM 1822 C CB . SER C 3 21 ? 18.350 25.360 26.240 1.00 0.00 ? ? ? ? ? ? 21 SER A CB 2
ATOM 1823 O OG . SER C 3 21 ? 17.410 24.310 26.020 1.00 0.00 ? ? ? ? ? ? 21 SER A OG 2
ATOM 1824 H H . SER C 3 21 ? 19.890 27.370 25.960 1.00 0.00 ? ? ? ? ? ? 21 SER A H 2
ATOM 1825 H HG . SER C 3 21 ? 17.470 24.020 25.020 1.00 0.00 ? ? ? ? ? ? 21 SER A HG 2
ATOM 1826 N N . ARG C 3 22 ? 16.390 27.600 26.920 1.00 0.00 ? ? ? ? ? ? 22 ARG A N 2
ATOM 1827 C CA . ARG C 3 22 ? 15.110 28.220 27.340 1.00 0.00 ? ? ? ? ? ? 22 ARG A CA 2
ATOM 1828 C C . ARG C 3 22 ? 14.810 29.650 26.860 1.00 0.00 ? ? ? ? ? ? 22 ARG A C 2
ATOM 1829 O O . ARG C 3 22 ? 13.950 30.370 27.380 1.00 0.00 ? ? ? ? ? ? 22 ARG A O 2
ATOM 1830 C CB . ARG C 3 22 ? 14.910 28.030 28.850 1.00 0.00 ? ? ? ? ? ? 22 ARG A CB 2
ATOM 1831 C CG . ARG C 3 22 ? 14.530 26.580 29.140 1.00 0.00 ? ? ? ? ? ? 22 ARG A CG 2
ATOM 1832 C CD . ARG C 3 22 ? 14.340 26.450 30.640 1.00 0.00 ? ? ? ? ? ? 22 ARG A CD 2
ATOM 1833 N NE . ARG C 3 22 ? 14.270 25.050 31.100 1.00 0.00 ? ? ? ? ? ? 22 ARG A NE 2
ATOM 1834 C CZ . ARG C 3 22 ? 14.760 24.610 32.260 1.00 0.00 ? ? ? ? ? ? 22 ARG A CZ 2
ATOM 1835 N NH1 . ARG C 3 22 ? 15.680 25.320 32.930 1.00 0.00 ? ? ? ? ? ? 22 ARG A NH1 2
ATOM 1836 N NH2 . ARG C 3 22 ? 14.600 23.340 32.620 1.00 0.00 ? ? ? ? ? ? 22 ARG A NH2 2
ATOM 1837 H H . ARG C 3 22 ? 17.100 27.480 27.630 1.00 0.00 ? ? ? ? ? ? 22 ARG A H 2
ATOM 1838 H HE . ARG C 3 22 ? 13.780 24.410 30.490 1.00 0.00 ? ? ? ? ? ? 22 ARG A HE 2
ATOM 1839 H HH11 . ARG C 3 22 ? 16.030 26.170 32.510 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH11 2
ATOM 1840 H HH12 . ARG C 3 22 ? 16.090 24.990 33.770 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH12 2
ATOM 1841 H HH21 . ARG C 3 22 ? 14.110 22.710 32.030 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH21 2
ATOM 1842 H HH22 . ARG C 3 22 ? 14.900 23.040 33.520 1.00 0.00 ? ? ? ? ? ? 22 ARG A HH22 2
ATOM 1843 N N . VAL C 3 23 ? 15.400 29.990 25.720 1.00 0.00 ? ? ? ? ? ? 23 VAL A N 2
ATOM 1844 C CA . VAL C 3 23 ? 15.020 31.120 24.860 1.00 0.00 ? ? ? ? ? ? 23 VAL A CA 2
ATOM 1845 C C . VAL C 3 23 ? 14.470 30.480 23.570 1.00 0.00 ? ? ? ? ? ? 23 VAL A C 2
ATOM 1846 O O . VAL C 3 23 ? 13.490 30.990 23.010 1.00 0.00 ? ? ? ? ? ? 23 VAL A O 2
ATOM 1847 C CB . VAL C 3 23 ? 16.210 32.090 24.660 1.00 0.00 ? ? ? ? ? ? 23 VAL A CB 2
ATOM 1848 C CG1 . VAL C 3 23 ? 16.270 32.800 23.310 1.00 0.00 ? ? ? ? ? ? 23 VAL A CG1 2
ATOM 1849 C CG2 . VAL C 3 23 ? 16.180 33.120 25.790 1.00 0.00 ? ? ? ? ? ? 23 VAL A CG2 2
ATOM 1850 H H . VAL C 3 23 ? 16.110 29.400 25.340 1.00 0.00 ? ? ? ? ? ? 23 VAL A H 2
ATOM 1851 N N . VAL C 3 24 ? 15.180 29.460 23.090 1.00 0.00 ? ? ? ? ? ? 24 VAL A N 2
ATOM 1852 C CA . VAL C 3 24 ? 14.790 28.610 21.950 1.00 0.00 ? ? ? ? ? ? 24 VAL A CA 2
ATOM 1853 C C . VAL C 3 24 ? 13.510 27.800 22.260 1.00 0.00 ? ? ? ? ? ? 24 VAL A C 2
ATOM 1854 O O . VAL C 3 24 ? 12.450 28.100 21.710 1.00 0.00 ? ? ? ? ? ? 24 VAL A O 2
ATOM 1855 C CB . VAL C 3 24 ? 16.000 27.750 21.490 1.00 0.00 ? ? ? ? ? ? 24 VAL A CB 2
ATOM 1856 C CG1 . VAL C 3 24 ? 15.590 26.760 20.400 1.00 0.00 ? ? ? ? ? ? 24 VAL A CG1 2
ATOM 1857 C CG2 . VAL C 3 24 ? 17.170 28.560 20.920 1.00 0.00 ? ? ? ? ? ? 24 VAL A CG2 2
ATOM 1858 H H . VAL C 3 24 ? 16.090 29.250 23.460 1.00 0.00 ? ? ? ? ? ? 24 VAL A H 2
ATOM 1859 N N . ASN C 3 25 ? 13.620 26.840 23.180 1.00 0.00 ? ? ? ? ? ? 25 ASN A N 2
ATOM 1860 C CA . ASN C 3 25 ? 12.570 25.880 23.570 1.00 0.00 ? ? ? ? ? ? 25 ASN A CA 2
ATOM 1861 C C . ASN C 3 25 ? 12.320 25.730 25.070 1.00 0.00 ? ? ? ? ? ? 25 ASN A C 2
ATOM 1862 O O . ASN C 3 25 ? 13.260 25.790 25.870 1.00 0.00 ? ? ? ? ? ? 25 ASN A O 2
ATOM 1863 C CB . ASN C 3 25 ? 13.010 24.500 23.070 1.00 0.00 ? ? ? ? ? ? 25 ASN A CB 2
ATOM 1864 C CG . ASN C 3 25 ? 12.490 24.320 21.650 1.00 0.00 ? ? ? ? ? ? 25 ASN A CG 2
ATOM 1865 O OD1 . ASN C 3 25 ? 11.330 24.560 21.360 1.00 0.00 ? ? ? ? ? ? 25 ASN A OD1 2
ATOM 1866 N ND2 . ASN C 3 25 ? 13.240 23.720 20.770 1.00 0.00 ? ? ? ? ? ? 25 ASN A ND2 2
ATOM 1867 H H . ASN C 3 25 ? 14.490 26.700 23.660 1.00 0.00 ? ? ? ? ? ? 25 ASN A H 2
ATOM 1868 H HD21 . ASN C 3 25 ? 14.140 23.320 21.000 1.00 0.00 ? ? ? ? ? ? 25 ASN A HD21 2
ATOM 1869 H HD22 . ASN C 3 25 ? 12.900 23.690 19.820 1.00 0.00 ? ? ? ? ? ? 25 ASN A HD22 2
ATOM 1870 N N . GLN C 3 26 ? 11.090 25.340 25.420 1.00 0.00 ? ? ? ? ? ? 26 GLN A N 2
ATOM 1871 C CA . GLN C 3 26 ? 10.650 25.130 26.820 1.00 0.00 ? ? ? ? ? ? 26 GLN A CA 2
ATOM 1872 C C . GLN C 3 26 ? 10.990 26.360 27.700 1.00 0.00 ? ? ? ? ? ? 26 GLN A C 2
ATOM 1873 O O . GLN C 3 26 ? 11.370 26.290 28.870 1.00 0.00 ? ? ? ? ? ? 26 GLN A O 2
ATOM 1874 C CB . GLN C 3 26 ? 11.350 23.860 27.300 1.00 0.00 ? ? ? ? ? ? 26 GLN A CB 2
ATOM 1875 C CG . GLN C 3 26 ? 11.040 23.330 28.700 1.00 0.00 ? ? ? ? ? ? 26 GLN A CG 2
ATOM 1876 C CD . GLN C 3 26 ? 12.100 22.300 29.060 1.00 0.00 ? ? ? ? ? ? 26 GLN A CD 2
ATOM 1877 O OE1 . GLN C 3 26 ? 12.890 22.480 29.990 1.00 0.00 ? ? ? ? ? ? 26 GLN A OE1 2
ATOM 1878 N NE2 . GLN C 3 26 ? 12.280 21.330 28.180 1.00 0.00 ? ? ? ? ? ? 26 GLN A NE2 2
ATOM 1879 H H . GLN C 3 26 ? 10.340 25.370 24.750 1.00 0.00 ? ? ? ? ? ? 26 GLN A H 2
ATOM 1880 H HE21 . GLN C 3 26 ? 11.750 21.340 27.320 1.00 0.00 ? ? ? ? ? ? 26 GLN A HE21 2
ATOM 1881 H HE22 . GLN C 3 26 ? 12.960 20.630 28.340 1.00 0.00 ? ? ? ? ? ? 26 GLN A HE22 2
ATOM 1882 N N . ALA C 3 27 ? 10.840 27.520 27.070 1.00 0.00 ? ? ? ? ? ? 27 ALA A N 2
ATOM 1883 C CA . ALA C 3 27 ? 11.220 28.840 27.590 1.00 0.00 ? ? ? ? ? ? 27 ALA A CA 2
ATOM 1884 C C . ALA C 3 27 ? 10.520 29.220 28.890 1.00 0.00 ? ? ? ? ? ? 27 ALA A C 2
ATOM 1885 O O . ALA C 3 27 ? 9.400 28.800 29.150 1.00 0.00 ? ? ? ? ? ? 27 ALA A O 2
ATOM 1886 C CB . ALA C 3 27 ? 11.000 29.880 26.500 1.00 0.00 ? ? ? ? ? ? 27 ALA A CB 2
ATOM 1887 H H . ALA C 3 27 ? 10.520 27.540 26.100 1.00 0.00 ? ? ? ? ? ? 27 ALA A H 2
ATOM 1888 N N . SER C 3 28 ? 11.420 29.560 29.800 1.00 0.00 ? ? ? ? ? ? 28 SER A N 2
ATOM 1889 C CA . SER C 3 28 ? 11.100 30.120 31.120 1.00 0.00 ? ? ? ? ? ? 28 SER A CA 2
ATOM 1890 C C . SER C 3 28 ? 12.340 30.790 31.720 1.00 0.00 ? ? ? ? ? ? 28 SER A C 2
ATOM 1891 O O . SER C 3 28 ? 13.470 30.440 31.360 1.00 0.00 ? ? ? ? ? ? 28 SER A O 2
ATOM 1892 C CB . SER C 3 28 ? 10.630 29.000 32.060 1.00 0.00 ? ? ? ? ? ? 28 SER A CB 2
ATOM 1893 O OG . SER C 3 28 ? 11.730 28.200 32.530 1.00 0.00 ? ? ? ? ? ? 28 SER A OG 2
ATOM 1894 H H . SER C 3 28 ? 12.380 29.290 29.700 1.00 0.00 ? ? ? ? ? ? 28 SER A H 2
ATOM 1895 H HG . SER C 3 28 ? 11.660 27.260 32.130 1.00 0.00 ? ? ? ? ? ? 28 SER A HG 2
ATOM 1896 N N . HIS C 3 29 ? 12.110 31.760 32.610 1.00 0.00 ? ? ? ? ? ? 29 HIS A N 2
ATOM 1897 C CA . HIS C 3 29 ? 13.140 32.420 33.430 1.00 0.00 ? ? ? ? ? ? 29 HIS A CA 2
ATOM 1898 C C . HIS C 3 29 ? 14.150 33.270 32.650 1.00 0.00 ? ? ? ? ? ? 29 HIS A C 2
ATOM 1899 O O . HIS C 3 29 ? 15.360 33.220 32.850 1.00 0.00 ? ? ? ? ? ? 29 HIS A O 2
ATOM 1900 C CB . HIS C 3 29 ? 13.860 31.390 34.320 1.00 0.00 ? ? ? ? ? ? 29 HIS A CB 2
ATOM 1901 C CG . HIS C 3 29 ? 12.960 30.880 35.430 1.00 0.00 ? ? ? ? ? ? 29 HIS A CG 2
ATOM 1902 N ND1 . HIS C 3 29 ? 12.970 31.330 36.680 1.00 0.00 ? ? ? ? ? ? 29 HIS A ND1 2
ATOM 1903 C CD2 . HIS C 3 29 ? 12.210 29.780 35.390 1.00 0.00 ? ? ? ? ? ? 29 HIS A CD2 2
ATOM 1904 C CE1 . HIS C 3 29 ? 12.270 30.460 37.410 1.00 0.00 ? ? ? ? ? ? 29 HIS A CE1 2
ATOM 1905 N NE2 . HIS C 3 29 ? 11.780 29.520 36.610 1.00 0.00 ? ? ? ? ? ? 29 HIS A NE2 2
ATOM 1906 H H . HIS C 3 29 ? 11.180 32.070 32.790 1.00 0.00 ? ? ? ? ? ? 29 HIS A H 2
ATOM 1907 H HD1 . HIS C 3 29 ? 13.230 32.280 36.940 1.00 0.00 ? ? ? ? ? ? 29 HIS A HD1 2
ATOM 1908 H HE2 . HIS C 3 29 ? 11.070 28.840 36.860 1.00 0.00 ? ? ? ? ? ? 29 HIS A HE2 2
ATOM 1909 N N . VAL C 3 30 ? 13.580 34.360 32.160 1.00 0.00 ? ? ? ? ? ? 30 VAL A N 2
ATOM 1910 C CA . VAL C 3 30 ? 14.300 35.300 31.270 1.00 0.00 ? ? ? ? ? ? 30 VAL A CA 2
ATOM 1911 C C . VAL C 3 30 ? 13.720 36.710 31.340 1.00 0.00 ? ? ? ? ? ? 30 VAL A C 2
ATOM 1912 O O . VAL C 3 30 ? 12.590 37.010 30.930 1.00 0.00 ? ? ? ? ? ? 30 VAL A O 2
ATOM 1913 C CB . VAL C 3 30 ? 14.440 34.680 29.850 1.00 0.00 ? ? ? ? ? ? 30 VAL A CB 2
ATOM 1914 C CG1 . VAL C 3 30 ? 13.090 34.470 29.150 1.00 0.00 ? ? ? ? ? ? 30 VAL A CG1 2
ATOM 1915 C CG2 . VAL C 3 30 ? 15.370 35.530 29.000 1.00 0.00 ? ? ? ? ? ? 30 VAL A CG2 2
ATOM 1916 H H . VAL C 3 30 ? 12.770 34.760 32.610 1.00 0.00 ? ? ? ? ? ? 30 VAL A H 2
ATOM 1917 N N . SER C 3 31 ? 14.600 37.600 31.780 1.00 0.00 ? ? ? ? ? ? 31 SER A N 2
ATOM 1918 C CA . SER C 3 31 ? 14.250 38.980 32.170 1.00 0.00 ? ? ? ? ? ? 31 SER A CA 2
ATOM 1919 C C . SER C 3 31 ? 14.760 39.970 31.120 1.00 0.00 ? ? ? ? ? ? 31 SER A C 2
ATOM 1920 O O . SER C 3 31 ? 15.750 39.700 30.430 1.00 0.00 ? ? ? ? ? ? 31 SER A O 2
ATOM 1921 C CB . SER C 3 31 ? 14.960 39.380 33.460 1.00 0.00 ? ? ? ? ? ? 31 SER A CB 2
ATOM 1922 O OG . SER C 3 31 ? 14.920 38.370 34.470 1.00 0.00 ? ? ? ? ? ? 31 SER A OG 2
ATOM 1923 H H . SER C 3 31 ? 15.580 37.430 31.680 1.00 0.00 ? ? ? ? ? ? 31 SER A H 2
ATOM 1924 H HG . SER C 3 31 ? 13.940 38.220 34.760 1.00 0.00 ? ? ? ? ? ? 31 SER A HG 2
ATOM 1925 N N . ALA C 3 32 ? 14.290 41.200 31.300 1.00 0.00 ? ? ? ? ? ? 32 ALA A N 2
ATOM 1926 C CA . ALA C 3 32 ? 14.600 42.380 30.470 1.00 0.00 ? ? ? ? ? ? 32 ALA A CA 2
ATOM 1927 C C . ALA C 3 32 ? 16.070 42.510 29.990 1.00 0.00 ? ? ? ? ? ? 32 ALA A C 2
ATOM 1928 O O . ALA C 3 32 ? 16.300 42.570 28.790 1.00 0.00 ? ? ? ? ? ? 32 ALA A O 2
ATOM 1929 C CB . ALA C 3 32 ? 14.170 43.600 31.280 1.00 0.00 ? ? ? ? ? ? 32 ALA A CB 2
ATOM 1930 H H . ALA C 3 32 ? 13.730 41.400 32.100 1.00 0.00 ? ? ? ? ? ? 32 ALA A H 2
ATOM 1931 N N . LYS C 3 33 ? 17.050 42.410 30.890 1.00 0.00 ? ? ? ? ? ? 33 LYS A N 2
ATOM 1932 C CA . LYS C 3 33 ? 18.480 42.630 30.570 1.00 0.00 ? ? ? ? ? ? 33 LYS A CA 2
ATOM 1933 C C . LYS C 3 33 ? 19.050 41.520 29.670 1.00 0.00 ? ? ? ? ? ? 33 LYS A C 2
ATOM 1934 O O . LYS C 3 33 ? 19.440 41.780 28.530 1.00 0.00 ? ? ? ? ? ? 33 LYS A O 2
ATOM 1935 C CB . LYS C 3 33 ? 19.340 42.810 31.820 1.00 0.00 ? ? ? ? ? ? 33 LYS A CB 2
ATOM 1936 C CG . LYS C 3 33 ? 20.770 43.260 31.480 1.00 0.00 ? ? ? ? ? ? 33 LYS A CG 2
ATOM 1937 C CD . LYS C 3 33 ? 20.760 44.750 31.120 1.00 0.00 ? ? ? ? ? ? 33 LYS A CD 2
ATOM 1938 C CE . LYS C 3 33 ? 21.980 45.230 30.350 1.00 0.00 ? ? ? ? ? ? 33 LYS A CE 2
ATOM 1939 N NZ . LYS C 3 33 ? 21.650 46.580 29.880 1.00 0.00 ? ? ? ? ? ? 33 LYS A NZ 2
ATOM 1940 H H . LYS C 3 33 ? 16.840 42.210 31.860 1.00 0.00 ? ? ? ? ? ? 33 LYS A H 2
ATOM 1941 H HZ1 . LYS C 3 33 ? 20.790 46.540 29.340 1.00 0.00 ? ? ? ? ? ? 33 LYS A HZ1 2
ATOM 1942 H HZ2 . LYS C 3 33 ? 21.480 47.180 30.660 1.00 0.00 ? ? ? ? ? ? 33 LYS A HZ2 2
ATOM 1943 H HZ3 . LYS C 3 33 ? 22.380 46.980 29.310 1.00 0.00 ? ? ? ? ? ? 33 LYS A HZ3 2
ATOM 1944 N N . THR C 3 34 ? 19.010 40.290 30.190 1.00 0.00 ? ? ? ? ? ? 34 THR A N 2
ATOM 1945 C CA . THR C 3 34 ? 19.380 39.060 29.470 1.00 0.00 ? ? ? ? ? ? 34 THR A CA 2
ATOM 1946 C C . THR C 3 34 ? 18.680 38.860 28.120 1.00 0.00 ? ? ? ? ? ? 34 THR A C 2
ATOM 1947 O O . THR C 3 34 ? 19.360 38.650 27.110 1.00 0.00 ? ? ? ? ? ? 34 THR A O 2
ATOM 1948 C CB . THR C 3 34 ? 19.130 37.830 30.340 1.00 0.00 ? ? ? ? ? ? 34 THR A CB 2
ATOM 1949 O OG1 . THR C 3 34 ? 17.850 37.920 30.990 1.00 0.00 ? ? ? ? ? ? 34 THR A OG1 2
ATOM 1950 C CG2 . THR C 3 34 ? 20.320 37.640 31.280 1.00 0.00 ? ? ? ? ? ? 34 THR A CG2 2
ATOM 1951 H H . THR C 3 34 ? 18.740 40.150 31.150 1.00 0.00 ? ? ? ? ? ? 34 THR A H 2
ATOM 1952 H HG1 . THR C 3 34 ? 17.870 37.600 31.970 1.00 0.00 ? ? ? ? ? ? 34 THR A HG1 2
ATOM 1953 N N . ARG C 3 35 ? 17.390 39.200 28.050 1.00 0.00 ? ? ? ? ? ? 35 ARG A N 2
ATOM 1954 C CA . ARG C 3 35 ? 16.590 39.100 26.810 1.00 0.00 ? ? ? ? ? ? 35 ARG A CA 2
ATOM 1955 C C . ARG C 3 35 ? 17.210 39.920 25.660 1.00 0.00 ? ? ? ? ? ? 35 ARG A C 2
ATOM 1956 O O . ARG C 3 35 ? 17.510 39.360 24.600 1.00 0.00 ? ? ? ? ? ? 35 ARG A O 2
ATOM 1957 C CB . ARG C 3 35 ? 15.140 39.510 27.080 1.00 0.00 ? ? ? ? ? ? 35 ARG A CB 2
ATOM 1958 C CG . ARG C 3 35 ? 14.270 39.330 25.830 1.00 0.00 ? ? ? ? ? ? 35 ARG A CG 2
ATOM 1959 C CD . ARG C 3 35 ? 12.800 39.100 26.170 1.00 0.00 ? ? ? ? ? ? 35 ARG A CD 2
ATOM 1960 N NE . ARG C 3 35 ? 12.280 40.320 26.800 1.00 0.00 ? ? ? ? ? ? 35 ARG A NE 2
ATOM 1961 C CZ . ARG C 3 35 ? 11.550 40.410 27.920 1.00 0.00 ? ? ? ? ? ? 35 ARG A CZ 2
ATOM 1962 N NH1 . ARG C 3 35 ? 10.920 39.380 28.490 1.00 0.00 ? ? ? ? ? ? 35 ARG A NH1 2
ATOM 1963 N NH2 . ARG C 3 35 ? 11.300 41.620 28.420 1.00 0.00 ? ? ? ? ? ? 35 ARG A NH2 2
ATOM 1964 H H . ARG C 3 35 ? 16.900 39.530 28.870 1.00 0.00 ? ? ? ? ? ? 35 ARG A H 2
ATOM 1965 H HE . ARG C 3 35 ? 12.550 41.180 26.350 1.00 0.00 ? ? ? ? ? ? 35 ARG A HE 2
ATOM 1966 H HH11 . ARG C 3 35 ? 10.830 38.480 28.040 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH11 2
ATOM 1967 H HH12 . ARG C 3 35 ? 10.460 39.550 29.350 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH12 2
ATOM 1968 H HH21 . ARG C 3 35 ? 11.670 42.440 27.970 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH21 2
ATOM 1969 H HH22 . ARG C 3 35 ? 10.700 41.730 29.210 1.00 0.00 ? ? ? ? ? ? 35 ARG A HH22 2
ATOM 1970 N N . GLU C 3 36 ? 17.520 41.180 25.950 1.00 0.00 ? ? ? ? ? ? 36 GLU A N 2
ATOM 1971 C CA . GLU C 3 36 ? 18.250 42.060 25.010 1.00 0.00 ? ? ? ? ? ? 36 GLU A CA 2
ATOM 1972 C C . GLU C 3 36 ? 19.590 41.440 24.540 1.00 0.00 ? ? ? ? ? ? 36 GLU A C 2
ATOM 1973 O O . GLU C 3 36 ? 19.830 41.320 23.340 1.00 0.00 ? ? ? ? ? ? 36 GLU A O 2
ATOM 1974 C CB . GLU C 3 36 ? 18.490 43.410 25.700 1.00 0.00 ? ? ? ? ? ? 36 GLU A CB 2
ATOM 1975 C CG . GLU C 3 36 ? 18.920 44.500 24.720 1.00 0.00 ? ? ? ? ? ? 36 GLU A CG 2
ATOM 1976 C CD . GLU C 3 36 ? 19.500 45.730 25.410 1.00 0.00 ? ? ? ? ? ? 36 GLU A CD 2
ATOM 1977 O OE1 . GLU C 3 36 ? 18.760 46.690 25.720 1.00 0.00 ? ? ? ? ? ? 36 GLU A OE1 2
ATOM 1978 O OE2 . GLU C 3 36 ? 20.740 45.770 25.530 1.00 0.00 ? ? ? ? ? ? 36 GLU A OE2 2
ATOM 1979 H H . GLU C 3 36 ? 17.210 41.630 26.790 1.00 0.00 ? ? ? ? ? ? 36 GLU A H 2
ATOM 1980 N N . LYS C 3 37 ? 20.380 40.940 25.500 1.00 0.00 ? ? ? ? ? ? 37 LYS A N 2
ATOM 1981 C CA . LYS C 3 37 ? 21.690 40.280 25.280 1.00 0.00 ? ? ? ? ? ? 37 LYS A CA 2
ATOM 1982 C C . LYS C 3 37 ? 21.650 39.080 24.320 1.00 0.00 ? ? ? ? ? ? 37 LYS A C 2
ATOM 1983 O O . LYS C 3 37 ? 22.460 38.980 23.400 1.00 0.00 ? ? ? ? ? ? 37 LYS A O 2
ATOM 1984 C CB . LYS C 3 37 ? 22.270 39.770 26.600 1.00 0.00 ? ? ? ? ? ? 37 LYS A CB 2
ATOM 1985 C CG . LYS C 3 37 ? 22.670 40.870 27.570 1.00 0.00 ? ? ? ? ? ? 37 LYS A CG 2
ATOM 1986 C CD . LYS C 3 37 ? 23.780 41.690 26.960 1.00 0.00 ? ? ? ? ? ? 37 LYS A CD 2
ATOM 1987 C CE . LYS C 3 37 ? 24.220 42.680 28.010 1.00 0.00 ? ? ? ? ? ? 37 LYS A CE 2
ATOM 1988 N NZ . LYS C 3 37 ? 25.240 43.500 27.380 1.00 0.00 ? ? ? ? ? ? 37 LYS A NZ 2
ATOM 1989 H H . LYS C 3 37 ? 20.090 41.000 26.460 1.00 0.00 ? ? ? ? ? ? 37 LYS A H 2
ATOM 1990 H HZ1 . LYS C 3 37 ? 25.960 42.900 27.020 1.00 0.00 ? ? ? ? ? ? 37 LYS A HZ1 2
ATOM 1991 H HZ2 . LYS C 3 37 ? 24.850 44.050 26.640 1.00 0.00 ? ? ? ? ? ? 37 LYS A HZ2 2
ATOM 1992 H HZ3 . LYS C 3 37 ? 25.670 44.110 28.060 1.00 0.00 ? ? ? ? ? ? 37 LYS A HZ3 2
ATOM 1993 N N . VAL C 3 38 ? 20.740 38.160 24.620 1.00 0.00 ? ? ? ? ? ? 38 VAL A N 2
ATOM 1994 C CA . VAL C 3 38 ? 20.480 36.970 23.790 1.00 0.00 ? ? ? ? ? ? 38 VAL A CA 2
ATOM 1995 C C . VAL C 3 38 ? 20.100 37.380 22.350 1.00 0.00 ? ? ? ? ? ? 38 VAL A C 2
ATOM 1996 O O . VAL C 3 38 ? 20.750 36.910 21.420 1.00 0.00 ? ? ? ? ? ? 38 VAL A O 2
ATOM 1997 C CB . VAL C 3 38 ? 19.390 36.040 24.390 1.00 0.00 ? ? ? ? ? ? 38 VAL A CB 2
ATOM 1998 C CG1 . VAL C 3 38 ? 19.290 34.740 23.580 1.00 0.00 ? ? ? ? ? ? 38 VAL A CG1 2
ATOM 1999 C CG2 . VAL C 3 38 ? 19.680 35.680 25.850 1.00 0.00 ? ? ? ? ? ? 38 VAL A CG2 2
ATOM 2000 H H . VAL C 3 38 ? 20.300 38.160 25.530 1.00 0.00 ? ? ? ? ? ? 38 VAL A H 2
ATOM 2001 N N . GLU C 3 39 ? 19.200 38.350 22.200 1.00 0.00 ? ? ? ? ? ? 39 GLU A N 2
ATOM 2002 C CA . GLU C 3 39 ? 18.860 38.870 20.860 1.00 0.00 ? ? ? ? ? ? 39 GLU A CA 2
ATOM 2003 C C . GLU C 3 39 ? 20.040 39.500 20.130 1.00 0.00 ? ? ? ? ? ? 39 GLU A C 2
ATOM 2004 O O . GLU C 3 39 ? 20.280 39.210 18.950 1.00 0.00 ? ? ? ? ? ? 39 GLU A O 2
ATOM 2005 C CB . GLU C 3 39 ? 17.630 39.790 20.860 1.00 0.00 ? ? ? ? ? ? 39 GLU A CB 2
ATOM 2006 C CG . GLU C 3 39 ? 16.380 38.920 20.860 1.00 0.00 ? ? ? ? ? ? 39 GLU A CG 2
ATOM 2007 C CD . GLU C 3 39 ? 15.080 39.680 20.600 1.00 0.00 ? ? ? ? ? ? 39 GLU A CD 2
ATOM 2008 O OE1 . GLU C 3 39 ? 14.840 40.100 19.450 1.00 0.00 ? ? ? ? ? ? 39 GLU A OE1 2
ATOM 2009 O OE2 . GLU C 3 39 ? 14.340 39.880 21.580 1.00 0.00 ? ? ? ? ? ? 39 GLU A OE2 2
ATOM 2010 H H . GLU C 3 39 ? 18.690 38.740 22.970 1.00 0.00 ? ? ? ? ? ? 39 GLU A H 2
ATOM 2011 N N . ALA C 3 40 ? 20.820 40.320 20.850 1.00 0.00 ? ? ? ? ? ? 40 ALA A N 2
ATOM 2012 C CA . ALA C 3 40 ? 22.090 40.880 20.360 1.00 0.00 ? ? ? ? ? ? 40 ALA A CA 2
ATOM 2013 C C . ALA C 3 40 ? 23.010 39.770 19.790 1.00 0.00 ? ? ? ? ? ? 40 ALA A C 2
ATOM 2014 O O . ALA C 3 40 ? 23.350 39.820 18.610 1.00 0.00 ? ? ? ? ? ? 40 ALA A O 2
ATOM 2015 C CB . ALA C 3 40 ? 22.760 41.620 21.520 1.00 0.00 ? ? ? ? ? ? 40 ALA A CB 2
ATOM 2016 H H . ALA C 3 40 ? 20.570 40.640 21.760 1.00 0.00 ? ? ? ? ? ? 40 ALA A H 2
ATOM 2017 N N . ALA C 3 41 ? 23.210 38.690 20.560 1.00 0.00 ? ? ? ? ? ? 41 ALA A N 2
ATOM 2018 C CA . ALA C 3 41 ? 24.020 37.530 20.130 1.00 0.00 ? ? ? ? ? ? 41 ALA A CA 2
ATOM 2019 C C . ALA C 3 41 ? 23.420 36.630 19.040 1.00 0.00 ? ? ? ? ? ? 41 ALA A C 2
ATOM 2020 O O . ALA C 3 41 ? 24.130 36.240 18.110 1.00 0.00 ? ? ? ? ? ? 41 ALA A O 2
ATOM 2021 C CB . ALA C 3 41 ? 24.440 36.670 21.320 1.00 0.00 ? ? ? ? ? ? 41 ALA A CB 2
ATOM 2022 H H . ALA C 3 41 ? 22.940 38.700 21.530 1.00 0.00 ? ? ? ? ? ? 41 ALA A H 2
ATOM 2023 N N . MET C 3 42 ? 22.110 36.400 19.100 1.00 0.00 ? ? ? ? ? ? 42 MET A N 2
ATOM 2024 C CA . MET C 3 42 ? 21.380 35.640 18.060 1.00 0.00 ? ? ? ? ? ? 42 MET A CA 2
ATOM 2025 C C . MET C 3 42 ? 21.590 36.220 16.650 1.00 0.00 ? ? ? ? ? ? 42 MET A C 2
ATOM 2026 O O . MET C 3 42 ? 21.820 35.460 15.700 1.00 0.00 ? ? ? ? ? ? 42 MET A O 2
ATOM 2027 C CB . MET C 3 42 ? 19.890 35.550 18.360 1.00 0.00 ? ? ? ? ? ? 42 MET A CB 2
ATOM 2028 C CG . MET C 3 42 ? 19.560 34.620 19.530 1.00 0.00 ? ? ? ? ? ? 42 MET A CG 2
ATOM 2029 S SD . MET C 3 42 ? 20.160 32.910 19.300 1.00 0.00 ? ? ? ? ? ? 42 MET A SD 2
ATOM 2030 C CE . MET C 3 42 ? 19.560 32.180 20.800 1.00 0.00 ? ? ? ? ? ? 42 MET A CE 2
ATOM 2031 H H . MET C 3 42 ? 21.550 36.670 19.900 1.00 0.00 ? ? ? ? ? ? 42 MET A H 2
ATOM 2032 N N . ALA C 3 43 ? 21.390 37.530 16.500 1.00 0.00 ? ? ? ? ? ? 43 ALA A N 2
ATOM 2033 C CA . ALA C 3 43 ? 21.580 38.230 15.210 1.00 0.00 ? ? ? ? ? ? 43 ALA A CA 2
ATOM 2034 C C . ALA C 3 43 ? 23.050 38.400 14.750 1.00 0.00 ? ? ? ? ? ? 43 ALA A C 2
ATOM 2035 O O . ALA C 3 43 ? 23.310 38.360 13.550 1.00 0.00 ? ? ? ? ? ? 43 ALA A O 2
ATOM 2036 C CB . ALA C 3 43 ? 20.830 39.560 15.190 1.00 0.00 ? ? ? ? ? ? 43 ALA A CB 2
ATOM 2037 H H . ALA C 3 43 ? 20.920 38.060 17.200 1.00 0.00 ? ? ? ? ? ? 43 ALA A H 2
ATOM 2038 N N . GLU C 3 44 ? 23.950 38.710 15.680 1.00 0.00 ? ? ? ? ? ? 44 GLU A N 2
ATOM 2039 C CA . GLU C 3 44 ? 25.400 38.790 15.360 1.00 0.00 ? ? ? ? ? ? 44 GLU A CA 2
ATOM 2040 C C . GLU C 3 44 ? 26.070 37.480 14.910 1.00 0.00 ? ? ? ? ? ? 44 GLU A C 2
ATOM 2041 O O . GLU C 3 44 ? 26.910 37.540 14.020 1.00 0.00 ? ? ? ? ? ? 44 GLU A O 2
ATOM 2042 C CB . GLU C 3 44 ? 26.250 39.480 16.440 1.00 0.00 ? ? ? ? ? ? 44 GLU A CB 2
ATOM 2043 C CG . GLU C 3 44 ? 26.760 40.880 16.040 1.00 0.00 ? ? ? ? ? ? 44 GLU A CG 2
ATOM 2044 C CD . GLU C 3 44 ? 25.780 42.030 16.330 1.00 0.00 ? ? ? ? ? ? 44 GLU A CD 2
ATOM 2045 O OE1 . GLU C 3 44 ? 24.970 42.330 15.440 1.00 0.00 ? ? ? ? ? ? 44 GLU A OE1 2
ATOM 2046 O OE2 . GLU C 3 44 ? 25.930 42.700 17.380 1.00 0.00 ? ? ? ? ? ? 44 GLU A OE2 2
ATOM 2047 H H . GLU C 3 44 ? 23.680 39.210 16.510 1.00 0.00 ? ? ? ? ? ? 44 GLU A H 2
ATOM 2048 N N . LEU C 3 45 ? 25.660 36.310 15.410 1.00 0.00 ? ? ? ? ? ? 45 LEU A N 2
ATOM 2049 C CA . LEU C 3 45 ? 26.270 35.030 15.020 1.00 0.00 ? ? ? ? ? ? 45 LEU A CA 2
ATOM 2050 C C . LEU C 3 45 ? 25.290 34.150 14.250 1.00 0.00 ? ? ? ? ? ? 45 LEU A C 2
ATOM 2051 O O . LEU C 3 45 ? 24.110 34.060 14.590 1.00 0.00 ? ? ? ? ? ? 45 LEU A O 2
ATOM 2052 C CB . LEU C 3 45 ? 26.760 34.320 16.280 1.00 0.00 ? ? ? ? ? ? 45 LEU A CB 2
ATOM 2053 C CG . LEU C 3 45 ? 27.990 35.000 16.910 1.00 0.00 ? ? ? ? ? ? 45 LEU A CG 2
ATOM 2054 C CD1 . LEU C 3 45 ? 28.300 34.340 18.250 1.00 0.00 ? ? ? ? ? ? 45 LEU A CD1 2
ATOM 2055 C CD2 . LEU C 3 45 ? 29.220 34.860 16.010 1.00 0.00 ? ? ? ? ? ? 45 LEU A CD2 2
ATOM 2056 H H . LEU C 3 45 ? 25.020 36.210 16.180 1.00 0.00 ? ? ? ? ? ? 45 LEU A H 2
ATOM 2057 N N . ASN C 3 46 ? 25.860 33.310 13.400 1.00 0.00 ? ? ? ? ? ? 46 ASN A N 2
ATOM 2058 C CA . ASN C 3 46 ? 25.120 32.510 12.410 1.00 0.00 ? ? ? ? ? ? 46 ASN A CA 2
ATOM 2059 C C . ASN C 3 46 ? 24.500 31.210 12.970 1.00 0.00 ? ? ? ? ? ? 46 ASN A C 2
ATOM 2060 O O . ASN C 3 46 ? 24.530 30.160 12.330 1.00 0.00 ? ? ? ? ? ? 46 ASN A O 2
ATOM 2061 C CB . ASN C 3 46 ? 26.070 32.230 11.230 1.00 0.00 ? ? ? ? ? ? 46 ASN A CB 2
ATOM 2062 C CG . ASN C 3 46 ? 27.380 31.550 11.650 1.00 0.00 ? ? ? ? ? ? 46 ASN A CG 2
ATOM 2063 O OD1 . ASN C 3 46 ? 27.440 30.380 11.990 1.00 0.00 ? ? ? ? ? ? 46 ASN A OD1 2
ATOM 2064 N ND2 . ASN C 3 46 ? 28.440 32.320 11.750 1.00 0.00 ? ? ? ? ? ? 46 ASN A ND2 2
ATOM 2065 H H . ASN C 3 46 ? 26.850 33.150 13.400 1.00 0.00 ? ? ? ? ? ? 46 ASN A H 2
ATOM 2066 H HD21 . ASN C 3 46 ? 28.370 33.290 11.440 1.00 0.00 ? ? ? ? ? ? 46 ASN A HD21 2
ATOM 2067 H HD22 . ASN C 3 46 ? 29.300 31.940 12.080 1.00 0.00 ? ? ? ? ? ? 46 ASN A HD22 2
ATOM 2068 N N . TYR C 3 47 ? 24.000 31.310 14.190 1.00 0.00 ? ? ? ? ? ? 47 TYR A N 2
ATOM 2069 C CA . TYR C 3 47 ? 23.300 30.230 14.920 1.00 0.00 ? ? ? ? ? ? 47 TYR A CA 2
ATOM 2070 C C . TYR C 3 47 ? 22.340 29.440 14.030 1.00 0.00 ? ? ? ? ? ? 47 TYR A C 2
ATOM 2071 O O . TYR C 3 47 ? 21.390 29.980 13.480 1.00 0.00 ? ? ? ? ? ? 47 TYR A O 2
ATOM 2072 C CB . TYR C 3 47 ? 22.530 30.820 16.100 1.00 0.00 ? ? ? ? ? ? 47 TYR A CB 2
ATOM 2073 C CG . TYR C 3 47 ? 21.870 29.750 16.960 1.00 0.00 ? ? ? ? ? ? 47 TYR A CG 2
ATOM 2074 C CD1 . TYR C 3 47 ? 22.750 28.990 17.760 1.00 0.00 ? ? ? ? ? ? 47 TYR A CD1 2
ATOM 2075 C CD2 . TYR C 3 47 ? 20.530 29.340 16.750 1.00 0.00 ? ? ? ? ? ? 47 TYR A CD2 2
ATOM 2076 C CE1 . TYR C 3 47 ? 22.320 27.770 18.300 1.00 0.00 ? ? ? ? ? ? 47 TYR A CE1 2
ATOM 2077 C CE2 . TYR C 3 47 ? 20.090 28.120 17.300 1.00 0.00 ? ? ? ? ? ? 47 TYR A CE2 2
ATOM 2078 C CZ . TYR C 3 47 ? 21.010 27.340 18.040 1.00 0.00 ? ? ? ? ? ? 47 TYR A CZ 2
ATOM 2079 O OH . TYR C 3 47 ? 20.670 26.070 18.410 1.00 0.00 ? ? ? ? ? ? 47 TYR A OH 2
ATOM 2080 H H . TYR C 3 47 ? 24.110 32.170 14.700 1.00 0.00 ? ? ? ? ? ? 47 TYR A H 2
ATOM 2081 H HH . TYR C 3 47 ? 21.500 25.560 18.740 1.00 0.00 ? ? ? ? ? ? 47 TYR A HH 2
ATOM 2082 N N . ILE C 3 48 ? 22.460 28.130 14.190 1.00 0.00 ? ? ? ? ? ? 48 ILE A N 2
ATOM 2083 C CA . ILE C 3 48 ? 21.710 27.130 13.410 1.00 0.00 ? ? ? ? ? ? 48 ILE A CA 2
ATOM 2084 C C . ILE C 3 48 ? 21.100 26.210 14.480 1.00 0.00 ? ? ? ? ? ? 48 ILE A C 2
ATOM 2085 O O . ILE C 3 48 ? 21.860 25.650 15.280 1.00 0.00 ? ? ? ? ? ? 48 ILE A O 2
ATOM 2086 C CB . ILE C 3 48 ? 22.670 26.240 12.600 1.00 0.00 ? ? ? ? ? ? 48 ILE A CB 2
ATOM 2087 C CG1 . ILE C 3 48 ? 23.790 27.000 11.900 1.00 0.00 ? ? ? ? ? ? 48 ILE A CG1 2
ATOM 2088 C CG2 . ILE C 3 48 ? 21.910 25.360 11.590 1.00 0.00 ? ? ? ? ? ? 48 ILE A CG2 2
ATOM 2089 C CD1 . ILE C 3 48 ? 25.000 27.130 12.840 1.00 0.00 ? ? ? ? ? ? 48 ILE A CD1 2
ATOM 2090 H H . ILE C 3 48 ? 23.140 27.720 14.800 1.00 0.00 ? ? ? ? ? ? 48 ILE A H 2
ATOM 2091 N N . PRO C 3 49 ? 19.780 25.980 14.420 1.00 0.00 ? ? ? ? ? ? 49 PRO A N 2
ATOM 2092 C CA . PRO C 3 49 ? 19.140 25.030 15.340 1.00 0.00 ? ? ? ? ? ? 49 PRO A CA 2
ATOM 2093 C C . PRO C 3 49 ? 19.820 23.670 15.140 1.00 0.00 ? ? ? ? ? ? 49 PRO A C 2
ATOM 2094 O O . PRO C 3 49 ? 20.240 23.350 14.030 1.00 0.00 ? ? ? ? ? ? 49 PRO A O 2
ATOM 2095 C CB . PRO C 3 49 ? 17.670 25.050 14.920 1.00 0.00 ? ? ? ? ? ? 49 PRO A CB 2
ATOM 2096 C CG . PRO C 3 49 ? 17.490 26.410 14.260 1.00 0.00 ? ? ? ? ? ? 49 PRO A CG 2
ATOM 2097 C CD . PRO C 3 49 ? 18.800 26.600 13.510 1.00 0.00 ? ? ? ? ? ? 49 PRO A CD 2
ATOM 2098 N N . ASN C 3 50 ? 20.330 23.150 16.260 1.00 0.00 ? ? ? ? ? ? 50 ASN A N 2
ATOM 2099 C CA . ASN C 3 50 ? 20.960 21.810 16.320 1.00 0.00 ? ? ? ? ? ? 50 ASN A CA 2
ATOM 2100 C C . ASN C 3 50 ? 22.370 21.680 15.710 1.00 0.00 ? ? ? ? ? ? 50 ASN A C 2
ATOM 2101 O O . ASN C 3 50 ? 22.830 20.580 15.410 1.00 0.00 ? ? ? ? ? ? 50 ASN A O 2
ATOM 2102 C CB . ASN C 3 50 ? 20.060 20.740 15.690 1.00 0.00 ? ? ? ? ? ? 50 ASN A CB 2
ATOM 2103 C CG . ASN C 3 50 ? 18.850 20.510 16.570 1.00 0.00 ? ? ? ? ? ? 50 ASN A CG 2
ATOM 2104 O OD1 . ASN C 3 50 ? 17.810 21.150 16.470 1.00 0.00 ? ? ? ? ? ? 50 ASN A OD1 2
ATOM 2105 N ND2 . ASN C 3 50 ? 19.020 19.610 17.510 1.00 0.00 ? ? ? ? ? ? 50 ASN A ND2 2
ATOM 2106 H H . ASN C 3 50 ? 20.450 23.710 17.080 1.00 0.00 ? ? ? ? ? ? 50 ASN A H 2
ATOM 2107 H HD21 . ASN C 3 50 ? 19.930 19.190 17.630 1.00 0.00 ? ? ? ? ? ? 50 ASN A HD21 2
ATOM 2108 H HD22 . ASN C 3 50 ? 18.280 19.400 18.150 1.00 0.00 ? ? ? ? ? ? 50 ASN A HD22 2
ATOM 2109 N N . ARG C 3 51 ? 23.070 22.800 15.610 1.00 0.00 ? ? ? ? ? ? 51 ARG A N 2
ATOM 2110 C CA . ARG C 3 51 ? 24.480 22.760 15.180 1.00 0.00 ? ? ? ? ? ? 51 ARG A CA 2
ATOM 2111 C C . ARG C 3 51 ? 25.400 23.530 16.120 1.00 0.00 ? ? ? ? ? ? 51 ARG A C 2
ATOM 2112 O O . ARG C 3 51 ? 25.050 24.700 16.380 1.00 0.00 ? ? ? ? ? ? 51 ARG A O 2
ATOM 2113 C CB . ARG C 3 51 ? 24.660 23.260 13.750 1.00 0.00 ? ? ? ? ? ? 51 ARG A CB 2
ATOM 2114 C CG . ARG C 3 51 ? 24.250 22.200 12.710 1.00 0.00 ? ? ? ? ? ? 51 ARG A CG 2
ATOM 2115 C CD . ARG C 3 51 ? 25.170 20.970 12.740 1.00 0.00 ? ? ? ? ? ? 51 ARG A CD 2
ATOM 2116 N NE . ARG C 3 51 ? 26.580 21.360 12.540 1.00 0.00 ? ? ? ? ? ? 51 ARG A NE 2
ATOM 2117 C CZ . ARG C 3 51 ? 27.660 20.860 13.150 1.00 0.00 ? ? ? ? ? ? 51 ARG A CZ 2
ATOM 2118 N NH1 . ARG C 3 51 ? 27.580 19.940 14.110 1.00 0.00 ? ? ? ? ? ? 51 ARG A NH1 2
ATOM 2119 N NH2 . ARG C 3 51 ? 28.840 21.320 12.750 1.00 0.00 ? ? ? ? ? ? 51 ARG A NH2 2
ATOM 2120 O OXT . ARG C 3 51 ? 26.530 23.030 16.340 1.00 0.00 ? ? ? ? ? ? 51 ARG A OXT 2
ATOM 2121 H H . ARG C 3 51 ? 22.730 23.700 15.910 1.00 0.00 ? ? ? ? ? ? 51 ARG A H 2
ATOM 2122 H HE . ARG C 3 51 ? 26.750 22.050 11.820 1.00 0.00 ? ? ? ? ? ? 51 ARG A HE 2
ATOM 2123 H HH11 . ARG C 3 51 ? 26.710 19.690 14.530 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH11 2
ATOM 2124 H HH12 . ARG C 3 51 ? 28.420 19.520 14.450 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH12 2
ATOM 2125 H HH21 . ARG C 3 51 ? 28.890 21.900 11.940 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH21 2
ATOM 2126 H HH22 . ARG C 3 51 ? 29.700 21.010 13.170 1.00 0.00 ? ? ? ? ? ? 51 ARG A HH22 2
HETATM 2127 NA NA . NA D 4 . ? 16.870 24.560 19.270 1.00 0.00 ? ? ? ? ? ? 12 NA C NA 2
HETATM 2128 O O . HOH E 5 . ? 21.460 18.730 18.280 1.00 0.00 ? ? ? ? ? ? 52 HOH A O 2
HETATM 2129 H H1 . HOH E 5 . ? 22.360 19.090 18.550 1.00 0.00 ? ? ? ? ? ? 52 HOH A H1 2
HETATM 2130 H H2 . HOH E 5 . ? 21.140 18.090 18.970 1.00 0.00 ? ? ? ? ? ? 52 HOH A H2 2
HETATM 2131 O O . HOH E 5 . ? 17.180 27.410 31.630 1.00 0.00 ? ? ? ? ? ? 53 HOH A O 2
HETATM 2132 H H1 . HOH E 5 . ? 16.940 28.270 32.080 1.00 0.00 ? ? ? ? ? ? 53 HOH A H1 2
HETATM 2133 H H2 . HOH E 5 . ? 16.760 27.390 30.720 1.00 0.00 ? ? ? ? ? ? 53 HOH A H2 2
HETATM 2134 O O . HOH E 5 . ? 15.310 23.600 27.950 1.00 0.00 ? ? ? ? ? ? 54 HOH A O 2
HETATM 2135 H H1 . HOH E 5 . ? 16.070 23.800 27.330 1.00 0.00 ? ? ? ? ? ? 54 HOH A H1 2
HETATM 2136 H H2 . HOH E 5 . ? 14.460 23.920 27.530 1.00 0.00 ? ? ? ? ? ? 54 HOH A H2 2
HETATM 2137 O O . HOH E 5 . ? 18.030 22.820 18.820 1.00 0.00 ? ? ? ? ? ? 55 HOH A O 2
HETATM 2138 H H1 . HOH E 5 . ? 18.390 22.540 19.710 1.00 0.00 ? ? ? ? ? ? 55 HOH A H1 2
HETATM 2139 H H2 . HOH E 5 . ? 18.080 22.050 18.190 1.00 0.00 ? ? ? ? ? ? 55 HOH A H2 2
HETATM 2140 O O . HOH E 5 . ? 17.510 34.670 31.650 1.00 0.00 ? ? ? ? ? ? 56 HOH A O 2
HETATM 2141 H H1 . HOH E 5 . ? 16.780 34.430 32.300 1.00 0.00 ? ? ? ? ? ? 56 HOH A H1 2
HETATM 2142 H H2 . HOH E 5 . ? 18.280 34.030 31.770 1.00 0.00 ? ? ? ? ? ? 56 HOH A H2 2
HETATM 2143 O O . HOH E 5 . ? 12.480 37.730 35.190 1.00 0.00 ? ? ? ? ? ? 57 HOH A O 2
HETATM 2144 H H1 . HOH E 5 . ? 11.660 38.290 35.330 1.00 0.00 ? ? ? ? ? ? 57 HOH A H1 2
HETATM 2145 H H2 . HOH E 5 . ? 12.660 37.180 36.010 1.00 0.00 ? ? ? ? ? ? 57 HOH A H2 2
HETATM 2146 O O . HOH E 5 . ? 16.160 29.790 32.320 1.00 0.00 ? ? ? ? ? ? 58 HOH A O 2
HETATM 2147 H H1 . HOH E 5 . ? 15.800 30.370 31.600 1.00 0.00 ? ? ? ? ? ? 58 HOH A H1 2
HETATM 2148 H H2 . HOH E 5 . ? 16.960 30.230 32.740 1.00 0.00 ? ? ? ? ? ? 58 HOH A H2 2
HETATM 2149 O O . HOH E 5 . ? 10.310 32.330 35.810 1.00 0.00 ? ? ? ? ? ? 59 HOH A O 2
HETATM 2150 H H1 . HOH E 5 . ? 10.750 33.150 36.170 1.00 0.00 ? ? ? ? ? ? 59 HOH A H1 2
HETATM 2151 H H2 . HOH E 5 . ? 9.390 32.250 36.210 1.00 0.00 ? ? ? ? ? ? 59 HOH A H2 2
HETATM 2152 O O . HOH E 5 . ? 13.440 27.020 35.920 1.00 0.00 ? ? ? ? ? ? 60 HOH A O 2
HETATM 2153 H H1 . HOH E 5 . ? 12.570 26.630 35.610 1.00 0.00 ? ? ? ? ? ? 60 HOH A H1 2
HETATM 2154 H H2 . HOH E 5 . ? 13.880 27.490 35.150 1.00 0.00 ? ? ? ? ? ? 60 HOH A H2 2
HETATM 2155 O O . HOH E 5 . ? 11.610 22.860 32.990 1.00 0.00 ? ? ? ? ? ? 61 HOH A O 2
HETATM 2156 H H1 . HOH E 5 . ? 11.460 23.770 32.600 1.00 0.00 ? ? ? ? ? ? 61 HOH A H1 2
HETATM 2157 H H2 . HOH E 5 . ? 11.240 22.170 32.370 1.00 0.00 ? ? ? ? ? ? 61 HOH A H2 2
HETATM 2158 O O . HOH E 5 . ? 25.560 17.840 14.880 1.00 0.00 ? ? ? ? ? ? 62 HOH A O 2
HETATM 2159 H H1 . HOH E 5 . ? 25.370 17.600 15.830 1.00 0.00 ? ? ? ? ? ? 62 HOH A H1 2
HETATM 2160 H H2 . HOH E 5 . ? 25.980 17.060 14.410 1.00 0.00 ? ? ? ? ? ? 62 HOH A H2 2
HETATM 2161 O O . HOH E 5 . ? 13.250 24.000 34.990 1.00 0.00 ? ? ? ? ? ? 63 HOH A O 2
HETATM 2162 H H1 . HOH E 5 . ? 12.720 24.250 35.790 1.00 0.00 ? ? ? ? ? ? 63 HOH A H1 2
HETATM 2163 H H2 . HOH E 5 . ? 12.620 23.810 34.230 1.00 0.00 ? ? ? ? ? ? 63 HOH A H2 2
HETATM 2164 O O . HOH E 5 . ? 24.050 20.340 30.530 1.00 0.00 ? ? ? ? ? ? 64 HOH A O 2
HETATM 2165 H H1 . HOH E 5 . ? 24.730 19.610 30.440 1.00 0.00 ? ? ? ? ? ? 64 HOH A H1 2
HETATM 2166 H H2 . HOH E 5 . ? 24.450 21.110 31.030 1.00 0.00 ? ? ? ? ? ? 64 HOH A H2 2
HETATM 2167 O O . HOH E 5 . ? 14.320 28.110 33.490 1.00 0.00 ? ? ? ? ? ? 65 HOH A O 2
HETATM 2168 H H1 . HOH E 5 . ? 15.000 28.780 33.200 1.00 0.00 ? ? ? ? ? ? 65 HOH A H1 2
HETATM 2169 H H2 . HOH E 5 . ? 13.460 28.280 33.010 1.00 0.00 ? ? ? ? ? ? 65 HOH A H2 2
HETATM 2170 O O . HOH E 5 . ? 23.030 32.690 32.190 1.00 0.00 ? ? ? ? ? ? 66 HOH A O 2
HETATM 2171 H H1 . HOH E 5 . ? 22.060 32.740 32.400 1.00 0.00 ? ? ? ? ? ? 66 HOH A H1 2
HETATM 2172 H H2 . HOH E 5 . ? 23.430 33.610 32.220 1.00 0.00 ? ? ? ? ? ? 66 HOH A H2 2
HETATM 2173 O O . HOH E 5 . ? 23.740 26.650 33.310 1.00 0.00 ? ? ? ? ? ? 67 HOH A O 2
HETATM 2174 H H1 . HOH E 5 . ? 24.190 27.140 34.060 1.00 0.00 ? ? ? ? ? ? 67 HOH A H1 2
HETATM 2175 H H2 . HOH E 5 . ? 24.280 25.840 33.070 1.00 0.00 ? ? ? ? ? ? 67 HOH A H2 2
HETATM 2176 O O . HOH E 5 . ? 25.600 20.490 24.090 1.00 0.00 ? ? ? ? ? ? 68 HOH A O 2
HETATM 2177 H H1 . HOH E 5 . ? 26.180 20.550 23.270 1.00 0.00 ? ? ? ? ? ? 68 HOH A H1 2
HETATM 2178 H H2 . HOH E 5 . ? 24.750 21.000 23.930 1.00 0.00 ? ? ? ? ? ? 68 HOH A H2 2
HETATM 2179 O O . HOH E 5 . ? 15.450 38.970 37.560 1.00 0.00 ? ? ? ? ? ? 69 HOH A O 2
HETATM 2180 H H1 . HOH E 5 . ? 15.090 39.190 38.470 1.00 0.00 ? ? ? ? ? ? 69 HOH A H1 2
HETATM 2181 H H2 . HOH E 5 . ? 14.710 38.630 36.980 1.00 0.00 ? ? ? ? ? ? 69 HOH A H2 2
HETATM 2182 O O . HOH E 5 . ? 10.170 21.260 31.180 1.00 0.00 ? ? ? ? ? ? 70 HOH A O 2
HETATM 2183 H H1 . HOH E 5 . ? 9.830 20.890 30.320 1.00 0.00 ? ? ? ? ? ? 70 HOH A H1 2
HETATM 2184 H H2 . HOH E 5 . ? 10.190 20.530 31.870 1.00 0.00 ? ? ? ? ? ? 70 HOH A H2 2
HETATM 2185 O O . HOH F 5 . ? 10.310 28.620 40.780 1.00 0.00 ? ? ? ? ? ? 1032 HOH B O 2
HETATM 2186 H H1 . HOH F 5 . ? 10.500 28.310 41.720 1.00 0.00 ? ? ? ? ? ? 1032 HOH B H1 2
HETATM 2187 H H2 . HOH F 5 . ? 10.350 29.620 40.750 1.00 0.00 ? ? ? ? ? ? 1032 HOH B H2 2
HETATM 2188 O O . HOH F 5 . ? 20.350 36.610 34.330 1.00 0.00 ? ? ? ? ? ? 1584 HOH B O 2
HETATM 2189 H H1 . HOH F 5 . ? 20.260 35.680 33.950 1.00 0.00 ? ? ? ? ? ? 1584 HOH B H1 2
HETATM 2190 H H2 . HOH F 5 . ? 21.170 37.040 33.970 1.00 0.00 ? ? ? ? ? ? 1584 HOH B H2 2
HETATM 2191 O O . HOH F 5 . ? 17.340 37.240 36.200 1.00 0.00 ? ? ? ? ? ? 1619 HOH B O 2
HETATM 2192 H H1 . HOH F 5 . ? 17.030 37.910 36.870 1.00 0.00 ? ? ? ? ? ? 1619 HOH B H1 2
HETATM 2193 H H2 . HOH F 5 . ? 16.640 36.540 36.090 1.00 0.00 ? ? ? ? ? ? 1619 HOH B H2 2
HETATM 2194 O O . HOH F 5 . ? 24.200 17.380 30.380 1.00 0.00 ? ? ? ? ? ? 1904 HOH B O 2
HETATM 2195 H H1 . HOH F 5 . ? 24.750 17.450 29.550 1.00 0.00 ? ? ? ? ? ? 1904 HOH B H1 2
HETATM 2196 H H2 . HOH F 5 . ? 23.620 18.190 30.460 1.00 0.00 ? ? ? ? ? ? 1904 HOH B H2 2
HETATM 2197 O O . HOH F 5 . ? 25.960 22.390 31.380 1.00 0.00 ? ? ? ? ? ? 2484 HOH B O 2
HETATM 2198 H H1 . HOH F 5 . ? 26.820 22.410 31.890 1.00 0.00 ? ? ? ? ? ? 2484 HOH B H1 2
HETATM 2199 H H2 . HOH F 5 . ? 26.150 22.240 30.410 1.00 0.00 ? ? ? ? ? ? 2484 HOH B H2 2
HETATM 2200 O O . HOH F 5 . ? 26.950 27.600 32.130 1.00 0.00 ? ? ? ? ? ? 2496 HOH B O 2
HETATM 2201 H H1 . HOH F 5 . ? 26.510 28.190 32.810 1.00 0.00 ? ? ? ? ? ? 2496 HOH B H1 2
HETATM 2202 H H2 . HOH F 5 . ? 26.560 26.680 32.180 1.00 0.00 ? ? ? ? ? ? 2496 HOH B H2 2
HETATM 2203 O O . HOH F 5 . ? 25.640 24.890 32.750 1.00 0.00 ? ? ? ? ? ? 2514 HOH B O 2
HETATM 2204 H H1 . HOH F 5 . ? 26.270 24.580 33.470 1.00 0.00 ? ? ? ? ? ? 2514 HOH B H1 2
HETATM 2205 H H2 . HOH F 5 . ? 25.480 24.140 32.110 1.00 0.00 ? ? ? ? ? ? 2514 HOH B H2 2
HETATM 2206 O O . HOH F 5 . ? 10.310 33.430 38.870 1.00 0.00 ? ? ? ? ? ? 2963 HOH B O 2
HETATM 2207 H H1 . HOH F 5 . ? 10.550 34.070 39.600 1.00 0.00 ? ? ? ? ? ? 2963 HOH B H1 2
HETATM 2208 H H2 . HOH F 5 . ? 9.320 33.440 38.740 1.00 0.00 ? ? ? ? ? ? 2963 HOH B H2 2
HETATM 2209 O O . HOH F 5 . ? 25.390 32.260 33.890 1.00 0.00 ? ? ? ? ? ? 3222 HOH B O 2
HETATM 2210 H H1 . HOH F 5 . ? 24.600 32.300 33.280 1.00 0.00 ? ? ? ? ? ? 3222 HOH B H1 2
HETATM 2211 H H2 . HOH F 5 . ? 25.560 31.310 34.150 1.00 0.00 ? ? ? ? ? ? 3222 HOH B H2 2
HETATM 2212 O O . HOH F 5 . ? 10.450 31.430 41.030 1.00 0.00 ? ? ? ? ? ? 3303 HOH B O 2
HETATM 2213 H H1 . HOH F 5 . ? 10.580 32.020 41.830 1.00 0.00 ? ? ? ? ? ? 3303 HOH B H1 2
HETATM 2214 H H2 . HOH F 5 . ? 10.360 32.000 40.210 1.00 0.00 ? ? ? ? ? ? 3303 HOH B H2 2
HETATM 2215 O O . HOH G 5 . ? 9.180 20.100 28.640 1.00 0.00 ? ? ? ? ? ? 317 HOH C O 2
HETATM 2216 H H1 . HOH G 5 . ? 10.000 19.740 28.200 1.00 0.00 ? ? ? ? ? ? 317 HOH C H1 2
HETATM 2217 H H2 . HOH G 5 . ? 8.780 19.390 29.230 1.00 0.00 ? ? ? ? ? ? 317 HOH C H2 2
HETATM 2218 O O . HOH G 5 . ? 18.700 15.530 18.720 1.00 0.00 ? ? ? ? ? ? 327 HOH C O 2
HETATM 2219 H H1 . HOH G 5 . ? 18.930 16.340 19.260 1.00 0.00 ? ? ? ? ? ? 327 HOH C H1 2
HETATM 2220 H H2 . HOH G 5 . ? 18.290 15.810 17.860 1.00 0.00 ? ? ? ? ? ? 327 HOH C H2 2
HETATM 2221 O O . HOH G 5 . ? 19.370 17.630 20.250 1.00 0.00 ? ? ? ? ? ? 328 HOH C O 2
HETATM 2222 H H1 . HOH G 5 . ? 18.660 17.720 20.950 1.00 0.00 ? ? ? ? ? ? 328 HOH C H1 2
HETATM 2223 H H2 . HOH G 5 . ? 20.180 18.150 20.540 1.00 0.00 ? ? ? ? ? ? 328 HOH C H2 2
HETATM 2224 O O . HOH G 5 . ? 7.540 20.510 25.950 1.00 0.00 ? ? ? ? ? ? 827 HOH C O 2
HETATM 2225 H H1 . HOH G 5 . ? 8.410 20.890 26.280 1.00 0.00 ? ? ? ? ? ? 827 HOH C H1 2
HETATM 2226 H H2 . HOH G 5 . ? 7.680 19.540 25.710 1.00 0.00 ? ? ? ? ? ? 827 HOH C H2 2
HETATM 2227 O O . HOH G 5 . ? 28.930 16.400 17.250 1.00 0.00 ? ? ? ? ? ? 845 HOH C O 2
HETATM 2228 H H1 . HOH G 5 . ? 29.030 17.390 17.300 1.00 0.00 ? ? ? ? ? ? 845 HOH C H1 2
HETATM 2229 H H2 . HOH G 5 . ? 29.790 15.970 17.510 1.00 0.00 ? ? ? ? ? ? 845 HOH C H2 2
HETATM 2230 O O . HOH G 5 . ? 18.220 25.060 20.920 1.00 0.00 ? ? ? ? ? ? 923 HOH C O 2
HETATM 2231 H H1 . HOH G 5 . ? 17.680 24.720 21.690 1.00 0.00 ? ? ? ? ? ? 923 HOH C H1 2
HETATM 2232 H H2 . HOH G 5 . ? 19.190 24.890 21.090 1.00 0.00 ? ? ? ? ? ? 923 HOH C H2 2
HETATM 2233 O O . HOH G 5 . ? 14.110 25.370 38.310 1.00 0.00 ? ? ? ? ? ? 952 HOH C O 2
HETATM 2234 H H1 . HOH G 5 . ? 13.490 24.600 38.150 1.00 0.00 ? ? ? ? ? ? 952 HOH C H1 2
HETATM 2235 H H2 . HOH G 5 . ? 13.870 26.120 37.690 1.00 0.00 ? ? ? ? ? ? 952 HOH C H2 2
HETATM 2236 O O . HOH G 5 . ? 10.170 22.880 23.630 1.00 0.00 ? ? ? ? ? ? 1002 HOH C O 2
HETATM 2237 H H1 . HOH G 5 . ? 10.500 22.380 22.820 1.00 0.00 ? ? ? ? ? ? 1002 HOH C H1 2
HETATM 2238 H H2 . HOH G 5 . ? 10.420 22.370 24.450 1.00 0.00 ? ? ? ? ? ? 1002 HOH C H2 2
HETATM 2239 O O . HOH G 5 . ? 15.760 19.980 19.340 1.00 0.00 ? ? ? ? ? ? 1419 HOH C O 2
HETATM 2240 H H1 . HOH G 5 . ? 15.850 20.300 20.290 1.00 0.00 ? ? ? ? ? ? 1419 HOH C H1 2
HETATM 2241 H H2 . HOH G 5 . ? 14.920 20.360 18.950 1.00 0.00 ? ? ? ? ? ? 1419 HOH C H2 2
HETATM 2242 O O . HOH G 5 . ? 31.010 19.980 14.940 1.00 0.00 ? ? ? ? ? ? 1771 HOH C O 2
HETATM 2243 H H1 . HOH G 5 . ? 30.230 20.380 15.430 1.00 0.00 ? ? ? ? ? ? 1771 HOH C H1 2
HETATM 2244 H H2 . HOH G 5 . ? 31.470 19.330 15.540 1.00 0.00 ? ? ? ? ? ? 1771 HOH C H2 2
HETATM 2245 O O . HOH G 5 . ? 29.700 22.480 21.810 1.00 0.00 ? ? ? ? ? ? 1817 HOH C O 2
HETATM 2246 H H1 . HOH G 5 . ? 30.090 23.400 21.780 1.00 0.00 ? ? ? ? ? ? 1817 HOH C H1 2
HETATM 2247 H H2 . HOH G 5 . ? 29.600 22.130 20.880 1.00 0.00 ? ? ? ? ? ? 1817 HOH C H2 2
HETATM 2248 O O . HOH G 5 . ? 29.040 19.060 23.620 1.00 0.00 ? ? ? ? ? ? 1958 HOH C O 2
HETATM 2249 H H1 . HOH G 5 . ? 28.510 19.640 23.000 1.00 0.00 ? ? ? ? ? ? 1958 HOH C H1 2
HETATM 2250 H H2 . HOH G 5 . ? 28.590 19.020 24.510 1.00 0.00 ? ? ? ? ? ? 1958 HOH C H2 2
HETATM 2251 O O . HOH G 5 . ? 25.720 18.250 28.220 1.00 0.00 ? ? ? ? ? ? 1961 HOH C O 2
HETATM 2252 H H1 . HOH G 5 . ? 26.120 19.150 28.410 1.00 0.00 ? ? ? ? ? ? 1961 HOH C H1 2
HETATM 2253 H H2 . HOH G 5 . ? 26.430 17.660 27.830 1.00 0.00 ? ? ? ? ? ? 1961 HOH C H2 2
HETATM 2254 O O . HOH G 5 . ? 30.890 23.360 17.030 1.00 0.00 ? ? ? ? ? ? 2011 HOH C O 2
HETATM 2255 H H1 . HOH G 5 . ? 30.500 22.880 17.830 1.00 0.00 ? ? ? ? ? ? 2011 HOH C H1 2
HETATM 2256 H H2 . HOH G 5 . ? 30.150 23.640 16.430 1.00 0.00 ? ? ? ? ? ? 2011 HOH C H2 2
HETATM 2257 O O . HOH G 5 . ? 23.550 22.330 23.470 1.00 0.00 ? ? ? ? ? ? 2471 HOH C O 2
HETATM 2258 H H1 . HOH G 5 . ? 22.610 22.570 23.220 1.00 0.00 ? ? ? ? ? ? 2471 HOH C H1 2
HETATM 2259 H H2 . HOH G 5 . ? 24.180 22.730 22.810 1.00 0.00 ? ? ? ? ? ? 2471 HOH C H2 2
HETATM 2260 O O . HOH G 5 . ? 27.480 20.700 21.920 1.00 0.00 ? ? ? ? ? ? 2570 HOH C O 2
HETATM 2261 H H1 . HOH G 5 . ? 27.300 20.490 20.960 1.00 0.00 ? ? ? ? ? ? 2570 HOH C H1 2
HETATM 2262 H H2 . HOH G 5 . ? 28.120 21.470 21.970 1.00 0.00 ? ? ? ? ? ? 2570 HOH C H2 2
ATOM 2263 O "O5'" . DA A 1 1 ? 7.850 31.870 48.800 1.00 0.00 ? ? ? ? ? ? 1 DA B "O5'" 3
ATOM 2264 C "C5'" . DA A 1 1 ? 7.900 31.760 47.370 1.00 0.00 ? ? ? ? ? ? 1 DA B "C5'" 3
ATOM 2265 C "C4'" . DA A 1 1 ? 9.300 31.550 46.800 1.00 0.00 ? ? ? ? ? ? 1 DA B "C4'" 3
ATOM 2266 O "O4'" . DA A 1 1 ? 10.200 30.670 47.500 1.00 0.00 ? ? ? ? ? ? 1 DA B "O4'" 3
ATOM 2267 C "C3'" . DA A 1 1 ? 9.200 31.020 45.380 1.00 0.00 ? ? ? ? ? ? 1 DA B "C3'" 3
ATOM 2268 O "O3'" . DA A 1 1 ? 9.670 32.030 44.480 1.00 0.00 ? ? ? ? ? ? 1 DA B "O3'" 3
ATOM 2269 C "C2'" . DA A 1 1 ? 10.030 29.770 45.340 1.00 0.00 ? ? ? ? ? ? 1 DA B "C2'" 3
ATOM 2270 C "C1'" . DA A 1 1 ? 11.000 30.210 46.410 1.00 0.00 ? ? ? ? ? ? 1 DA B "C1'" 3
ATOM 2271 N N9 . DA A 1 1 ? 11.900 29.180 46.870 1.00 0.00 ? ? ? ? ? ? 1 DA B N9 3
ATOM 2272 C C8 . DA A 1 1 ? 11.620 27.890 47.020 1.00 0.00 ? ? ? ? ? ? 1 DA B C8 3
ATOM 2273 N N7 . DA A 1 1 ? 12.680 27.270 47.540 1.00 0.00 ? ? ? ? ? ? 1 DA B N7 3
ATOM 2274 C C5 . DA A 1 1 ? 13.620 28.200 47.710 1.00 0.00 ? ? ? ? ? ? 1 DA B C5 3
ATOM 2275 C C6 . DA A 1 1 ? 14.900 28.250 48.260 1.00 0.00 ? ? ? ? ? ? 1 DA B C6 3
ATOM 2276 N N6 . DA A 1 1 ? 15.490 27.150 48.660 1.00 0.00 ? ? ? ? ? ? 1 DA B N6 3
ATOM 2277 N N1 . DA A 1 1 ? 15.610 29.400 48.300 1.00 0.00 ? ? ? ? ? ? 1 DA B N1 3
ATOM 2278 C C2 . DA A 1 1 ? 15.110 30.540 47.820 1.00 0.00 ? ? ? ? ? ? 1 DA B C2 3
ATOM 2279 N N3 . DA A 1 1 ? 13.880 30.540 47.310 1.00 0.00 ? ? ? ? ? ? 1 DA B N3 3
ATOM 2280 C C4 . DA A 1 1 ? 13.130 29.410 47.260 1.00 0.00 ? ? ? ? ? ? 1 DA B C4 3
ATOM 2281 H H61 . DA A 1 1 ? 16.330 27.200 49.200 1.00 0.00 ? ? ? ? ? ? 1 DA B H61 3
ATOM 2282 H H62 . DA A 1 1 ? 15.260 26.290 48.200 1.00 0.00 ? ? ? ? ? ? 1 DA B H62 3
ATOM 2283 H "HO5'" . DA A 1 1 ? 7.700 32.850 49.090 1.00 0.00 ? ? ? ? ? ? 1 DA B "HO5'" 3
ATOM 2284 P P . DA A 1 2 ? 9.150 32.050 42.970 1.00 0.00 ? ? ? ? ? ? 2 DA B P 3
ATOM 2285 O OP1 . DA A 1 2 ? 7.990 32.960 42.850 1.00 0.00 ? ? ? ? ? ? 2 DA B OP1 3
ATOM 2286 O OP2 . DA A 1 2 ? 8.900 30.660 42.510 1.00 0.00 ? ? ? ? ? ? 2 DA B OP2 3
ATOM 2287 O "O5'" . DA A 1 2 ? 10.470 32.550 42.230 1.00 0.00 ? ? ? ? ? ? 2 DA B "O5'" 3
ATOM 2288 C "C5'" . DA A 1 2 ? 10.870 33.930 42.340 1.00 0.00 ? ? ? ? ? ? 2 DA B "C5'" 3
ATOM 2289 C "C4'" . DA A 1 2 ? 12.350 34.160 42.010 1.00 0.00 ? ? ? ? ? ? 2 DA B "C4'" 3
ATOM 2290 O "O4'" . DA A 1 2 ? 13.130 33.300 42.870 1.00 0.00 ? ? ? ? ? ? 2 DA B "O4'" 3
ATOM 2291 C "C3'" . DA A 1 2 ? 12.670 33.760 40.570 1.00 0.00 ? ? ? ? ? ? 2 DA B "C3'" 3
ATOM 2292 O "O3'" . DA A 1 2 ? 13.520 34.620 39.790 1.00 0.00 ? ? ? ? ? ? 2 DA B "O3'" 3
ATOM 2293 C "C2'" . DA A 1 2 ? 13.250 32.370 40.700 1.00 0.00 ? ? ? ? ? ? 2 DA B "C2'" 3
ATOM 2294 C "C1'" . DA A 1 2 ? 13.920 32.390 42.070 1.00 0.00 ? ? ? ? ? ? 2 DA B "C1'" 3
ATOM 2295 N N9 . DA A 1 2 ? 13.900 31.060 42.730 1.00 0.00 ? ? ? ? ? ? 2 DA B N9 3
ATOM 2296 C C8 . DA A 1 2 ? 12.800 30.340 42.990 1.00 0.00 ? ? ? ? ? ? 2 DA B C8 3
ATOM 2297 N N7 . DA A 1 2 ? 13.130 29.220 43.650 1.00 0.00 ? ? ? ? ? ? 2 DA B N7 3
ATOM 2298 C C5 . DA A 1 2 ? 14.450 29.210 43.810 1.00 0.00 ? ? ? ? ? ? 2 DA B C5 3
ATOM 2299 C C6 . DA A 1 2 ? 15.420 28.420 44.460 1.00 0.00 ? ? ? ? ? ? 2 DA B C6 3
ATOM 2300 N N6 . DA A 1 2 ? 15.240 27.200 44.920 1.00 0.00 ? ? ? ? ? ? 2 DA B N6 3
ATOM 2301 N N1 . DA A 1 2 ? 16.710 28.800 44.550 1.00 0.00 ? ? ? ? ? ? 2 DA B N1 3
ATOM 2302 C C2 . DA A 1 2 ? 17.120 29.950 44.010 1.00 0.00 ? ? ? ? ? ? 2 DA B C2 3
ATOM 2303 N N3 . DA A 1 2 ? 16.250 30.710 43.350 1.00 0.00 ? ? ? ? ? ? 2 DA B N3 3
ATOM 2304 C C4 . DA A 1 2 ? 14.930 30.390 43.240 1.00 0.00 ? ? ? ? ? ? 2 DA B C4 3
ATOM 2305 H H61 . DA A 1 2 ? 16.000 26.710 45.370 1.00 0.00 ? ? ? ? ? ? 2 DA B H61 3
ATOM 2306 H H62 . DA A 1 2 ? 14.350 26.740 44.860 1.00 0.00 ? ? ? ? ? ? 2 DA B H62 3
ATOM 2307 P P . DT A 1 3 ? 13.250 34.690 38.200 1.00 0.00 ? ? ? ? ? ? 3 DT B P 3
ATOM 2308 O OP1 . DT A 1 3 ? 12.620 36.010 37.990 1.00 0.00 ? ? ? ? ? ? 3 DT B OP1 3
ATOM 2309 O OP2 . DT A 1 3 ? 12.510 33.480 37.750 1.00 0.00 ? ? ? ? ? ? 3 DT B OP2 3
ATOM 2310 O "O5'" . DT A 1 3 ? 14.700 34.750 37.510 1.00 0.00 ? ? ? ? ? ? 3 DT B "O5'" 3
ATOM 2311 C "C5'" . DT A 1 3 ? 15.270 33.610 36.840 1.00 0.00 ? ? ? ? ? ? 3 DT B "C5'" 3
ATOM 2312 C "C4'" . DT A 1 3 ? 16.480 32.990 37.540 1.00 0.00 ? ? ? ? ? ? 3 DT B "C4'" 3
ATOM 2313 O "O4'" . DT A 1 3 ? 16.200 32.300 38.780 1.00 0.00 ? ? ? ? ? ? 3 DT B "O4'" 3
ATOM 2314 C "C3'" . DT A 1 3 ? 17.140 31.960 36.660 1.00 0.00 ? ? ? ? ? ? 3 DT B "C3'" 3
ATOM 2315 O "O3'" . DT A 1 3 ? 17.930 32.620 35.660 1.00 0.00 ? ? ? ? ? ? 3 DT B "O3'" 3
ATOM 2316 C "C2'" . DT A 1 3 ? 18.050 31.310 37.690 1.00 0.00 ? ? ? ? ? ? 3 DT B "C2'" 3
ATOM 2317 C "C1'" . DT A 1 3 ? 17.330 31.440 39.020 1.00 0.00 ? ? ? ? ? ? 3 DT B "C1'" 3
ATOM 2318 N N1 . DT A 1 3 ? 16.880 30.140 39.610 1.00 0.00 ? ? ? ? ? ? 3 DT B N1 3
ATOM 2319 C C2 . DT A 1 3 ? 17.790 29.340 40.350 1.00 0.00 ? ? ? ? ? ? 3 DT B C2 3
ATOM 2320 O O2 . DT A 1 3 ? 19.000 29.370 40.150 1.00 0.00 ? ? ? ? ? ? 3 DT B O2 3
ATOM 2321 N N3 . DT A 1 3 ? 17.330 28.240 41.060 1.00 0.00 ? ? ? ? ? ? 3 DT B N3 3
ATOM 2322 C C4 . DT A 1 3 ? 15.990 27.880 40.970 1.00 0.00 ? ? ? ? ? ? 3 DT B C4 3
ATOM 2323 O O4 . DT A 1 3 ? 15.610 26.960 41.690 1.00 0.00 ? ? ? ? ? ? 3 DT B O4 3
ATOM 2324 C C5 . DT A 1 3 ? 15.070 28.610 40.210 1.00 0.00 ? ? ? ? ? ? 3 DT B C5 3
ATOM 2325 C C7 . DT A 1 3 ? 13.700 28.010 39.860 1.00 0.00 ? ? ? ? ? ? 3 DT B C7 3
ATOM 2326 C C6 . DT A 1 3 ? 15.510 29.770 39.560 1.00 0.00 ? ? ? ? ? ? 3 DT B C6 3
ATOM 2327 H H3 . DT A 1 3 ? 17.920 27.790 41.730 1.00 0.00 ? ? ? ? ? ? 3 DT B H3 3
ATOM 2328 P P . DT A 1 4 ? 18.620 31.900 34.410 1.00 0.00 ? ? ? ? ? ? 4 DT B P 3
ATOM 2329 O OP1 . DT A 1 4 ? 19.280 33.010 33.700 1.00 0.00 ? ? ? ? ? ? 4 DT B OP1 3
ATOM 2330 O OP2 . DT A 1 4 ? 17.640 31.110 33.640 1.00 0.00 ? ? ? ? ? ? 4 DT B OP2 3
ATOM 2331 O "O5'" . DT A 1 4 ? 19.770 30.920 34.990 1.00 0.00 ? ? ? ? ? ? 4 DT B "O5'" 3
ATOM 2332 C "C5'" . DT A 1 4 ? 20.960 31.410 35.650 1.00 0.00 ? ? ? ? ? ? 4 DT B "C5'" 3
ATOM 2333 C "C4'" . DT A 1 4 ? 21.880 30.340 36.230 1.00 0.00 ? ? ? ? ? ? 4 DT B "C4'" 3
ATOM 2334 O "O4'" . DT A 1 4 ? 21.240 29.420 37.140 1.00 0.00 ? ? ? ? ? ? 4 DT B "O4'" 3
ATOM 2335 C "C3'" . DT A 1 4 ? 22.590 29.450 35.230 1.00 0.00 ? ? ? ? ? ? 4 DT B "C3'" 3
ATOM 2336 O "O3'" . DT A 1 4 ? 23.970 29.340 35.680 1.00 0.00 ? ? ? ? ? ? 4 DT B "O3'" 3
ATOM 2337 C "C2'" . DT A 1 4 ? 21.790 28.180 35.160 1.00 0.00 ? ? ? ? ? ? 4 DT B "C2'" 3
ATOM 2338 C "C1'" . DT A 1 4 ? 21.220 28.110 36.560 1.00 0.00 ? ? ? ? ? ? 4 DT B "C1'" 3
ATOM 2339 N N1 . DT A 1 4 ? 19.800 27.680 36.640 1.00 0.00 ? ? ? ? ? ? 4 DT B N1 3
ATOM 2340 C C2 . DT A 1 4 ? 19.450 26.970 37.790 1.00 0.00 ? ? ? ? ? ? 4 DT B C2 3
ATOM 2341 O O2 . DT A 1 4 ? 20.270 26.460 38.540 1.00 0.00 ? ? ? ? ? ? 4 DT B O2 3
ATOM 2342 N N3 . DT A 1 4 ? 18.110 26.850 38.130 1.00 0.00 ? ? ? ? ? ? 4 DT B N3 3
ATOM 2343 C C4 . DT A 1 4 ? 17.130 27.410 37.330 1.00 0.00 ? ? ? ? ? ? 4 DT B C4 3
ATOM 2344 O O4 . DT A 1 4 ? 15.980 27.200 37.710 1.00 0.00 ? ? ? ? ? ? 4 DT B O4 3
ATOM 2345 C C5 . DT A 1 4 ? 17.440 28.110 36.160 1.00 0.00 ? ? ? ? ? ? 4 DT B C5 3
ATOM 2346 C C7 . DT A 1 4 ? 16.330 28.690 35.280 1.00 0.00 ? ? ? ? ? ? 4 DT B C7 3
ATOM 2347 C C6 . DT A 1 4 ? 18.790 28.230 35.810 1.00 0.00 ? ? ? ? ? ? 4 DT B C6 3
ATOM 2348 H H3 . DT A 1 4 ? 17.860 26.190 38.840 1.00 0.00 ? ? ? ? ? ? 4 DT B H3 3
ATOM 2349 P P . DG A 1 5 ? 25.160 28.750 34.770 1.00 0.00 ? ? ? ? ? ? 5 DG B P 3
ATOM 2350 O OP1 . DG A 1 5 ? 26.460 29.280 35.250 1.00 0.00 ? ? ? ? ? ? 5 DG B OP1 3
ATOM 2351 O OP2 . DG A 1 5 ? 24.810 28.960 33.350 1.00 0.00 ? ? ? ? ? ? 5 DG B OP2 3
ATOM 2352 O "O5'" . DG A 1 5 ? 25.080 27.200 35.150 1.00 0.00 ? ? ? ? ? ? 5 DG B "O5'" 3
ATOM 2353 C "C5'" . DG A 1 5 ? 25.230 26.820 36.530 1.00 0.00 ? ? ? ? ? ? 5 DG B "C5'" 3
ATOM 2354 C "C4'" . DG A 1 5 ? 24.650 25.440 36.790 1.00 0.00 ? ? ? ? ? ? 5 DG B "C4'" 3
ATOM 2355 O "O4'" . DG A 1 5 ? 23.220 25.260 36.700 1.00 0.00 ? ? ? ? ? ? 5 DG B "O4'" 3
ATOM 2356 C "C3'" . DG A 1 5 ? 25.250 24.380 35.910 1.00 0.00 ? ? ? ? ? ? 5 DG B "C3'" 3
ATOM 2357 O "O3'" . DG A 1 5 ? 26.070 23.620 36.830 1.00 0.00 ? ? ? ? ? ? 5 DG B "O3'" 3
ATOM 2358 C "C2'" . DG A 1 5 ? 24.100 23.700 35.210 1.00 0.00 ? ? ? ? ? ? 5 DG B "C2'" 3
ATOM 2359 C "C1'" . DG A 1 5 ? 22.990 23.900 36.250 1.00 0.00 ? ? ? ? ? ? 5 DG B "C1'" 3
ATOM 2360 N N9 . DG A 1 5 ? 21.610 23.780 35.750 1.00 0.00 ? ? ? ? ? ? 5 DG B N9 3
ATOM 2361 C C8 . DG A 1 5 ? 21.120 24.570 34.820 1.00 0.00 ? ? ? ? ? ? 5 DG B C8 3
ATOM 2362 N N7 . DG A 1 5 ? 19.790 24.440 34.750 1.00 0.00 ? ? ? ? ? ? 5 DG B N7 3
ATOM 2363 C C5 . DG A 1 5 ? 19.440 23.520 35.650 1.00 0.00 ? ? ? ? ? ? 5 DG B C5 3
ATOM 2364 C C6 . DG A 1 5 ? 18.240 22.870 35.960 1.00 0.00 ? ? ? ? ? ? 5 DG B C6 3
ATOM 2365 O O6 . DG A 1 5 ? 17.200 23.150 35.380 1.00 0.00 ? ? ? ? ? ? 5 DG B O6 3
ATOM 2366 N N1 . DG A 1 5 ? 18.240 21.820 36.870 1.00 0.00 ? ? ? ? ? ? 5 DG B N1 3
ATOM 2367 C C2 . DG A 1 5 ? 19.430 21.420 37.460 1.00 0.00 ? ? ? ? ? ? 5 DG B C2 3
ATOM 2368 N N2 . DG A 1 5 ? 19.410 20.230 38.000 1.00 0.00 ? ? ? ? ? ? 5 DG B N2 3
ATOM 2369 N N3 . DG A 1 5 ? 20.570 22.060 37.180 1.00 0.00 ? ? ? ? ? ? 5 DG B N3 3
ATOM 2370 C C4 . DG A 1 5 ? 20.610 23.090 36.290 1.00 0.00 ? ? ? ? ? ? 5 DG B C4 3
ATOM 2371 H H1 . DG A 1 5 ? 17.380 21.380 37.140 1.00 0.00 ? ? ? ? ? ? 5 DG B H1 3
ATOM 2372 H H21 . DG A 1 5 ? 18.520 19.800 38.230 1.00 0.00 ? ? ? ? ? ? 5 DG B H21 3
ATOM 2373 H H22 . DG A 1 5 ? 20.250 19.730 38.160 1.00 0.00 ? ? ? ? ? ? 5 DG B H22 3
ATOM 2374 P P . DT A 1 6 ? 27.020 22.390 36.430 1.00 0.00 ? ? ? ? ? ? 6 DT B P 3
ATOM 2375 O OP1 . DT A 1 6 ? 28.060 22.220 37.470 1.00 0.00 ? ? ? ? ? ? 6 DT B OP1 3
ATOM 2376 O OP2 . DT A 1 6 ? 27.370 22.520 35.010 1.00 0.00 ? ? ? ? ? ? 6 DT B OP2 3
ATOM 2377 O "O5'" . DT A 1 6 ? 26.040 21.150 36.590 1.00 0.00 ? ? ? ? ? ? 6 DT B "O5'" 3
ATOM 2378 C "C5'" . DT A 1 6 ? 25.450 20.770 37.840 1.00 0.00 ? ? ? ? ? ? 6 DT B "C5'" 3
ATOM 2379 C "C4'" . DT A 1 6 ? 24.400 19.730 37.510 1.00 0.00 ? ? ? ? ? ? 6 DT B "C4'" 3
ATOM 2380 O "O4'" . DT A 1 6 ? 23.340 20.260 36.700 1.00 0.00 ? ? ? ? ? ? 6 DT B "O4'" 3
ATOM 2381 C "C3'" . DT A 1 6 ? 25.000 18.610 36.690 1.00 0.00 ? ? ? ? ? ? 6 DT B "C3'" 3
ATOM 2382 O "O3'" . DT A 1 6 ? 25.280 17.510 37.570 1.00 0.00 ? ? ? ? ? ? 6 DT B "O3'" 3
ATOM 2383 C "C2'" . DT A 1 6 ? 24.060 18.330 35.550 1.00 0.00 ? ? ? ? ? ? 6 DT B "C2'" 3
ATOM 2384 C "C1'" . DT A 1 6 ? 22.840 19.110 36.010 1.00 0.00 ? ? ? ? ? ? 6 DT B "C1'" 3
ATOM 2385 N N1 . DT A 1 6 ? 21.990 19.580 34.910 1.00 0.00 ? ? ? ? ? ? 6 DT B N1 3
ATOM 2386 C C2 . DT A 1 6 ? 20.620 19.290 35.020 1.00 0.00 ? ? ? ? ? ? 6 DT B C2 3
ATOM 2387 O O2 . DT A 1 6 ? 20.230 18.240 35.520 1.00 0.00 ? ? ? ? ? ? 6 DT B O2 3
ATOM 2388 N N3 . DT A 1 6 ? 19.700 20.060 34.320 1.00 0.00 ? ? ? ? ? ? 6 DT B N3 3
ATOM 2389 C C4 . DT A 1 6 ? 20.130 21.060 33.460 1.00 0.00 ? ? ? ? ? ? 6 DT B C4 3
ATOM 2390 O O4 . DT A 1 6 ? 19.250 21.750 32.960 1.00 0.00 ? ? ? ? ? ? 6 DT B O4 3
ATOM 2391 C C5 . DT A 1 6 ? 21.500 21.310 33.260 1.00 0.00 ? ? ? ? ? ? 6 DT B C5 3
ATOM 2392 C C7 . DT A 1 6 ? 21.980 22.170 32.080 1.00 0.00 ? ? ? ? ? ? 6 DT B C7 3
ATOM 2393 C C6 . DT A 1 6 ? 22.420 20.600 34.030 1.00 0.00 ? ? ? ? ? ? 6 DT B C6 3
ATOM 2394 H H3 . DT A 1 6 ? 18.730 19.870 34.420 1.00 0.00 ? ? ? ? ? ? 6 DT B H3 3
ATOM 2395 P P . DG A 1 7 ? 26.020 16.170 37.090 1.00 0.00 ? ? ? ? ? ? 7 DG B P 3
ATOM 2396 O OP1 . DG A 1 7 ? 26.480 15.600 38.380 1.00 0.00 ? ? ? ? ? ? 7 DG B OP1 3
ATOM 2397 O OP2 . DG A 1 7 ? 27.020 16.510 36.050 1.00 0.00 ? ? ? ? ? ? 7 DG B OP2 3
ATOM 2398 O "O5'" . DG A 1 7 ? 24.810 15.370 36.420 1.00 0.00 ? ? ? ? ? ? 7 DG B "O5'" 3
ATOM 2399 C "C5'" . DG A 1 7 ? 23.610 15.000 37.140 1.00 0.00 ? ? ? ? ? ? 7 DG B "C5'" 3
ATOM 2400 C "C4'" . DG A 1 7 ? 22.560 14.450 36.190 1.00 0.00 ? ? ? ? ? ? 7 DG B "C4'" 3
ATOM 2401 O "O4'" . DG A 1 7 ? 22.010 15.510 35.390 1.00 0.00 ? ? ? ? ? ? 7 DG B "O4'" 3
ATOM 2402 C "C3'" . DG A 1 7 ? 23.160 13.480 35.180 1.00 0.00 ? ? ? ? ? ? 7 DG B "C3'" 3
ATOM 2403 O "O3'" . DG A 1 7 ? 22.310 12.320 35.050 1.00 0.00 ? ? ? ? ? ? 7 DG B "O3'" 3
ATOM 2404 C "C2'" . DG A 1 7 ? 23.300 14.280 33.920 1.00 0.00 ? ? ? ? ? ? 7 DG B "C2'" 3
ATOM 2405 C "C1'" . DG A 1 7 ? 21.900 14.920 34.090 1.00 0.00 ? ? ? ? ? ? 7 DG B "C1'" 3
ATOM 2406 N N9 . DG A 1 7 ? 21.510 15.970 33.140 1.00 0.00 ? ? ? ? ? ? 7 DG B N9 3
ATOM 2407 C C8 . DG A 1 7 ? 22.350 16.810 32.550 1.00 0.00 ? ? ? ? ? ? 7 DG B C8 3
ATOM 2408 N N7 . DG A 1 7 ? 21.660 17.780 31.950 1.00 0.00 ? ? ? ? ? ? 7 DG B N7 3
ATOM 2409 C C5 . DG A 1 7 ? 20.380 17.500 32.110 1.00 0.00 ? ? ? ? ? ? 7 DG B C5 3
ATOM 2410 C C6 . DG A 1 7 ? 19.210 18.060 31.590 1.00 0.00 ? ? ? ? ? ? 7 DG B C6 3
ATOM 2411 O O6 . DG A 1 7 ? 19.250 19.070 30.890 1.00 0.00 ? ? ? ? ? ? 7 DG B O6 3
ATOM 2412 N N1 . DG A 1 7 ? 17.980 17.450 31.860 1.00 0.00 ? ? ? ? ? ? 7 DG B N1 3
ATOM 2413 C C2 . DG A 1 7 ? 17.940 16.300 32.640 1.00 0.00 ? ? ? ? ? ? 7 DG B C2 3
ATOM 2414 N N2 . DG A 1 7 ? 16.920 15.490 32.620 1.00 0.00 ? ? ? ? ? ? 7 DG B N2 3
ATOM 2415 N N3 . DG A 1 7 ? 19.070 15.780 33.140 1.00 0.00 ? ? ? ? ? ? 7 DG B N3 3
ATOM 2416 C C4 . DG A 1 7 ? 20.270 16.350 32.880 1.00 0.00 ? ? ? ? ? ? 7 DG B C4 3
ATOM 2417 H H1 . DG A 1 7 ? 17.150 17.800 31.420 1.00 0.00 ? ? ? ? ? ? 7 DG B H1 3
ATOM 2418 H H21 . DG A 1 7 ? 16.020 15.750 32.260 1.00 0.00 ? ? ? ? ? ? 7 DG B H21 3
ATOM 2419 H H22 . DG A 1 7 ? 17.130 14.540 32.900 1.00 0.00 ? ? ? ? ? ? 7 DG B H22 3
ATOM 2420 P P . DA A 1 8 ? 23.020 10.950 34.640 1.00 0.00 ? ? ? ? ? ? 8 DA B P 3
ATOM 2421 O OP1 . DA A 1 8 ? 24.010 10.640 35.700 1.00 0.00 ? ? ? ? ? ? 8 DA B OP1 3
ATOM 2422 O OP2 . DA A 1 8 ? 23.480 11.010 33.240 1.00 0.00 ? ? ? ? ? ? 8 DA B OP2 3
ATOM 2423 O "O5'" . DA A 1 8 ? 21.910 9.780 34.740 1.00 0.00 ? ? ? ? ? ? 8 DA B "O5'" 3
ATOM 2424 C "C5'" . DA A 1 8 ? 20.490 10.020 34.890 1.00 0.00 ? ? ? ? ? ? 8 DA B "C5'" 3
ATOM 2425 C "C4'" . DA A 1 8 ? 19.700 10.400 33.640 1.00 0.00 ? ? ? ? ? ? 8 DA B "C4'" 3
ATOM 2426 O "O4'" . DA A 1 8 ? 19.970 11.710 33.080 1.00 0.00 ? ? ? ? ? ? 8 DA B "O4'" 3
ATOM 2427 C "C3'" . DA A 1 8 ? 19.780 9.400 32.480 1.00 0.00 ? ? ? ? ? ? 8 DA B "C3'" 3
ATOM 2428 O "O3'" . DA A 1 8 ? 18.520 8.720 32.270 1.00 0.00 ? ? ? ? ? ? 8 DA B "O3'" 3
ATOM 2429 C "C2'" . DA A 1 8 ? 20.250 10.250 31.320 1.00 0.00 ? ? ? ? ? ? 8 DA B "C2'" 3
ATOM 2430 C "C1'" . DA A 1 8 ? 19.640 11.580 31.690 1.00 0.00 ? ? ? ? ? ? 8 DA B "C1'" 3
ATOM 2431 N N9 . DA A 1 8 ? 20.230 12.720 30.950 1.00 0.00 ? ? ? ? ? ? 8 DA B N9 3
ATOM 2432 C C8 . DA A 1 8 ? 21.530 12.940 30.770 1.00 0.00 ? ? ? ? ? ? 8 DA B C8 3
ATOM 2433 N N7 . DA A 1 8 ? 21.730 14.080 30.110 1.00 0.00 ? ? ? ? ? ? 8 DA B N7 3
ATOM 2434 C C5 . DA A 1 8 ? 20.520 14.590 29.840 1.00 0.00 ? ? ? ? ? ? 8 DA B C5 3
ATOM 2435 C C6 . DA A 1 8 ? 20.030 15.720 29.190 1.00 0.00 ? ? ? ? ? ? 8 DA B C6 3
ATOM 2436 N N6 . DA A 1 8 ? 20.820 16.630 28.660 1.00 0.00 ? ? ? ? ? ? 8 DA B N6 3
ATOM 2437 N N1 . DA A 1 8 ? 18.700 15.900 29.030 1.00 0.00 ? ? ? ? ? ? 8 DA B N1 3
ATOM 2438 C C2 . DA A 1 8 ? 17.820 15.020 29.500 1.00 0.00 ? ? ? ? ? ? 8 DA B C2 3
ATOM 2439 N N3 . DA A 1 8 ? 18.250 13.940 30.160 1.00 0.00 ? ? ? ? ? ? 8 DA B N3 3
ATOM 2440 C C4 . DA A 1 8 ? 19.570 13.710 30.360 1.00 0.00 ? ? ? ? ? ? 8 DA B C4 3
ATOM 2441 H H61 . DA A 1 8 ? 20.490 17.490 28.260 1.00 0.00 ? ? ? ? ? ? 8 DA B H61 3
ATOM 2442 H H62 . DA A 1 8 ? 21.820 16.420 28.620 1.00 0.00 ? ? ? ? ? ? 8 DA B H62 3
ATOM 2443 P P . DG A 1 9 ? 18.310 7.590 31.130 1.00 0.00 ? ? ? ? ? ? 9 DG B P 3
ATOM 2444 O OP1 . DG A 1 9 ? 17.390 6.530 31.600 1.00 0.00 ? ? ? ? ? ? 9 DG B OP1 3
ATOM 2445 O OP2 . DG A 1 9 ? 19.630 7.150 30.640 1.00 0.00 ? ? ? ? ? ? 9 DG B OP2 3
ATOM 2446 O "O5'" . DG A 1 9 ? 17.550 8.360 29.930 1.00 0.00 ? ? ? ? ? ? 9 DG B "O5'" 3
ATOM 2447 C "C5'" . DG A 1 9 ? 16.230 8.930 30.070 1.00 0.00 ? ? ? ? ? ? 9 DG B "C5'" 3
ATOM 2448 C "C4'" . DG A 1 9 ? 15.680 9.660 28.830 1.00 0.00 ? ? ? ? ? ? 9 DG B "C4'" 3
ATOM 2449 O "O4'" . DG A 1 9 ? 16.430 10.860 28.510 1.00 0.00 ? ? ? ? ? ? 9 DG B "O4'" 3
ATOM 2450 C "C3'" . DG A 1 9 ? 15.770 8.800 27.580 1.00 0.00 ? ? ? ? ? ? 9 DG B "C3'" 3
ATOM 2451 O "O3'" . DG A 1 9 ? 14.640 8.970 26.690 1.00 0.00 ? ? ? ? ? ? 9 DG B "O3'" 3
ATOM 2452 C "C2'" . DG A 1 9 ? 17.090 9.170 27.000 1.00 0.00 ? ? ? ? ? ? 9 DG B "C2'" 3
ATOM 2453 C "C1'" . DG A 1 9 ? 16.960 10.680 27.180 1.00 0.00 ? ? ? ? ? ? 9 DG B "C1'" 3
ATOM 2454 N N9 . DG A 1 9 ? 18.250 11.390 27.130 1.00 0.00 ? ? ? ? ? ? 9 DG B N9 3
ATOM 2455 C C8 . DG A 1 9 ? 19.360 11.020 27.750 1.00 0.00 ? ? ? ? ? ? 9 DG B C8 3
ATOM 2456 N N7 . DG A 1 9 ? 20.310 11.940 27.560 1.00 0.00 ? ? ? ? ? ? 9 DG B N7 3
ATOM 2457 C C5 . DG A 1 9 ? 19.770 12.920 26.820 1.00 0.00 ? ? ? ? ? ? 9 DG B C5 3
ATOM 2458 C C6 . DG A 1 9 ? 20.230 14.150 26.340 1.00 0.00 ? ? ? ? ? ? 9 DG B C6 3
ATOM 2459 O O6 . DG A 1 9 ? 21.420 14.420 26.270 1.00 0.00 ? ? ? ? ? ? 9 DG B O6 3
ATOM 2460 N N1 . DG A 1 9 ? 19.350 15.010 25.670 1.00 0.00 ? ? ? ? ? ? 9 DG B N1 3
ATOM 2461 C C2 . DG A 1 9 ? 18.040 14.610 25.490 1.00 0.00 ? ? ? ? ? ? 9 DG B C2 3
ATOM 2462 N N2 . DG A 1 9 ? 17.290 15.310 24.700 1.00 0.00 ? ? ? ? ? ? 9 DG B N2 3
ATOM 2463 N N3 . DG A 1 9 ? 17.610 13.400 25.890 1.00 0.00 ? ? ? ? ? ? 9 DG B N3 3
ATOM 2464 C C4 . DG A 1 9 ? 18.450 12.570 26.560 1.00 0.00 ? ? ? ? ? ? 9 DG B C4 3
ATOM 2465 H H1 . DG A 1 9 ? 19.710 15.710 25.070 1.00 0.00 ? ? ? ? ? ? 9 DG B H1 3
ATOM 2466 H H21 . DG A 1 9 ? 17.490 16.270 24.440 1.00 0.00 ? ? ? ? ? ? 9 DG B H21 3
ATOM 2467 H H22 . DG A 1 9 ? 16.500 14.850 24.290 1.00 0.00 ? ? ? ? ? ? 9 DG B H22 3
ATOM 2468 P P . DC A 1 10 ? 14.360 7.930 25.490 1.00 0.00 ? ? ? ? ? ? 10 DC B P 3
ATOM 2469 O OP1 . DC A 1 10 ? 12.950 7.480 25.480 1.00 0.00 ? ? ? ? ? ? 10 DC B OP1 3
ATOM 2470 O OP2 . DC A 1 10 ? 15.390 6.870 25.420 1.00 0.00 ? ? ? ? ? ? 10 DC B OP2 3
ATOM 2471 O "O5'" . DC A 1 10 ? 14.640 8.880 24.240 1.00 0.00 ? ? ? ? ? ? 10 DC B "O5'" 3
ATOM 2472 C "C5'" . DC A 1 10 ? 13.620 9.790 23.810 1.00 0.00 ? ? ? ? ? ? 10 DC B "C5'" 3
ATOM 2473 C "C4'" . DC A 1 10 ? 14.050 10.610 22.610 1.00 0.00 ? ? ? ? ? ? 10 DC B "C4'" 3
ATOM 2474 O "O4'" . DC A 1 10 ? 15.140 11.500 22.950 1.00 0.00 ? ? ? ? ? ? 10 DC B "O4'" 3
ATOM 2475 C "C3'" . DC A 1 10 ? 14.530 9.640 21.550 1.00 0.00 ? ? ? ? ? ? 10 DC B "C3'" 3
ATOM 2476 O "O3'" . DC A 1 10 ? 13.940 9.880 20.270 1.00 0.00 ? ? ? ? ? ? 10 DC B "O3'" 3
ATOM 2477 C "C2'" . DC A 1 10 ? 16.010 9.830 21.550 1.00 0.00 ? ? ? ? ? ? 10 DC B "C2'" 3
ATOM 2478 C "C1'" . DC A 1 10 ? 16.120 11.300 21.920 1.00 0.00 ? ? ? ? ? ? 10 DC B "C1'" 3
ATOM 2479 N N1 . DC A 1 10 ? 17.390 11.610 22.610 1.00 0.00 ? ? ? ? ? ? 10 DC B N1 3
ATOM 2480 C C2 . DC A 1 10 ? 18.030 12.860 22.480 1.00 0.00 ? ? ? ? ? ? 10 DC B C2 3
ATOM 2481 O O2 . DC A 1 10 ? 17.680 13.660 21.620 1.00 0.00 ? ? ? ? ? ? 10 DC B O2 3
ATOM 2482 N N3 . DC A 1 10 ? 19.260 13.030 23.030 1.00 0.00 ? ? ? ? ? ? 10 DC B N3 3
ATOM 2483 C C4 . DC A 1 10 ? 19.890 12.020 23.650 1.00 0.00 ? ? ? ? ? ? 10 DC B C4 3
ATOM 2484 N N4 . DC A 1 10 ? 21.130 12.210 24.020 1.00 0.00 ? ? ? ? ? ? 10 DC B N4 3
ATOM 2485 C C5 . DC A 1 10 ? 19.320 10.750 23.810 1.00 0.00 ? ? ? ? ? ? 10 DC B C5 3
ATOM 2486 C C6 . DC A 1 10 ? 18.060 10.570 23.280 1.00 0.00 ? ? ? ? ? ? 10 DC B C6 3
ATOM 2487 H H41 . DC A 1 10 ? 21.570 13.100 23.930 1.00 0.00 ? ? ? ? ? ? 10 DC B H41 3
ATOM 2488 H H42 . DC A 1 10 ? 21.670 11.460 24.420 1.00 0.00 ? ? ? ? ? ? 10 DC B H42 3
ATOM 2489 P P . DG A 1 11 ? 14.040 8.750 19.120 1.00 0.00 ? ? ? ? ? ? 11 DG B P 3
ATOM 2490 O OP1 . DG A 1 11 ? 12.850 8.930 18.260 1.00 0.00 ? ? ? ? ? ? 11 DG B OP1 3
ATOM 2491 O OP2 . DG A 1 11 ? 14.430 7.440 19.690 1.00 0.00 ? ? ? ? ? ? 11 DG B OP2 3
ATOM 2492 O "O5'" . DG A 1 11 ? 15.380 9.170 18.360 1.00 0.00 ? ? ? ? ? ? 11 DG B "O5'" 3
ATOM 2493 C "C5'" . DG A 1 11 ? 15.320 10.350 17.570 1.00 0.00 ? ? ? ? ? ? 11 DG B "C5'" 3
ATOM 2494 C "C4'" . DG A 1 11 ? 16.690 10.940 17.350 1.00 0.00 ? ? ? ? ? ? 11 DG B "C4'" 3
ATOM 2495 O "O4'" . DG A 1 11 ? 17.450 11.130 18.560 1.00 0.00 ? ? ? ? ? ? 11 DG B "O4'" 3
ATOM 2496 C "C3'" . DG A 1 11 ? 17.560 10.110 16.420 1.00 0.00 ? ? ? ? ? ? 11 DG B "C3'" 3
ATOM 2497 O "O3'" . DG A 1 11 ? 17.340 10.500 15.050 1.00 0.00 ? ? ? ? ? ? 11 DG B "O3'" 3
ATOM 2498 C "C2'" . DG A 1 11 ? 18.970 10.410 16.910 1.00 0.00 ? ? ? ? ? ? 11 DG B "C2'" 3
ATOM 2499 C "C1'" . DG A 1 11 ? 18.760 11.420 18.040 1.00 0.00 ? ? ? ? ? ? 11 DG B "C1'" 3
ATOM 2500 N N9 . DG A 1 11 ? 19.800 11.300 19.090 1.00 0.00 ? ? ? ? ? ? 11 DG B N9 3
ATOM 2501 C C8 . DG A 1 11 ? 19.950 10.230 19.860 1.00 0.00 ? ? ? ? ? ? 11 DG B C8 3
ATOM 2502 N N7 . DG A 1 11 ? 21.030 10.350 20.640 1.00 0.00 ? ? ? ? ? ? 11 DG B N7 3
ATOM 2503 C C5 . DG A 1 11 ? 21.620 11.500 20.300 1.00 0.00 ? ? ? ? ? ? 11 DG B C5 3
ATOM 2504 C C6 . DG A 1 11 ? 22.840 12.100 20.630 1.00 0.00 ? ? ? ? ? ? 11 DG B C6 3
ATOM 2505 O O6 . DG A 1 11 ? 23.510 11.720 21.590 1.00 0.00 ? ? ? ? ? ? 11 DG B O6 3
ATOM 2506 N N1 . DG A 1 11 ? 23.250 13.250 19.940 1.00 0.00 ? ? ? ? ? ? 11 DG B N1 3
ATOM 2507 C C2 . DG A 1 11 ? 22.420 13.800 18.980 1.00 0.00 ? ? ? ? ? ? 11 DG B C2 3
ATOM 2508 N N2 . DG A 1 11 ? 22.830 14.820 18.260 1.00 0.00 ? ? ? ? ? ? 11 DG B N2 3
ATOM 2509 N N3 . DG A 1 11 ? 21.240 13.240 18.700 1.00 0.00 ? ? ? ? ? ? 11 DG B N3 3
ATOM 2510 C C4 . DG A 1 11 ? 20.830 12.110 19.320 1.00 0.00 ? ? ? ? ? ? 11 DG B C4 3
ATOM 2511 H "HO3'" . DG A 1 11 ? 17.930 10.160 14.300 1.00 0.00 ? ? ? ? ? ? 11 DG B "HO3'" 3
ATOM 2512 H H1 . DG A 1 11 ? 24.150 13.640 20.140 1.00 0.00 ? ? ? ? ? ? 11 DG B H1 3
ATOM 2513 H H21 . DG A 1 11 ? 23.720 15.230 18.440 1.00 0.00 ? ? ? ? ? ? 11 DG B H21 3
ATOM 2514 H H22 . DG A 1 11 ? 22.290 15.120 17.470 1.00 0.00 ? ? ? ? ? ? 11 DG B H22 3
ATOM 2515 O "O5'" . DC B 2 1 ? 31.690 17.510 19.400 1.00 0.00 ? ? ? ? ? ? 1 DC C "O5'" 3
ATOM 2516 C "C5'" . DC B 2 1 ? 30.410 18.150 19.490 1.00 0.00 ? ? ? ? ? ? 1 DC C "C5'" 3
ATOM 2517 C "C4'" . DC B 2 1 ? 29.450 17.860 18.330 1.00 0.00 ? ? ? ? ? ? 1 DC C "C4'" 3
ATOM 2518 O "O4'" . DC B 2 1 ? 28.900 16.550 18.620 1.00 0.00 ? ? ? ? ? ? 1 DC C "O4'" 3
ATOM 2519 C "C3'" . DC B 2 1 ? 28.270 18.840 18.350 1.00 0.00 ? ? ? ? ? ? 1 DC C "C3'" 3
ATOM 2520 O "O3'" . DC B 2 1 ? 27.840 19.190 17.010 1.00 0.00 ? ? ? ? ? ? 1 DC C "O3'" 3
ATOM 2521 C "C2'" . DC B 2 1 ? 27.230 18.170 19.180 1.00 0.00 ? ? ? ? ? ? 1 DC C "C2'" 3
ATOM 2522 C "C1'" . DC B 2 1 ? 27.490 16.720 18.840 1.00 0.00 ? ? ? ? ? ? 1 DC C "C1'" 3
ATOM 2523 N N1 . DC B 2 1 ? 27.110 15.780 19.910 1.00 0.00 ? ? ? ? ? ? 1 DC C N1 3
ATOM 2524 C C2 . DC B 2 1 ? 26.380 14.630 19.550 1.00 0.00 ? ? ? ? ? ? 1 DC C C2 3
ATOM 2525 O O2 . DC B 2 1 ? 25.650 14.710 18.560 1.00 0.00 ? ? ? ? ? ? 1 DC C O2 3
ATOM 2526 N N3 . DC B 2 1 ? 26.070 13.730 20.500 1.00 0.00 ? ? ? ? ? ? 1 DC C N3 3
ATOM 2527 C C4 . DC B 2 1 ? 26.370 13.960 21.790 1.00 0.00 ? ? ? ? ? ? 1 DC C C4 3
ATOM 2528 N N4 . DC B 2 1 ? 25.790 13.160 22.670 1.00 0.00 ? ? ? ? ? ? 1 DC C N4 3
ATOM 2529 C C5 . DC B 2 1 ? 27.060 15.110 22.220 1.00 0.00 ? ? ? ? ? ? 1 DC C C5 3
ATOM 2530 C C6 . DC B 2 1 ? 27.460 16.010 21.250 1.00 0.00 ? ? ? ? ? ? 1 DC C C6 3
ATOM 2531 H H41 . DC B 2 1 ? 25.110 12.480 22.370 1.00 0.00 ? ? ? ? ? ? 1 DC C H41 3
ATOM 2532 H H42 . DC B 2 1 ? 25.950 13.310 23.650 1.00 0.00 ? ? ? ? ? ? 1 DC C H42 3
ATOM 2533 H "HO5'" . DC B 2 1 ? 31.600 16.480 19.370 1.00 0.00 ? ? ? ? ? ? 1 DC C "HO5'" 3
ATOM 2534 P P . DG B 2 2 ? 27.280 20.660 16.670 1.00 0.00 ? ? ? ? ? ? 2 DG C P 3
ATOM 2535 O OP1 . DG B 2 2 ? 27.280 20.790 15.190 1.00 0.00 ? ? ? ? ? ? 2 DG C OP1 3
ATOM 2536 O OP2 . DG B 2 2 ? 28.090 21.620 17.460 1.00 0.00 ? ? ? ? ? ? 2 DG C OP2 3
ATOM 2537 O "O5'" . DG B 2 2 ? 25.790 20.710 17.270 1.00 0.00 ? ? ? ? ? ? 2 DG C "O5'" 3
ATOM 2538 C "C5'" . DG B 2 2 ? 24.620 20.460 16.470 1.00 0.00 ? ? ? ? ? ? 2 DG C "C5'" 3
ATOM 2539 C "C4'" . DG B 2 2 ? 23.430 20.150 17.350 1.00 0.00 ? ? ? ? ? ? 2 DG C "C4'" 3
ATOM 2540 O "O4'" . DG B 2 2 ? 23.710 19.020 18.190 1.00 0.00 ? ? ? ? ? ? 2 DG C "O4'" 3
ATOM 2541 C "C3'" . DG B 2 2 ? 23.030 21.290 18.270 1.00 0.00 ? ? ? ? ? ? 2 DG C "C3'" 3
ATOM 2542 O "O3'" . DG B 2 2 ? 21.910 22.040 17.730 1.00 0.00 ? ? ? ? ? ? 2 DG C "O3'" 3
ATOM 2543 C "C2'" . DG B 2 2 ? 22.750 20.580 19.590 1.00 0.00 ? ? ? ? ? ? 2 DG C "C2'" 3
ATOM 2544 C "C1'" . DG B 2 2 ? 22.710 19.110 19.200 1.00 0.00 ? ? ? ? ? ? 2 DG C "C1'" 3
ATOM 2545 N N9 . DG B 2 2 ? 23.020 18.110 20.240 1.00 0.00 ? ? ? ? ? ? 2 DG C N9 3
ATOM 2546 C C8 . DG B 2 2 ? 24.070 18.090 21.060 1.00 0.00 ? ? ? ? ? ? 2 DG C C8 3
ATOM 2547 N N7 . DG B 2 2 ? 23.910 17.110 21.960 1.00 0.00 ? ? ? ? ? ? 2 DG C N7 3
ATOM 2548 C C5 . DG B 2 2 ? 22.740 16.520 21.720 1.00 0.00 ? ? ? ? ? ? 2 DG C C5 3
ATOM 2549 C C6 . DG B 2 2 ? 21.950 15.580 22.400 1.00 0.00 ? ? ? ? ? ? 2 DG C C6 3
ATOM 2550 O O6 . DG B 2 2 ? 22.400 14.840 23.280 1.00 0.00 ? ? ? ? ? ? 2 DG C O6 3
ATOM 2551 N N1 . DG B 2 2 ? 20.640 15.370 21.980 1.00 0.00 ? ? ? ? ? ? 2 DG C N1 3
ATOM 2552 C C2 . DG B 2 2 ? 20.150 16.050 20.880 1.00 0.00 ? ? ? ? ? ? 2 DG C C2 3
ATOM 2553 N N2 . DG B 2 2 ? 18.870 16.050 20.650 1.00 0.00 ? ? ? ? ? ? 2 DG C N2 3
ATOM 2554 N N3 . DG B 2 2 ? 20.930 16.890 20.190 1.00 0.00 ? ? ? ? ? ? 2 DG C N3 3
ATOM 2555 C C4 . DG B 2 2 ? 22.180 17.150 20.610 1.00 0.00 ? ? ? ? ? ? 2 DG C C4 3
ATOM 2556 H H1 . DG B 2 2 ? 20.030 14.750 22.480 1.00 0.00 ? ? ? ? ? ? 2 DG C H1 3
ATOM 2557 H H21 . DG B 2 2 ? 18.260 15.460 21.180 1.00 0.00 ? ? ? ? ? ? 2 DG C H21 3
ATOM 2558 H H22 . DG B 2 2 ? 18.500 16.610 19.890 1.00 0.00 ? ? ? ? ? ? 2 DG C H22 3
ATOM 2559 P P . DC B 2 3 ? 21.270 23.340 18.420 1.00 0.00 ? ? ? ? ? ? 3 DC C P 3
ATOM 2560 O OP1 . DC B 2 3 ? 20.460 24.060 17.410 1.00 0.00 ? ? ? ? ? ? 3 DC C OP1 3
ATOM 2561 O OP2 . DC B 2 3 ? 22.300 24.060 19.200 1.00 0.00 ? ? ? ? ? ? 3 DC C OP2 3
ATOM 2562 O "O5'" . DC B 2 3 ? 20.280 22.650 19.480 1.00 0.00 ? ? ? ? ? ? 3 DC C "O5'" 3
ATOM 2563 C "C5'" . DC B 2 3 ? 19.160 21.860 19.040 1.00 0.00 ? ? ? ? ? ? 3 DC C "C5'" 3
ATOM 2564 C "C4'" . DC B 2 3 ? 18.510 21.060 20.160 1.00 0.00 ? ? ? ? ? ? 3 DC C "C4'" 3
ATOM 2565 O "O4'" . DC B 2 3 ? 19.370 20.130 20.820 1.00 0.00 ? ? ? ? ? ? 3 DC C "O4'" 3
ATOM 2566 C "C3'" . DC B 2 3 ? 17.900 21.930 21.240 1.00 0.00 ? ? ? ? ? ? 3 DC C "C3'" 3
ATOM 2567 O "O3'" . DC B 2 3 ? 16.480 21.840 21.140 1.00 0.00 ? ? ? ? ? ? 3 DC C "O3'" 3
ATOM 2568 C "C2'" . DC B 2 3 ? 18.450 21.340 22.530 1.00 0.00 ? ? ? ? ? ? 3 DC C "C2'" 3
ATOM 2569 C "C1'" . DC B 2 3 ? 18.740 19.910 22.090 1.00 0.00 ? ? ? ? ? ? 3 DC C "C1'" 3
ATOM 2570 N N1 . DC B 2 3 ? 19.640 19.180 22.980 1.00 0.00 ? ? ? ? ? ? 3 DC C N1 3
ATOM 2571 C C2 . DC B 2 3 ? 19.130 18.240 23.900 1.00 0.00 ? ? ? ? ? ? 3 DC C C2 3
ATOM 2572 O O2 . DC B 2 3 ? 17.970 17.870 23.890 1.00 0.00 ? ? ? ? ? ? 3 DC C O2 3
ATOM 2573 N N3 . DC B 2 3 ? 19.930 17.770 24.880 1.00 0.00 ? ? ? ? ? ? 3 DC C N3 3
ATOM 2574 C C4 . DC B 2 3 ? 21.210 18.160 24.970 1.00 0.00 ? ? ? ? ? ? 3 DC C C4 3
ATOM 2575 N N4 . DC B 2 3 ? 21.930 17.380 25.750 1.00 0.00 ? ? ? ? ? ? 3 DC C N4 3
ATOM 2576 C C5 . DC B 2 3 ? 21.780 19.090 24.100 1.00 0.00 ? ? ? ? ? ? 3 DC C C5 3
ATOM 2577 C C6 . DC B 2 3 ? 20.980 19.610 23.080 1.00 0.00 ? ? ? ? ? ? 3 DC C C6 3
ATOM 2578 H H41 . DC B 2 3 ? 21.560 16.540 26.160 1.00 0.00 ? ? ? ? ? ? 3 DC C H41 3
ATOM 2579 H H42 . DC B 2 3 ? 22.890 17.590 25.930 1.00 0.00 ? ? ? ? ? ? 3 DC C H42 3
ATOM 2580 P P . DT B 2 4 ? 15.430 22.610 22.080 1.00 0.00 ? ? ? ? ? ? 4 DT C P 3
ATOM 2581 O OP1 . DT B 2 4 ? 14.400 23.180 21.180 1.00 0.00 ? ? ? ? ? ? 4 DT C OP1 3
ATOM 2582 O OP2 . DT B 2 4 ? 16.090 23.500 23.070 1.00 0.00 ? ? ? ? ? ? 4 DT C OP2 3
ATOM 2583 O "O5'" . DT B 2 4 ? 14.770 21.410 22.920 1.00 0.00 ? ? ? ? ? ? 4 DT C "O5'" 3
ATOM 2584 C "C5'" . DT B 2 4 ? 13.940 20.410 22.290 1.00 0.00 ? ? ? ? ? ? 4 DT C "C5'" 3
ATOM 2585 C "C4'" . DT B 2 4 ? 13.570 19.260 23.210 1.00 0.00 ? ? ? ? ? ? 4 DT C "C4'" 3
ATOM 2586 O "O4'" . DT B 2 4 ? 14.720 18.590 23.800 1.00 0.00 ? ? ? ? ? ? 4 DT C "O4'" 3
ATOM 2587 C "C3'" . DT B 2 4 ? 12.700 19.740 24.360 1.00 0.00 ? ? ? ? ? ? 4 DT C "C3'" 3
ATOM 2588 O "O3'" . DT B 2 4 ? 11.480 18.980 24.310 1.00 0.00 ? ? ? ? ? ? 4 DT C "O3'" 3
ATOM 2589 C "C2'" . DT B 2 4 ? 13.570 19.670 25.580 1.00 0.00 ? ? ? ? ? ? 4 DT C "C2'" 3
ATOM 2590 C "C1'" . DT B 2 4 ? 14.540 18.550 25.240 1.00 0.00 ? ? ? ? ? ? 4 DT C "C1'" 3
ATOM 2591 N N1 . DT B 2 4 ? 15.850 18.750 25.910 1.00 0.00 ? ? ? ? ? ? 4 DT C N1 3
ATOM 2592 C C2 . DT B 2 4 ? 16.380 17.750 26.740 1.00 0.00 ? ? ? ? ? ? 4 DT C C2 3
ATOM 2593 O O2 . DT B 2 4 ? 15.650 16.890 27.240 1.00 0.00 ? ? ? ? ? ? 4 DT C O2 3
ATOM 2594 N N3 . DT B 2 4 ? 17.610 17.960 27.350 1.00 0.00 ? ? ? ? ? ? 4 DT C N3 3
ATOM 2595 C C4 . DT B 2 4 ? 18.290 19.170 27.200 1.00 0.00 ? ? ? ? ? ? 4 DT C C4 3
ATOM 2596 O O4 . DT B 2 4 ? 19.400 19.240 27.720 1.00 0.00 ? ? ? ? ? ? 4 DT C O4 3
ATOM 2597 C C5 . DT B 2 4 ? 17.760 20.200 26.400 1.00 0.00 ? ? ? ? ? ? 4 DT C C5 3
ATOM 2598 C C7 . DT B 2 4 ? 18.490 21.530 26.190 1.00 0.00 ? ? ? ? ? ? 4 DT C C7 3
ATOM 2599 C C6 . DT B 2 4 ? 16.520 19.970 25.770 1.00 0.00 ? ? ? ? ? ? 4 DT C C6 3
ATOM 2600 H H3 . DT B 2 4 ? 18.100 17.170 27.730 1.00 0.00 ? ? ? ? ? ? 4 DT C H3 3
ATOM 2601 P P . DC B 2 5 ? 10.100 19.520 24.960 1.00 0.00 ? ? ? ? ? ? 5 DC C P 3
ATOM 2602 O OP1 . DC B 2 5 ? 9.010 18.860 24.200 1.00 0.00 ? ? ? ? ? ? 5 DC C OP1 3
ATOM 2603 O OP2 . DC B 2 5 ? 10.120 21.000 25.060 1.00 0.00 ? ? ? ? ? ? 5 DC C OP2 3
ATOM 2604 O "O5'" . DC B 2 5 ? 10.250 18.890 26.430 1.00 0.00 ? ? ? ? ? ? 5 DC C "O5'" 3
ATOM 2605 C "C5'" . DC B 2 5 ? 10.100 17.490 26.680 1.00 0.00 ? ? ? ? ? ? 5 DC C "C5'" 3
ATOM 2606 C "C4'" . DC B 2 5 ? 10.860 17.030 27.920 1.00 0.00 ? ? ? ? ? ? 5 DC C "C4'" 3
ATOM 2607 O "O4'" . DC B 2 5 ? 12.230 17.460 27.940 1.00 0.00 ? ? ? ? ? ? 5 DC C "O4'" 3
ATOM 2608 C "C3'" . DC B 2 5 ? 10.270 17.510 29.240 1.00 0.00 ? ? ? ? ? ? 5 DC C "C3'" 3
ATOM 2609 O "O3'" . DC B 2 5 ? 9.620 16.380 29.860 1.00 0.00 ? ? ? ? ? ? 5 DC C "O3'" 3
ATOM 2610 C "C2'" . DC B 2 5 ? 11.430 17.860 30.110 1.00 0.00 ? ? ? ? ? ? 5 DC C "C2'" 3
ATOM 2611 C "C1'" . DC B 2 5 ? 12.630 17.360 29.320 1.00 0.00 ? ? ? ? ? ? 5 DC C "C1'" 3
ATOM 2612 N N1 . DC B 2 5 ? 13.760 18.270 29.580 1.00 0.00 ? ? ? ? ? ? 5 DC C N1 3
ATOM 2613 C C2 . DC B 2 5 ? 14.900 17.850 30.290 1.00 0.00 ? ? ? ? ? ? 5 DC C C2 3
ATOM 2614 O O2 . DC B 2 5 ? 15.010 16.710 30.750 1.00 0.00 ? ? ? ? ? ? 5 DC C O2 3
ATOM 2615 N N3 . DC B 2 5 ? 15.920 18.710 30.460 1.00 0.00 ? ? ? ? ? ? 5 DC C N3 3
ATOM 2616 C C4 . DC B 2 5 ? 15.870 19.950 29.950 1.00 0.00 ? ? ? ? ? ? 5 DC C C4 3
ATOM 2617 N N4 . DC B 2 5 ? 17.050 20.470 29.770 1.00 0.00 ? ? ? ? ? ? 5 DC C N4 3
ATOM 2618 C C5 . DC B 2 5 ? 14.760 20.470 29.270 1.00 0.00 ? ? ? ? ? ? 5 DC C C5 3
ATOM 2619 C C6 . DC B 2 5 ? 13.700 19.580 29.070 1.00 0.00 ? ? ? ? ? ? 5 DC C C6 3
ATOM 2620 H H41 . DC B 2 5 ? 17.850 19.950 30.110 1.00 0.00 ? ? ? ? ? ? 5 DC C H41 3
ATOM 2621 H H42 . DC B 2 5 ? 17.170 21.390 29.370 1.00 0.00 ? ? ? ? ? ? 5 DC C H42 3
ATOM 2622 P P . DA B 2 6 ? 8.520 16.510 31.020 1.00 0.00 ? ? ? ? ? ? 6 DA C P 3
ATOM 2623 O OP1 . DA B 2 6 ? 7.410 15.610 30.650 1.00 0.00 ? ? ? ? ? ? 6 DA C OP1 3
ATOM 2624 O OP2 . DA B 2 6 ? 8.150 17.920 31.270 1.00 0.00 ? ? ? ? ? ? 6 DA C OP2 3
ATOM 2625 O "O5'" . DA B 2 6 ? 9.220 16.040 32.380 1.00 0.00 ? ? ? ? ? ? 6 DA C "O5'" 3
ATOM 2626 C "C5'" . DA B 2 6 ? 9.910 14.790 32.480 1.00 0.00 ? ? ? ? ? ? 6 DA C "C5'" 3
ATOM 2627 C "C4'" . DA B 2 6 ? 11.110 14.960 33.390 1.00 0.00 ? ? ? ? ? ? 6 DA C "C4'" 3
ATOM 2628 O "O4'" . DA B 2 6 ? 12.020 15.980 32.930 1.00 0.00 ? ? ? ? ? ? 6 DA C "O4'" 3
ATOM 2629 C "C3'" . DA B 2 6 ? 10.670 15.340 34.790 1.00 0.00 ? ? ? ? ? ? 6 DA C "C3'" 3
ATOM 2630 O "O3'" . DA B 2 6 ? 10.710 14.140 35.610 1.00 0.00 ? ? ? ? ? ? 6 DA C "O3'" 3
ATOM 2631 C "C2'" . DA B 2 6 ? 11.560 16.490 35.170 1.00 0.00 ? ? ? ? ? ? 6 DA C "C2'" 3
ATOM 2632 C "C1'" . DA B 2 6 ? 12.660 16.480 34.130 1.00 0.00 ? ? ? ? ? ? 6 DA C "C1'" 3
ATOM 2633 N N9 . DA B 2 6 ? 13.200 17.830 33.880 1.00 0.00 ? ? ? ? ? ? 6 DA C N9 3
ATOM 2634 C C8 . DA B 2 6 ? 12.530 18.880 33.440 1.00 0.00 ? ? ? ? ? ? 6 DA C C8 3
ATOM 2635 N N7 . DA B 2 6 ? 13.350 19.920 33.240 1.00 0.00 ? ? ? ? ? ? 6 DA C N7 3
ATOM 2636 C C5 . DA B 2 6 ? 14.560 19.510 33.600 1.00 0.00 ? ? ? ? ? ? 6 DA C C5 3
ATOM 2637 C C6 . DA B 2 6 ? 15.820 20.100 33.720 1.00 0.00 ? ? ? ? ? ? 6 DA C C6 3
ATOM 2638 N N6 . DA B 2 6 ? 16.080 21.240 33.080 1.00 0.00 ? ? ? ? ? ? 6 DA C N6 3
ATOM 2639 N N1 . DA B 2 6 ? 16.830 19.450 34.340 1.00 0.00 ? ? ? ? ? ? 6 DA C N1 3
ATOM 2640 C C2 . DA B 2 6 ? 16.670 18.210 34.820 1.00 0.00 ? ? ? ? ? ? 6 DA C C2 3
ATOM 2641 N N3 . DA B 2 6 ? 15.500 17.580 34.660 1.00 0.00 ? ? ? ? ? ? 6 DA C N3 3
ATOM 2642 C C4 . DA B 2 6 ? 14.460 18.190 34.050 1.00 0.00 ? ? ? ? ? ? 6 DA C C4 3
ATOM 2643 H H61 . DA B 2 6 ? 16.980 21.660 33.120 1.00 0.00 ? ? ? ? ? ? 6 DA C H61 3
ATOM 2644 H H62 . DA B 2 6 ? 15.330 21.730 32.630 1.00 0.00 ? ? ? ? ? ? 6 DA C H62 3
ATOM 2645 P P . DC B 2 7 ? 10.390 14.130 37.180 1.00 0.00 ? ? ? ? ? ? 7 DC C P 3
ATOM 2646 O OP1 . DC B 2 7 ? 10.450 12.740 37.700 1.00 0.00 ? ? ? ? ? ? 7 DC C OP1 3
ATOM 2647 O OP2 . DC B 2 7 ? 9.190 14.940 37.450 1.00 0.00 ? ? ? ? ? ? 7 DC C OP2 3
ATOM 2648 O "O5'" . DC B 2 7 ? 11.670 14.870 37.800 1.00 0.00 ? ? ? ? ? ? 7 DC C "O5'" 3
ATOM 2649 C "C5'" . DC B 2 7 ? 12.960 14.210 37.790 1.00 0.00 ? ? ? ? ? ? 7 DC C "C5'" 3
ATOM 2650 C "C4'" . DC B 2 7 ? 14.060 15.070 38.400 1.00 0.00 ? ? ? ? ? ? 7 DC C "C4'" 3
ATOM 2651 O "O4'" . DC B 2 7 ? 14.390 16.260 37.670 1.00 0.00 ? ? ? ? ? ? 7 DC C "O4'" 3
ATOM 2652 C "C3'" . DC B 2 7 ? 13.730 15.520 39.810 1.00 0.00 ? ? ? ? ? ? 7 DC C "C3'" 3
ATOM 2653 O "O3'" . DC B 2 7 ? 14.840 15.130 40.660 1.00 0.00 ? ? ? ? ? ? 7 DC C "O3'" 3
ATOM 2654 C "C2'" . DC B 2 7 ? 13.570 17.020 39.690 1.00 0.00 ? ? ? ? ? ? 7 DC C "C2'" 3
ATOM 2655 C "C1'" . DC B 2 7 ? 14.660 17.280 38.670 1.00 0.00 ? ? ? ? ? ? 7 DC C "C1'" 3
ATOM 2656 N N1 . DC B 2 7 ? 14.610 18.600 38.030 1.00 0.00 ? ? ? ? ? ? 7 DC C N1 3
ATOM 2657 C C2 . DC B 2 7 ? 15.760 19.430 37.940 1.00 0.00 ? ? ? ? ? ? 7 DC C C2 3
ATOM 2658 O O2 . DC B 2 7 ? 16.800 19.200 38.540 1.00 0.00 ? ? ? ? ? ? 7 DC C O2 3
ATOM 2659 N N3 . DC B 2 7 ? 15.670 20.600 37.300 1.00 0.00 ? ? ? ? ? ? 7 DC C N3 3
ATOM 2660 C C4 . DC B 2 7 ? 14.510 21.010 36.760 1.00 0.00 ? ? ? ? ? ? 7 DC C C4 3
ATOM 2661 N N4 . DC B 2 7 ? 14.520 22.250 36.360 1.00 0.00 ? ? ? ? ? ? 7 DC C N4 3
ATOM 2662 C C5 . DC B 2 7 ? 13.330 20.270 36.810 1.00 0.00 ? ? ? ? ? ? 7 DC C C5 3
ATOM 2663 C C6 . DC B 2 7 ? 13.390 19.040 37.470 1.00 0.00 ? ? ? ? ? ? 7 DC C C6 3
ATOM 2664 H H41 . DC B 2 7 ? 15.290 22.840 36.570 1.00 0.00 ? ? ? ? ? ? 7 DC C H41 3
ATOM 2665 H H42 . DC B 2 7 ? 13.690 22.640 35.900 1.00 0.00 ? ? ? ? ? ? 7 DC C H42 3
ATOM 2666 P P . DA B 2 8 ? 14.940 15.420 42.240 1.00 0.00 ? ? ? ? ? ? 8 DA C P 3
ATOM 2667 O OP1 . DA B 2 8 ? 15.710 14.320 42.860 1.00 0.00 ? ? ? ? ? ? 8 DA C OP1 3
ATOM 2668 O OP2 . DA B 2 8 ? 13.650 15.780 42.860 1.00 0.00 ? ? ? ? ? ? 8 DA C OP2 3
ATOM 2669 O "O5'" . DA B 2 8 ? 15.800 16.760 42.230 1.00 0.00 ? ? ? ? ? ? 8 DA C "O5'" 3
ATOM 2670 C "C5'" . DA B 2 8 ? 17.180 16.700 41.850 1.00 0.00 ? ? ? ? ? ? 8 DA C "C5'" 3
ATOM 2671 C "C4'" . DA B 2 8 ? 17.930 17.940 42.290 1.00 0.00 ? ? ? ? ? ? 8 DA C "C4'" 3
ATOM 2672 O "O4'" . DA B 2 8 ? 17.620 18.990 41.360 1.00 0.00 ? ? ? ? ? ? 8 DA C "O4'" 3
ATOM 2673 C "C3'" . DA B 2 8 ? 17.500 18.410 43.680 1.00 0.00 ? ? ? ? ? ? 8 DA C "C3'" 3
ATOM 2674 O "O3'" . DA B 2 8 ? 18.590 18.780 44.570 1.00 0.00 ? ? ? ? ? ? 8 DA C "O3'" 3
ATOM 2675 C "C2'" . DA B 2 8 ? 16.730 19.660 43.340 1.00 0.00 ? ? ? ? ? ? 8 DA C "C2'" 3
ATOM 2676 C "C1'" . DA B 2 8 ? 17.530 20.180 42.160 1.00 0.00 ? ? ? ? ? ? 8 DA C "C1'" 3
ATOM 2677 N N9 . DA B 2 8 ? 16.800 21.080 41.240 1.00 0.00 ? ? ? ? ? ? 8 DA C N9 3
ATOM 2678 C C8 . DA B 2 8 ? 15.520 20.960 40.940 1.00 0.00 ? ? ? ? ? ? 8 DA C C8 3
ATOM 2679 N N7 . DA B 2 8 ? 15.150 21.910 40.080 1.00 0.00 ? ? ? ? ? ? 8 DA C N7 3
ATOM 2680 C C5 . DA B 2 8 ? 16.240 22.640 39.830 1.00 0.00 ? ? ? ? ? ? 8 DA C C5 3
ATOM 2681 C C6 . DA B 2 8 ? 16.530 23.820 39.130 1.00 0.00 ? ? ? ? ? ? 8 DA C C6 3
ATOM 2682 N N6 . DA B 2 8 ? 15.590 24.660 38.750 1.00 0.00 ? ? ? ? ? ? 8 DA C N6 3
ATOM 2683 N N1 . DA B 2 8 ? 17.760 24.350 39.160 1.00 0.00 ? ? ? ? ? ? 8 DA C N1 3
ATOM 2684 C C2 . DA B 2 8 ? 18.750 23.820 39.870 1.00 0.00 ? ? ? ? ? ? 8 DA C C2 3
ATOM 2685 N N3 . DA B 2 8 ? 18.510 22.700 40.560 1.00 0.00 ? ? ? ? ? ? 8 DA C N3 3
ATOM 2686 C C4 . DA B 2 8 ? 17.290 22.100 40.560 1.00 0.00 ? ? ? ? ? ? 8 DA C C4 3
ATOM 2687 H H61 . DA B 2 8 ? 15.810 25.500 38.240 1.00 0.00 ? ? ? ? ? ? 8 DA C H61 3
ATOM 2688 H H62 . DA B 2 8 ? 14.630 24.500 39.030 1.00 0.00 ? ? ? ? ? ? 8 DA C H62 3
ATOM 2689 P P . DA B 2 9 ? 18.980 18.030 45.940 1.00 0.00 ? ? ? ? ? ? 9 DA C P 3
ATOM 2690 O OP1 . DA B 2 9 ? 19.160 16.580 45.690 1.00 0.00 ? ? ? ? ? ? 9 DA C OP1 3
ATOM 2691 O OP2 . DA B 2 9 ? 18.040 18.390 47.030 1.00 0.00 ? ? ? ? ? ? 9 DA C OP2 3
ATOM 2692 O "O5'" . DA B 2 9 ? 20.370 18.690 46.380 1.00 0.00 ? ? ? ? ? ? 9 DA C "O5'" 3
ATOM 2693 C "C5'" . DA B 2 9 ? 21.570 18.480 45.610 1.00 0.00 ? ? ? ? ? ? 9 DA C "C5'" 3
ATOM 2694 C "C4'" . DA B 2 9 ? 22.280 19.750 45.150 1.00 0.00 ? ? ? ? ? ? 9 DA C "C4'" 3
ATOM 2695 O "O4'" . DA B 2 9 ? 21.370 20.590 44.390 1.00 0.00 ? ? ? ? ? ? 9 DA C "O4'" 3
ATOM 2696 C "C3'" . DA B 2 9 ? 22.840 20.620 46.280 1.00 0.00 ? ? ? ? ? ? 9 DA C "C3'" 3
ATOM 2697 O "O3'" . DA B 2 9 ? 24.220 20.950 45.980 1.00 0.00 ? ? ? ? ? ? 9 DA C "O3'" 3
ATOM 2698 C "C2'" . DA B 2 9 ? 21.890 21.770 46.330 1.00 0.00 ? ? ? ? ? ? 9 DA C "C2'" 3
ATOM 2699 C "C1'" . DA B 2 9 ? 21.500 21.960 44.870 1.00 0.00 ? ? ? ? ? ? 9 DA C "C1'" 3
ATOM 2700 N N9 . DA B 2 9 ? 20.210 22.660 44.800 1.00 0.00 ? ? ? ? ? ? 9 DA C N9 3
ATOM 2701 C C8 . DA B 2 9 ? 19.080 22.180 45.320 1.00 0.00 ? ? ? ? ? ? 9 DA C C8 3
ATOM 2702 N N7 . DA B 2 9 ? 18.040 22.870 44.860 1.00 0.00 ? ? ? ? ? ? 9 DA C N7 3
ATOM 2703 C C5 . DA B 2 9 ? 18.520 23.820 44.070 1.00 0.00 ? ? ? ? ? ? 9 DA C C5 3
ATOM 2704 C C6 . DA B 2 9 ? 17.970 24.910 43.380 1.00 0.00 ? ? ? ? ? ? 9 DA C C6 3
ATOM 2705 N N6 . DA B 2 9 ? 16.670 24.960 43.240 1.00 0.00 ? ? ? ? ? ? 9 DA C N6 3
ATOM 2706 N N1 . DA B 2 9 ? 18.750 25.810 42.750 1.00 0.00 ? ? ? ? ? ? 9 DA C N1 3
ATOM 2707 C C2 . DA B 2 9 ? 20.090 25.670 42.750 1.00 0.00 ? ? ? ? ? ? 9 DA C C2 3
ATOM 2708 N N3 . DA B 2 9 ? 20.650 24.640 43.380 1.00 0.00 ? ? ? ? ? ? 9 DA C N3 3
ATOM 2709 C C4 . DA B 2 9 ? 19.910 23.710 44.040 1.00 0.00 ? ? ? ? ? ? 9 DA C C4 3
ATOM 2710 H H61 . DA B 2 9 ? 16.200 25.730 42.790 1.00 0.00 ? ? ? ? ? ? 9 DA C H61 3
ATOM 2711 H H62 . DA B 2 9 ? 16.150 24.150 43.570 1.00 0.00 ? ? ? ? ? ? 9 DA C H62 3
ATOM 2712 P P . DT B 2 10 ? 25.190 21.850 46.910 1.00 0.00 ? ? ? ? ? ? 10 DT C P 3
ATOM 2713 O OP1 . DT B 2 10 ? 26.550 21.700 46.350 1.00 0.00 ? ? ? ? ? ? 10 DT C OP1 3
ATOM 2714 O OP2 . DT B 2 10 ? 25.010 21.450 48.320 1.00 0.00 ? ? ? ? ? ? 10 DT C OP2 3
ATOM 2715 O "O5'" . DT B 2 10 ? 24.680 23.350 46.620 1.00 0.00 ? ? ? ? ? ? 10 DT C "O5'" 3
ATOM 2716 C "C5'" . DT B 2 10 ? 25.190 24.110 45.510 1.00 0.00 ? ? ? ? ? ? 10 DT C "C5'" 3
ATOM 2717 C "C4'" . DT B 2 10 ? 24.580 25.490 45.370 1.00 0.00 ? ? ? ? ? ? 10 DT C "C4'" 3
ATOM 2718 O "O4'" . DT B 2 10 ? 23.150 25.400 45.280 1.00 0.00 ? ? ? ? ? ? 10 DT C "O4'" 3
ATOM 2719 C "C3'" . DT B 2 10 ? 24.870 26.450 46.520 1.00 0.00 ? ? ? ? ? ? 10 DT C "C3'" 3
ATOM 2720 O "O3'" . DT B 2 10 ? 25.520 27.610 45.970 1.00 0.00 ? ? ? ? ? ? 10 DT C "O3'" 3
ATOM 2721 C "C2'" . DT B 2 10 ? 23.530 26.880 47.090 1.00 0.00 ? ? ? ? ? ? 10 DT C "C2'" 3
ATOM 2722 C "C1'" . DT B 2 10 ? 22.700 26.620 45.860 1.00 0.00 ? ? ? ? ? ? 10 DT C "C1'" 3
ATOM 2723 N N1 . DT B 2 10 ? 21.270 26.460 46.210 1.00 0.00 ? ? ? ? ? ? 10 DT C N1 3
ATOM 2724 C C2 . DT B 2 10 ? 20.320 27.320 45.650 1.00 0.00 ? ? ? ? ? ? 10 DT C C2 3
ATOM 2725 O O2 . DT B 2 10 ? 20.640 28.400 45.160 1.00 0.00 ? ? ? ? ? ? 10 DT C O2 3
ATOM 2726 N N3 . DT B 2 10 ? 18.970 27.060 45.840 1.00 0.00 ? ? ? ? ? ? 10 DT C N3 3
ATOM 2727 C C4 . DT B 2 10 ? 18.560 25.980 46.630 1.00 0.00 ? ? ? ? ? ? 10 DT C C4 3
ATOM 2728 O O4 . DT B 2 10 ? 17.350 25.790 46.710 1.00 0.00 ? ? ? ? ? ? 10 DT C O4 3
ATOM 2729 C C5 . DT B 2 10 ? 19.510 25.150 47.260 1.00 0.00 ? ? ? ? ? ? 10 DT C C5 3
ATOM 2730 C C7 . DT B 2 10 ? 19.150 24.250 48.440 1.00 0.00 ? ? ? ? ? ? 10 DT C C7 3
ATOM 2731 C C6 . DT B 2 10 ? 20.860 25.370 47.010 1.00 0.00 ? ? ? ? ? ? 10 DT C C6 3
ATOM 2732 H H3 . DT B 2 10 ? 18.290 27.680 45.470 1.00 0.00 ? ? ? ? ? ? 10 DT C H3 3
ATOM 2733 P P . DT B 2 11 ? 26.140 28.760 46.900 1.00 0.00 ? ? ? ? ? ? 11 DT C P 3
ATOM 2734 O OP1 . DT B 2 11 ? 27.220 29.420 46.130 1.00 0.00 ? ? ? ? ? ? 11 DT C OP1 3
ATOM 2735 O OP2 . DT B 2 11 ? 26.450 28.240 48.250 1.00 0.00 ? ? ? ? ? ? 11 DT C OP2 3
ATOM 2736 O "O5'" . DT B 2 11 ? 24.880 29.730 47.090 1.00 0.00 ? ? ? ? ? ? 11 DT C "O5'" 3
ATOM 2737 C "C5'" . DT B 2 11 ? 24.470 30.660 46.070 1.00 0.00 ? ? ? ? ? ? 11 DT C "C5'" 3
ATOM 2738 C "C4'" . DT B 2 11 ? 23.280 31.490 46.500 1.00 0.00 ? ? ? ? ? ? 11 DT C "C4'" 3
ATOM 2739 O "O4'" . DT B 2 11 ? 22.080 30.720 46.640 1.00 0.00 ? ? ? ? ? ? 11 DT C "O4'" 3
ATOM 2740 C "C3'" . DT B 2 11 ? 23.510 32.230 47.810 1.00 0.00 ? ? ? ? ? ? 11 DT C "C3'" 3
ATOM 2741 O "O3'" . DT B 2 11 ? 24.130 33.520 47.640 1.00 0.00 ? ? ? ? ? ? 11 DT C "O3'" 3
ATOM 2742 C "C2'" . DT B 2 11 ? 22.110 32.380 48.390 1.00 0.00 ? ? ? ? ? ? 11 DT C "C2'" 3
ATOM 2743 C "C1'" . DT B 2 11 ? 21.240 31.500 47.500 1.00 0.00 ? ? ? ? ? ? 11 DT C "C1'" 3
ATOM 2744 N N1 . DT B 2 11 ? 20.470 30.500 48.280 1.00 0.00 ? ? ? ? ? ? 11 DT C N1 3
ATOM 2745 C C2 . DT B 2 11 ? 19.070 30.510 48.180 1.00 0.00 ? ? ? ? ? ? 11 DT C C2 3
ATOM 2746 O O2 . DT B 2 11 ? 18.400 31.470 47.780 1.00 0.00 ? ? ? ? ? ? 11 DT C O2 3
ATOM 2747 N N3 . DT B 2 11 ? 18.360 29.420 48.660 1.00 0.00 ? ? ? ? ? ? 11 DT C N3 3
ATOM 2748 C C4 . DT B 2 11 ? 19.000 28.350 49.280 1.00 0.00 ? ? ? ? ? ? 11 DT C C4 3
ATOM 2749 O O4 . DT B 2 11 ? 18.300 27.370 49.530 1.00 0.00 ? ? ? ? ? ? 11 DT C O4 3
ATOM 2750 C C5 . DT B 2 11 ? 20.390 28.330 49.420 1.00 0.00 ? ? ? ? ? ? 11 DT C C5 3
ATOM 2751 C C7 . DT B 2 11 ? 21.140 27.220 50.160 1.00 0.00 ? ? ? ? ? ? 11 DT C C7 3
ATOM 2752 C C6 . DT B 2 11 ? 21.110 29.400 48.900 1.00 0.00 ? ? ? ? ? ? 11 DT C C6 3
ATOM 2753 H "HO3'" . DT B 2 11 ? 25.060 33.370 47.220 1.00 0.00 ? ? ? ? ? ? 11 DT C "HO3'" 3
ATOM 2754 H H3 . DT B 2 11 ? 17.360 29.430 48.580 1.00 0.00 ? ? ? ? ? ? 11 DT C H3 3
ATOM 2755 N N . MET C 3 1 ? 34.170 31.500 11.380 1.00 0.00 ? ? ? ? ? ? 1 MET A N 3
ATOM 2756 C CA . MET C 3 1 ? 33.550 30.380 10.640 1.00 0.00 ? ? ? ? ? ? 1 MET A CA 3
ATOM 2757 C C . MET C 3 1 ? 33.130 29.230 11.590 1.00 0.00 ? ? ? ? ? ? 1 MET A C 3
ATOM 2758 O O . MET C 3 1 ? 33.730 28.160 11.640 1.00 0.00 ? ? ? ? ? ? 1 MET A O 3
ATOM 2759 C CB . MET C 3 1 ? 34.600 29.880 9.650 1.00 0.00 ? ? ? ? ? ? 1 MET A CB 3
ATOM 2760 C CG . MET C 3 1 ? 34.840 30.790 8.450 1.00 0.00 ? ? ? ? ? ? 1 MET A CG 3
ATOM 2761 S SD . MET C 3 1 ? 33.500 30.720 7.210 1.00 0.00 ? ? ? ? ? ? 1 MET A SD 3
ATOM 2762 C CE . MET C 3 1 ? 33.700 29.030 6.670 1.00 0.00 ? ? ? ? ? ? 1 MET A CE 3
ATOM 2763 H H1 . MET C 3 1 ? 34.930 31.130 11.920 1.00 0.00 ? ? ? ? ? ? 1 MET A H1 3
ATOM 2764 H H2 . MET C 3 1 ? 34.510 32.180 10.730 1.00 0.00 ? ? ? ? ? ? 1 MET A H2 3
ATOM 2765 H H3 . MET C 3 1 ? 33.520 31.940 12.010 1.00 0.00 ? ? ? ? ? ? 1 MET A H3 3
ATOM 2766 N N . LYS C 3 2 ? 32.100 29.510 12.380 1.00 0.00 ? ? ? ? ? ? 2 LYS A N 3
ATOM 2767 C CA . LYS C 3 2 ? 31.700 28.620 13.480 1.00 0.00 ? ? ? ? ? ? 2 LYS A CA 3
ATOM 2768 C C . LYS C 3 2 ? 30.170 28.440 13.530 1.00 0.00 ? ? ? ? ? ? 2 LYS A C 3
ATOM 2769 O O . LYS C 3 2 ? 29.450 29.430 13.670 1.00 0.00 ? ? ? ? ? ? 2 LYS A O 3
ATOM 2770 C CB . LYS C 3 2 ? 32.260 29.170 14.800 1.00 0.00 ? ? ? ? ? ? 2 LYS A CB 3
ATOM 2771 C CG . LYS C 3 2 ? 33.170 28.150 15.500 1.00 0.00 ? ? ? ? ? ? 2 LYS A CG 3
ATOM 2772 C CD . LYS C 3 2 ? 33.810 28.700 16.790 1.00 0.00 ? ? ? ? ? ? 2 LYS A CD 3
ATOM 2773 C CE . LYS C 3 2 ? 32.830 28.960 17.940 1.00 0.00 ? ? ? ? ? ? 2 LYS A CE 3
ATOM 2774 N NZ . LYS C 3 2 ? 33.470 29.840 18.940 1.00 0.00 ? ? ? ? ? ? 2 LYS A NZ 3
ATOM 2775 H H . LYS C 3 2 ? 31.490 30.280 12.190 1.00 0.00 ? ? ? ? ? ? 2 LYS A H 3
ATOM 2776 H HZ1 . LYS C 3 2 ? 34.390 29.480 19.180 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ1 3
ATOM 2777 H HZ2 . LYS C 3 2 ? 33.590 30.760 18.560 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ2 3
ATOM 2778 H HZ3 . LYS C 3 2 ? 32.950 29.910 19.800 1.00 0.00 ? ? ? ? ? ? 2 LYS A HZ3 3
ATOM 2779 N N . PRO C 3 3 ? 29.680 27.230 13.210 1.00 0.00 ? ? ? ? ? ? 3 PRO A N 3
ATOM 2780 C CA . PRO C 3 3 ? 28.260 26.870 13.400 1.00 0.00 ? ? ? ? ? ? 3 PRO A CA 3
ATOM 2781 C C . PRO C 3 3 ? 27.770 27.260 14.800 1.00 0.00 ? ? ? ? ? ? 3 PRO A C 3
ATOM 2782 O O . PRO C 3 3 ? 28.400 26.930 15.810 1.00 0.00 ? ? ? ? ? ? 3 PRO A O 3
ATOM 2783 C CB . PRO C 3 3 ? 28.220 25.370 13.150 1.00 0.00 ? ? ? ? ? ? 3 PRO A CB 3
ATOM 2784 C CG . PRO C 3 3 ? 29.320 25.130 12.130 1.00 0.00 ? ? ? ? ? ? 3 PRO A CG 3
ATOM 2785 C CD . PRO C 3 3 ? 30.380 26.180 12.450 1.00 0.00 ? ? ? ? ? ? 3 PRO A CD 3
ATOM 2786 N N . VAL C 3 4 ? 26.860 28.230 14.770 1.00 0.00 ? ? ? ? ? ? 4 VAL A N 3
ATOM 2787 C CA . VAL C 3 4 ? 26.260 28.810 15.990 1.00 0.00 ? ? ? ? ? ? 4 VAL A CA 3
ATOM 2788 C C . VAL C 3 4 ? 25.230 27.860 16.620 1.00 0.00 ? ? ? ? ? ? 4 VAL A C 3
ATOM 2789 O O . VAL C 3 4 ? 24.160 27.610 16.070 1.00 0.00 ? ? ? ? ? ? 4 VAL A O 3
ATOM 2790 C CB . VAL C 3 4 ? 25.690 30.230 15.750 1.00 0.00 ? ? ? ? ? ? 4 VAL A CB 3
ATOM 2791 C CG1 . VAL C 3 4 ? 25.380 30.890 17.100 1.00 0.00 ? ? ? ? ? ? 4 VAL A CG1 3
ATOM 2792 C CG2 . VAL C 3 4 ? 26.670 31.160 15.030 1.00 0.00 ? ? ? ? ? ? 4 VAL A CG2 3
ATOM 2793 H H . VAL C 3 4 ? 26.690 28.720 13.930 1.00 0.00 ? ? ? ? ? ? 4 VAL A H 3
ATOM 2794 N N . THR C 3 5 ? 25.730 27.220 17.680 1.00 0.00 ? ? ? ? ? ? 5 THR A N 3
ATOM 2795 C CA . THR C 3 5 ? 24.990 26.290 18.580 1.00 0.00 ? ? ? ? ? ? 5 THR A CA 3
ATOM 2796 C C . THR C 3 5 ? 24.260 27.050 19.700 1.00 0.00 ? ? ? ? ? ? 5 THR A C 3
ATOM 2797 O O . THR C 3 5 ? 24.670 28.170 20.030 1.00 0.00 ? ? ? ? ? ? 5 THR A O 3
ATOM 2798 C CB . THR C 3 5 ? 25.930 25.300 19.300 1.00 0.00 ? ? ? ? ? ? 5 THR A CB 3
ATOM 2799 O OG1 . THR C 3 5 ? 26.930 25.980 20.060 1.00 0.00 ? ? ? ? ? ? 5 THR A OG1 3
ATOM 2800 C CG2 . THR C 3 5 ? 26.530 24.250 18.360 1.00 0.00 ? ? ? ? ? ? 5 THR A CG2 3
ATOM 2801 H H . THR C 3 5 ? 26.690 27.390 17.930 1.00 0.00 ? ? ? ? ? ? 5 THR A H 3
ATOM 2802 H HG1 . THR C 3 5 ? 27.440 26.640 19.440 1.00 0.00 ? ? ? ? ? ? 5 THR A HG1 3
ATOM 2803 N N . LEU C 3 6 ? 23.390 26.360 20.450 1.00 0.00 ? ? ? ? ? ? 6 LEU A N 3
ATOM 2804 C CA . LEU C 3 6 ? 22.740 26.930 21.650 1.00 0.00 ? ? ? ? ? ? 6 LEU A CA 3
ATOM 2805 C C . LEU C 3 6 ? 23.770 27.430 22.680 1.00 0.00 ? ? ? ? ? ? 6 LEU A C 3
ATOM 2806 O O . LEU C 3 6 ? 23.640 28.530 23.220 1.00 0.00 ? ? ? ? ? ? 6 LEU A O 3
ATOM 2807 C CB . LEU C 3 6 ? 21.780 25.930 22.310 1.00 0.00 ? ? ? ? ? ? 6 LEU A CB 3
ATOM 2808 C CG . LEU C 3 6 ? 20.400 25.890 21.640 1.00 0.00 ? ? ? ? ? ? 6 LEU A CG 3
ATOM 2809 C CD1 . LEU C 3 6 ? 19.520 24.900 22.380 1.00 0.00 ? ? ? ? ? ? 6 LEU A CD1 3
ATOM 2810 C CD2 . LEU C 3 6 ? 19.700 27.250 21.660 1.00 0.00 ? ? ? ? ? ? 6 LEU A CD2 3
ATOM 2811 H H . LEU C 3 6 ? 23.120 25.410 20.250 1.00 0.00 ? ? ? ? ? ? 6 LEU A H 3
ATOM 2812 N N . TYR C 3 7 ? 24.830 26.650 22.840 1.00 0.00 ? ? ? ? ? ? 7 TYR A N 3
ATOM 2813 C CA . TYR C 3 7 ? 26.040 27.020 23.600 1.00 0.00 ? ? ? ? ? ? 7 TYR A CA 3
ATOM 2814 C C . TYR C 3 7 ? 26.670 28.370 23.220 1.00 0.00 ? ? ? ? ? ? 7 TYR A C 3
ATOM 2815 O O . TYR C 3 7 ? 26.960 29.160 24.110 1.00 0.00 ? ? ? ? ? ? 7 TYR A O 3
ATOM 2816 C CB . TYR C 3 7 ? 27.150 25.990 23.420 1.00 0.00 ? ? ? ? ? ? 7 TYR A CB 3
ATOM 2817 C CG . TYR C 3 7 ? 26.810 24.620 23.980 1.00 0.00 ? ? ? ? ? ? 7 TYR A CG 3
ATOM 2818 C CD1 . TYR C 3 7 ? 26.860 24.460 25.380 1.00 0.00 ? ? ? ? ? ? 7 TYR A CD1 3
ATOM 2819 C CD2 . TYR C 3 7 ? 26.780 23.530 23.090 1.00 0.00 ? ? ? ? ? ? 7 TYR A CD2 3
ATOM 2820 C CE1 . TYR C 3 7 ? 26.930 23.160 25.910 1.00 0.00 ? ? ? ? ? ? 7 TYR A CE1 3
ATOM 2821 C CE2 . TYR C 3 7 ? 26.840 22.230 23.620 1.00 0.00 ? ? ? ? ? ? 7 TYR A CE2 3
ATOM 2822 C CZ . TYR C 3 7 ? 26.930 22.070 25.010 1.00 0.00 ? ? ? ? ? ? 7 TYR A CZ 3
ATOM 2823 O OH . TYR C 3 7 ? 27.110 20.820 25.510 1.00 0.00 ? ? ? ? ? ? 7 TYR A OH 3
ATOM 2824 H H . TYR C 3 7 ? 24.770 25.680 22.580 1.00 0.00 ? ? ? ? ? ? 7 TYR A H 3
ATOM 2825 H HH . TYR C 3 7 ? 26.980 20.190 24.730 1.00 0.00 ? ? ? ? ? ? 7 TYR A HH 3
ATOM 2826 N N . ASP C 3 8 ? 26.910 28.580 21.930 1.00 0.00 ? ? ? ? ? ? 8 ASP A N 3
ATOM 2827 C CA . ASP C 3 8 ? 27.590 29.780 21.400 1.00 0.00 ? ? ? ? ? ? 8 ASP A CA 3
ATOM 2828 C C . ASP C 3 8 ? 26.820 31.050 21.790 1.00 0.00 ? ? ? ? ? ? 8 ASP A C 3
ATOM 2829 O O . ASP C 3 8 ? 27.310 31.820 22.620 1.00 0.00 ? ? ? ? ? ? 8 ASP A O 3
ATOM 2830 C CB . ASP C 3 8 ? 27.800 29.640 19.880 1.00 0.00 ? ? ? ? ? ? 8 ASP A CB 3
ATOM 2831 C CG . ASP C 3 8 ? 28.730 28.480 19.480 1.00 0.00 ? ? ? ? ? ? 8 ASP A CG 3
ATOM 2832 O OD1 . ASP C 3 8 ? 29.860 28.390 19.990 1.00 0.00 ? ? ? ? ? ? 8 ASP A OD1 3
ATOM 2833 O OD2 . ASP C 3 8 ? 28.330 27.680 18.620 1.00 0.00 ? ? ? ? ? ? 8 ASP A OD2 3
ATOM 2834 H H . ASP C 3 8 ? 26.610 27.930 21.230 1.00 0.00 ? ? ? ? ? ? 8 ASP A H 3
ATOM 2835 N N . VAL C 3 9 ? 25.530 31.060 21.480 1.00 0.00 ? ? ? ? ? ? 9 VAL A N 3
ATOM 2836 C CA . VAL C 3 9 ? 24.590 32.150 21.880 1.00 0.00 ? ? ? ? ? ? 9 VAL A CA 3
ATOM 2837 C C . VAL C 3 9 ? 24.400 32.310 23.400 1.00 0.00 ? ? ? ? ? ? 9 VAL A C 3
ATOM 2838 O O . VAL C 3 9 ? 24.280 33.420 23.910 1.00 0.00 ? ? ? ? ? ? 9 VAL A O 3
ATOM 2839 C CB . VAL C 3 9 ? 23.230 32.110 21.150 1.00 0.00 ? ? ? ? ? ? 9 VAL A CB 3
ATOM 2840 C CG1 . VAL C 3 9 ? 23.330 32.920 19.870 1.00 0.00 ? ? ? ? ? ? 9 VAL A CG1 3
ATOM 2841 C CG2 . VAL C 3 9 ? 22.640 30.710 20.900 1.00 0.00 ? ? ? ? ? ? 9 VAL A CG2 3
ATOM 2842 H H . VAL C 3 9 ? 25.110 30.300 20.980 1.00 0.00 ? ? ? ? ? ? 9 VAL A H 3
ATOM 2843 N N . ALA C 3 10 ? 24.390 31.170 24.090 1.00 0.00 ? ? ? ? ? ? 10 ALA A N 3
ATOM 2844 C CA . ALA C 3 10 ? 24.450 31.120 25.560 1.00 0.00 ? ? ? ? ? ? 10 ALA A CA 3
ATOM 2845 C C . ALA C 3 10 ? 25.710 31.810 26.130 1.00 0.00 ? ? ? ? ? ? 10 ALA A C 3
ATOM 2846 O O . ALA C 3 10 ? 25.610 32.890 26.720 1.00 0.00 ? ? ? ? ? ? 10 ALA A O 3
ATOM 2847 C CB . ALA C 3 10 ? 24.360 29.650 25.970 1.00 0.00 ? ? ? ? ? ? 10 ALA A CB 3
ATOM 2848 H H . ALA C 3 10 ? 24.210 30.280 23.650 1.00 0.00 ? ? ? ? ? ? 10 ALA A H 3
ATOM 2849 N N . GLU C 3 11 ? 26.890 31.250 25.850 1.00 0.00 ? ? ? ? ? ? 11 GLU A N 3
ATOM 2850 C CA . GLU C 3 11 ? 28.230 31.820 26.120 1.00 0.00 ? ? ? ? ? ? 11 GLU A CA 3
ATOM 2851 C C . GLU C 3 11 ? 28.300 33.360 25.970 1.00 0.00 ? ? ? ? ? ? 11 GLU A C 3
ATOM 2852 O O . GLU C 3 11 ? 28.470 34.040 26.980 1.00 0.00 ? ? ? ? ? ? 11 GLU A O 3
ATOM 2853 C CB . GLU C 3 11 ? 29.260 31.180 25.180 1.00 0.00 ? ? ? ? ? ? 11 GLU A CB 3
ATOM 2854 C CG . GLU C 3 11 ? 30.120 30.090 25.820 1.00 0.00 ? ? ? ? ? ? 11 GLU A CG 3
ATOM 2855 C CD . GLU C 3 11 ? 31.300 29.720 24.910 1.00 0.00 ? ? ? ? ? ? 11 GLU A CD 3
ATOM 2856 O OE1 . GLU C 3 11 ? 31.070 29.060 23.880 1.00 0.00 ? ? ? ? ? ? 11 GLU A OE1 3
ATOM 2857 O OE2 . GLU C 3 11 ? 32.440 30.130 25.220 1.00 0.00 ? ? ? ? ? ? 11 GLU A OE2 3
ATOM 2858 H H . GLU C 3 11 ? 26.940 30.320 25.450 1.00 0.00 ? ? ? ? ? ? 11 GLU A H 3
ATOM 2859 N N . TYR C 3 12 ? 27.950 33.850 24.780 1.00 0.00 ? ? ? ? ? ? 12 TYR A N 3
ATOM 2860 C CA . TYR C 3 12 ? 28.020 35.270 24.390 1.00 0.00 ? ? ? ? ? ? 12 TYR A CA 3
ATOM 2861 C C . TYR C 3 12 ? 27.170 36.210 25.230 1.00 0.00 ? ? ? ? ? ? 12 TYR A C 3
ATOM 2862 O O . TYR C 3 12 ? 27.600 37.300 25.610 1.00 0.00 ? ? ? ? ? ? 12 TYR A O 3
ATOM 2863 C CB . TYR C 3 12 ? 27.560 35.390 22.940 1.00 0.00 ? ? ? ? ? ? 12 TYR A CB 3
ATOM 2864 C CG . TYR C 3 12 ? 27.920 36.750 22.360 1.00 0.00 ? ? ? ? ? ? 12 TYR A CG 3
ATOM 2865 C CD1 . TYR C 3 12 ? 29.250 36.890 21.940 1.00 0.00 ? ? ? ? ? ? 12 TYR A CD1 3
ATOM 2866 C CD2 . TYR C 3 12 ? 26.920 37.660 21.950 1.00 0.00 ? ? ? ? ? ? 12 TYR A CD2 3
ATOM 2867 C CE1 . TYR C 3 12 ? 29.600 37.880 21.020 1.00 0.00 ? ? ? ? ? ? 12 TYR A CE1 3
ATOM 2868 C CE2 . TYR C 3 12 ? 27.260 38.670 21.030 1.00 0.00 ? ? ? ? ? ? 12 TYR A CE2 3
ATOM 2869 C CZ . TYR C 3 12 ? 28.590 38.750 20.570 1.00 0.00 ? ? ? ? ? ? 12 TYR A CZ 3
ATOM 2870 O OH . TYR C 3 12 ? 28.950 39.760 19.750 1.00 0.00 ? ? ? ? ? ? 12 TYR A OH 3
ATOM 2871 H H . TYR C 3 12 ? 27.670 33.250 24.030 1.00 0.00 ? ? ? ? ? ? 12 TYR A H 3
ATOM 2872 H HH . TYR C 3 12 ? 30.010 39.790 19.700 1.00 0.00 ? ? ? ? ? ? 12 TYR A HH 3
ATOM 2873 N N . ALA C 3 13 ? 25.920 35.810 25.400 1.00 0.00 ? ? ? ? ? ? 13 ALA A N 3
ATOM 2874 C CA . ALA C 3 13 ? 24.980 36.610 26.210 1.00 0.00 ? ? ? ? ? ? 13 ALA A CA 3
ATOM 2875 C C . ALA C 3 13 ? 25.210 36.430 27.720 1.00 0.00 ? ? ? ? ? ? 13 ALA A C 3
ATOM 2876 O O . ALA C 3 13 ? 24.610 37.140 28.540 1.00 0.00 ? ? ? ? ? ? 13 ALA A O 3
ATOM 2877 C CB . ALA C 3 13 ? 23.550 36.280 25.820 1.00 0.00 ? ? ? ? ? ? 13 ALA A CB 3
ATOM 2878 H H . ALA C 3 13 ? 25.590 34.940 25.040 1.00 0.00 ? ? ? ? ? ? 13 ALA A H 3
ATOM 2879 N N . GLY C 3 14 ? 26.110 35.510 28.060 1.00 0.00 ? ? ? ? ? ? 14 GLY A N 3
ATOM 2880 C CA . GLY C 3 14 ? 26.550 35.210 29.430 1.00 0.00 ? ? ? ? ? ? 14 GLY A CA 3
ATOM 2881 C C . GLY C 3 14 ? 25.400 34.630 30.260 1.00 0.00 ? ? ? ? ? ? 14 GLY A C 3
ATOM 2882 O O . GLY C 3 14 ? 25.090 35.130 31.340 1.00 0.00 ? ? ? ? ? ? 14 GLY A O 3
ATOM 2883 H H . GLY C 3 14 ? 26.460 34.880 27.360 1.00 0.00 ? ? ? ? ? ? 14 GLY A H 3
ATOM 2884 N N . VAL C 3 15 ? 24.770 33.630 29.640 1.00 0.00 ? ? ? ? ? ? 15 VAL A N 3
ATOM 2885 C CA . VAL C 3 15 ? 23.490 33.010 30.070 1.00 0.00 ? ? ? ? ? ? 15 VAL A CA 3
ATOM 2886 C C . VAL C 3 15 ? 23.530 31.510 29.720 1.00 0.00 ? ? ? ? ? ? 15 VAL A C 3
ATOM 2887 O O . VAL C 3 15 ? 24.340 31.050 28.910 1.00 0.00 ? ? ? ? ? ? 15 VAL A O 3
ATOM 2888 C CB . VAL C 3 15 ? 22.260 33.760 29.560 1.00 0.00 ? ? ? ? ? ? 15 VAL A CB 3
ATOM 2889 C CG1 . VAL C 3 15 ? 22.030 35.050 30.350 1.00 0.00 ? ? ? ? ? ? 15 VAL A CG1 3
ATOM 2890 C CG2 . VAL C 3 15 ? 22.280 34.000 28.060 1.00 0.00 ? ? ? ? ? ? 15 VAL A CG2 3
ATOM 2891 H H . VAL C 3 15 ? 25.180 33.200 28.830 1.00 0.00 ? ? ? ? ? ? 15 VAL A H 3
ATOM 2892 N N . SER C 3 16 ? 22.760 30.760 30.490 1.00 0.00 ? ? ? ? ? ? 16 SER A N 3
ATOM 2893 C CA . SER C 3 16 ? 22.730 29.300 30.460 1.00 0.00 ? ? ? ? ? ? 16 SER A CA 3
ATOM 2894 C C . SER C 3 16 ? 22.080 28.750 29.200 1.00 0.00 ? ? ? ? ? ? 16 SER A C 3
ATOM 2895 O O . SER C 3 16 ? 21.190 29.340 28.600 1.00 0.00 ? ? ? ? ? ? 16 SER A O 3
ATOM 2896 C CB . SER C 3 16 ? 21.960 28.770 31.650 1.00 0.00 ? ? ? ? ? ? 16 SER A CB 3
ATOM 2897 O OG . SER C 3 16 ? 21.790 27.350 31.580 1.00 0.00 ? ? ? ? ? ? 16 SER A OG 3
ATOM 2898 H H . SER C 3 16 ? 22.100 31.180 31.120 1.00 0.00 ? ? ? ? ? ? 16 SER A H 3
ATOM 2899 H HG . SER C 3 16 ? 22.340 26.920 32.360 1.00 0.00 ? ? ? ? ? ? 16 SER A HG 3
ATOM 2900 N N . TYR C 3 17 ? 22.750 27.700 28.750 1.00 0.00 ? ? ? ? ? ? 17 TYR A N 3
ATOM 2901 C CA . TYR C 3 17 ? 22.240 26.640 27.870 1.00 0.00 ? ? ? ? ? ? 17 TYR A CA 3
ATOM 2902 C C . TYR C 3 17 ? 20.720 26.480 27.900 1.00 0.00 ? ? ? ? ? ? 17 TYR A C 3
ATOM 2903 O O . TYR C 3 17 ? 20.080 26.610 26.850 1.00 0.00 ? ? ? ? ? ? 17 TYR A O 3
ATOM 2904 C CB . TYR C 3 17 ? 22.960 25.390 28.370 1.00 0.00 ? ? ? ? ? ? 17 TYR A CB 3
ATOM 2905 C CG . TYR C 3 17 ? 22.900 24.220 27.400 1.00 0.00 ? ? ? ? ? ? 17 TYR A CG 3
ATOM 2906 C CD1 . TYR C 3 17 ? 23.100 24.430 26.020 1.00 0.00 ? ? ? ? ? ? 17 TYR A CD1 3
ATOM 2907 C CD2 . TYR C 3 17 ? 22.890 22.940 27.980 1.00 0.00 ? ? ? ? ? ? 17 TYR A CD2 3
ATOM 2908 C CE1 . TYR C 3 17 ? 23.340 23.320 25.190 1.00 0.00 ? ? ? ? ? ? 17 TYR A CE1 3
ATOM 2909 C CE2 . TYR C 3 17 ? 23.140 21.830 27.170 1.00 0.00 ? ? ? ? ? ? 17 TYR A CE2 3
ATOM 2910 C CZ . TYR C 3 17 ? 23.380 22.040 25.790 1.00 0.00 ? ? ? ? ? ? 17 TYR A CZ 3
ATOM 2911 O OH . TYR C 3 17 ? 23.940 21.010 25.110 1.00 0.00 ? ? ? ? ? ? 17 TYR A OH 3
ATOM 2912 H H . TYR C 3 17 ? 23.750 27.690 28.870 1.00 0.00 ? ? ? ? ? ? 17 TYR A H 3
ATOM 2913 H HH . TYR C 3 17 ? 24.280 20.320 25.810 1.00 0.00 ? ? ? ? ? ? 17 TYR A HH 3
ATOM 2914 N N . GLN C 3 18 ? 20.190 26.370 29.120 1.00 0.00 ? ? ? ? ? ? 18 GLN A N 3
ATOM 2915 C CA . GLN C 3 18 ? 18.760 26.290 29.480 1.00 0.00 ? ? ? ? ? ? 18 GLN A CA 3
ATOM 2916 C C . GLN C 3 18 ? 17.950 27.600 29.390 1.00 0.00 ? ? ? ? ? ? 18 GLN A C 3
ATOM 2917 O O . GLN C 3 18 ? 16.940 27.590 28.700 1.00 0.00 ? ? ? ? ? ? 18 GLN A O 3
ATOM 2918 C CB . GLN C 3 18 ? 18.740 25.660 30.870 1.00 0.00 ? ? ? ? ? ? 18 GLN A CB 3
ATOM 2919 C CG . GLN C 3 18 ? 18.020 24.300 30.910 1.00 0.00 ? ? ? ? ? ? 18 GLN A CG 3
ATOM 2920 C CD . GLN C 3 18 ? 18.360 23.320 29.780 1.00 0.00 ? ? ? ? ? ? 18 GLN A CD 3
ATOM 2921 O OE1 . GLN C 3 18 ? 17.640 23.250 28.790 1.00 0.00 ? ? ? ? ? ? 18 GLN A OE1 3
ATOM 2922 N NE2 . GLN C 3 18 ? 19.180 22.320 30.020 1.00 0.00 ? ? ? ? ? ? 18 GLN A NE2 3
ATOM 2923 H H . GLN C 3 18 ? 20.790 26.220 29.900 1.00 0.00 ? ? ? ? ? ? 18 GLN A H 3
ATOM 2924 H HE21 . GLN C 3 18 ? 19.470 22.110 30.960 1.00 0.00 ? ? ? ? ? ? 18 GLN A HE21 3
ATOM 2925 H HE22 . GLN C 3 18 ? 19.440 21.710 29.280 1.00 0.00 ? ? ? ? ? ? 18 GLN A HE22 3
ATOM 2926 N N . THR C 3 19 ? 18.500 28.720 29.860 1.00 0.00 ? ? ? ? ? ? 19 THR A N 3
ATOM 2927 C CA . THR C 3 19 ? 17.900 30.070 29.700 1.00 0.00 ? ? ? ? ? ? 19 THR A CA 3
ATOM 2928 C C . THR C 3 19 ? 17.700 30.380 28.200 1.00 0.00 ? ? ? ? ? ? 19 THR A C 3
ATOM 2929 O O . THR C 3 19 ? 16.590 30.710 27.800 1.00 0.00 ? ? ? ? ? ? 19 THR A O 3
ATOM 2930 C CB . THR C 3 19 ? 18.800 31.150 30.340 1.00 0.00 ? ? ? ? ? ? 19 THR A CB 3
ATOM 2931 O OG1 . THR C 3 19 ? 19.260 30.630 31.590 1.00 0.00 ? ? ? ? ? ? 19 THR A OG1 3
ATOM 2932 C CG2 . THR C 3 19 ? 18.070 32.470 30.580 1.00 0.00 ? ? ? ? ? ? 19 THR A CG2 3
ATOM 2933 H H . THR C 3 19 ? 19.350 28.740 30.390 1.00 0.00 ? ? ? ? ? ? 19 THR A H 3
ATOM 2934 H HG1 . THR C 3 19 ? 18.570 30.840 32.320 1.00 0.00 ? ? ? ? ? ? 19 THR A HG1 3
ATOM 2935 N N . VAL C 3 20 ? 18.660 29.880 27.410 1.00 0.00 ? ? ? ? ? ? 20 VAL A N 3
ATOM 2936 C CA . VAL C 3 20 ? 18.710 30.020 25.940 1.00 0.00 ? ? ? ? ? ? 20 VAL A CA 3
ATOM 2937 C C . VAL C 3 20 ? 17.840 28.950 25.230 1.00 0.00 ? ? ? ? ? ? 20 VAL A C 3
ATOM 2938 O O . VAL C 3 20 ? 16.990 29.300 24.430 1.00 0.00 ? ? ? ? ? ? 20 VAL A O 3
ATOM 2939 C CB . VAL C 3 20 ? 20.180 30.140 25.510 1.00 0.00 ? ? ? ? ? ? 20 VAL A CB 3
ATOM 2940 C CG1 . VAL C 3 20 ? 20.450 30.090 24.000 1.00 0.00 ? ? ? ? ? ? 20 VAL A CG1 3
ATOM 2941 C CG2 . VAL C 3 20 ? 20.700 31.490 26.000 1.00 0.00 ? ? ? ? ? ? 20 VAL A CG2 3