Skip to content
Browse files

Merge pull request #90 from cbrueffer/fixes

Some minor cleanup
  • Loading branch information...
2 parents c98a217 + ba8109e commit 1d2d6cddd898c3297748f65de3c7a7cae8cb74c7 @mdehoon mdehoon committed Nov 21, 2012
Showing with 1 addition and 5 deletions.
  1. +0 −4 Tests/test_IsoelectricPoint.py
  2. +1 −1 Tests/test_bgzf.py
View
4 Tests/test_IsoelectricPoint.py
@@ -1,4 +0,0 @@
-from Bio.SeqUtils import ProtParam
-
-X = ProtParam.ProteinAnalysis("MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV")
-print "isoelectric point for this protein: %.3f" % X.isoelectric_point()
View
2 Tests/test_bgzf.py
@@ -217,7 +217,7 @@ def check_random(self, filename):
h = bgzf.BgzfReader(filename, "rb", max_cache = 1)
for voffset, real_offset in v_offsets:
h.seek(0)
- assert voffset >= 0 and real_offset >= 0
+ self.assertTrue(voffset >= 0 and real_offset >= 0)
self.assertEqual(h.read(real_offset), old[:real_offset])
self.assertEqual(h.tell(), voffset)
for voffset, real_offset in v_offsets:

0 comments on commit 1d2d6cd

Please sign in to comment.
Something went wrong with that request. Please try again.