Permalink
Cannot retrieve contributors at this time
Fetching contributors…
Cannot retrieve contributors at this time
| <?xml version="1.0" encoding="UTF-8"?><!DOCTYPE article PUBLIC "-//NLM//DTD JATS (Z39.96) Journal Archiving and Interchange DTD v1.1d1 20130915//EN" "JATS-archivearticle1.dtd"><article article-type="research-article" dtd-version="1.1d1" xmlns:xlink="http://www.w3.org/1999/xlink"><front><journal-meta><journal-id journal-id-type="nlm-ta">elife</journal-id><journal-id journal-id-type="hwp">eLife</journal-id><journal-id journal-id-type="publisher-id">eLife</journal-id><journal-title-group><journal-title>eLife</journal-title></journal-title-group><issn publication-format="electronic">2050-084X</issn><publisher><publisher-name>eLife Sciences Publications, Ltd</publisher-name></publisher></journal-meta><article-meta><article-id pub-id-type="publisher-id">03191</article-id><article-id pub-id-type="doi">10.7554/eLife.03191</article-id><article-categories><subj-group subj-group-type="display-channel"><subject>Research article</subject></subj-group><subj-group subj-group-type="heading"><subject>Cell biology</subject></subj-group></article-categories><title-group><article-title>The metal transporter ZIP13 supplies iron into the secretory pathway in <italic>Drosophila melanogaster</italic></article-title></title-group><contrib-group><contrib contrib-type="author" equal-contrib="yes" id="author-13660"><name><surname>Xiao</surname><given-names>Guiran</given-names></name><xref ref-type="aff" rid="aff1"/><xref ref-type="fn" rid="equal-contrib">†</xref><xref ref-type="fn" rid="con1"/><xref ref-type="fn" rid="conf1"/></contrib><contrib contrib-type="author" equal-contrib="yes" id="author-13661"><name><surname>Wan</surname><given-names>Zhihui</given-names></name><xref ref-type="aff" rid="aff1"/><xref ref-type="fn" rid="equal-contrib">†</xref><xref ref-type="fn" rid="con2"/><xref ref-type="fn" rid="conf1"/></contrib><contrib contrib-type="author" id="author-13662"><name><surname>Fan</surname><given-names>Qiangwang</given-names></name><xref ref-type="aff" rid="aff1"/><xref ref-type="fn" rid="con3"/><xref ref-type="fn" rid="conf1"/></contrib><contrib contrib-type="author" id="author-13663"><name><surname>Tang</surname><given-names>Xiaona</given-names></name><xref ref-type="aff" rid="aff1"/><xref ref-type="fn" rid="con4"/><xref ref-type="fn" rid="conf1"/></contrib><contrib contrib-type="author" corresp="yes" id="author-10287"><name><surname>Zhou</surname><given-names>Bing</given-names></name><xref ref-type="aff" rid="aff1"/><xref ref-type="corresp" rid="cor1">*</xref><xref ref-type="other" rid="par-1"/><xref ref-type="other" rid="par-2"/><xref ref-type="fn" rid="con5"/><xref ref-type="fn" rid="conf1"/></contrib><aff id="aff1"><institution content-type="dept">State Key Laboratory of Biomembrane and Membrane Biotechnology, School of Life Sciences</institution>, <institution>Tsinghua University</institution>, <addr-line><named-content content-type="city">Beijing</named-content></addr-line>, <country>China</country></aff></contrib-group><contrib-group content-type="section"><contrib contrib-type="editor"><name><surname>Schekman</surname><given-names>Randy</given-names></name><role>Reviewing editor</role><aff><institution>Howard Hughes Medical Institute, University of California, Berkeley</institution>, <country>United States</country></aff></contrib></contrib-group><author-notes><corresp id="cor1"><label>*</label>For correspondence: <email>zhoubing@mail.tsinghua.edu.cn</email></corresp><fn fn-type="con" id="equal-contrib"><label>†</label><p>These authors contributed equally to this work</p></fn></author-notes><pub-date date-type="pub" publication-format="electronic"><day>15</day><month>08</month><year>2014</year></pub-date><pub-date pub-type="collection"><year>2014</year></pub-date><volume>3</volume><elocation-id>e03191</elocation-id><history><date date-type="received"><day>25</day><month>04</month><year>2014</year></date><date date-type="accepted"><day>07</day><month>07</month><year>2014</year></date></history><permissions><copyright-statement>© 2014, Xiao et al</copyright-statement><copyright-year>2014</copyright-year><copyright-holder>Xiao et al</copyright-holder><license xlink:href="http://creativecommons.org/licenses/by/4.0/"><license-p>This article is distributed under the terms of the <ext-link ext-link-type="uri" xlink:href="http://creativecommons.org/licenses/by/4.0/">Creative Commons Attribution License</ext-link>, which permits unrestricted use and redistribution provided that the original author and source are credited.</license-p></license></permissions><self-uri content-type="pdf" xlink:href="elife03191.pdf"/><abstract><object-id pub-id-type="doi">10.7554/eLife.03191.001</object-id><p>The intracellular iron transfer process is not well understood, and the identity of the iron transporter responsible for iron delivery to the secretory compartments remains elusive. In this study, we show <italic>Drosophila</italic> ZIP13 (Slc39a13), a presumed zinc importer, fulfills the iron effluxing role. Interfering with dZIP13 expression causes iron-rescuable iron absorption defect, simultaneous iron increase in the cytosol and decrease in the secretory compartments, failure of ferritin iron loading, and abnormal collagen secretion. dZIP13 expression in <italic>E. coli</italic> confers upon the host iron-dependent growth and iron resistance. Importantly, time-coursed transport assays using an iron isotope indicated a potent iron exporting activity of dZIP13. The identification of dZIP13 as an iron transporter suggests that the spondylocheiro dysplastic form of Ehlers–Danlos syndrome, in which hZIP13 is defective, is likely due to a failure of iron delivery to the secretory compartments. Our results also broaden our knowledge of the scope of defects from iron dyshomeostasis.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.001">http://dx.doi.org/10.7554/eLife.03191.001</ext-link></p></abstract><abstract abstract-type="executive-summary"><object-id pub-id-type="doi">10.7554/eLife.03191.002</object-id><title>eLife digest</title><p>Iron is essential for life. Amongst its many important roles, iron is crucial for producing collagen—the protein that provides both strength and elasticity to bones, tendons, ligaments, and skin. Like many other proteins, collagens are produced inside the endoplasmic reticulum—an organelle inside the cell that is enclosed by a membrane that is similar to the plasma membrane that surrounds the cell itself.</p><p>Two enzymes that are critical for producing collagen need to bind with iron in order to work correctly. To do this, iron in the cytoplasm of the cell has to cross the membrane that surrounds the endoplasmic reticulum. Small molecules are commonly transported across membranes by proteins called transporters, which tend to work on specific types of ions or molecules. However, researchers did not know the identity of the membrane transporter responsible for moving iron into the secretory pathway—including the endoplasmic reticulum—to bind with the enzymes that produce collagen.</p><p>Xiao, Wan et al. have now investigated the function of the transporter ZIP13 in the fruit fly <italic>Drosophila</italic>. This transporter was thought to transport zinc across membranes and into the cytoplasm. Instead, Xiao, Wan et al. found that ZIP13 transports iron out of the cytoplasm and into the endoplasmic reticulum.</p><p>Ehlers–Danlos syndrome is a condition that causes individuals to suffer from frequent joint dislocations, bone deformities, and fragile skin as a result of their body producing collagen incorrectly. One form of Ehlers–Danlos syndrome is caused by ZIP13 transporters working incorrectly. However, this was difficult to understand when it was thought that ZIP13 only transports zinc. The discovery that ZIP13 mostly transports iron rather than zinc can explain the link between this transporter and Ehlers–Danlos syndrome: if ZIP13 doesn't work, the collagen-building enzymes cannot get the iron they need to work properly.</p><p>Disorders caused by iron deficiencies are normally identified by a few tell-tale symptoms, such as anemia, but these are not seen in Ehlers–Danlos syndrome. Xiao, Wan et al. suggest that iron transport problems could therefore be behind a wider range of diseases and disorders than is currently known.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.002">http://dx.doi.org/10.7554/eLife.03191.002</ext-link></p></abstract><kwd-group kwd-group-type="author-keywords"><title>Author keywords</title><kwd>Slc39a13</kwd><kwd>iron transporter</kwd><kwd>secretory compartments</kwd><kwd>Ehlers–Danlos syndrome</kwd><kwd>Drosophila</kwd></kwd-group><kwd-group kwd-group-type="research-organism"><title>Research organism</title><kwd><italic>D. melanogaster</italic></kwd></kwd-group><funding-group><award-group id="par-1"><funding-source><institution-wrap><institution>National Basic Research Program of China</institution></institution-wrap></funding-source><award-id>2013CB910700, 2011CB910900</award-id><principal-award-recipient><name><surname>Zhou</surname><given-names>Bing</given-names></name></principal-award-recipient></award-group><award-group id="par-2"><funding-source><institution-wrap><institution-id institution-id-type="FundRef">http://dx.doi.org/10.13039/501100001809</institution-id><institution>National Natural Science Foundation of China</institution></institution-wrap></funding-source><award-id>31123004</award-id><principal-award-recipient><name><surname>Zhou</surname><given-names>Bing</given-names></name></principal-award-recipient></award-group><funding-statement>The funder had no role in study design, data collection and interpretation, or the decision to submit the work for publication.</funding-statement></funding-group><custom-meta-group><custom-meta><meta-name>elife-xml-version</meta-name><meta-value>2</meta-value></custom-meta><custom-meta specific-use="meta-only"><meta-name>Author impact statement</meta-name><meta-value><italic>Drosophila</italic> ZIP13 (Slc39a13), a presumed zinc importer, is responsible for iron delivery to the secretory pathway.</meta-value></custom-meta></custom-meta-group></article-meta></front><body><sec id="s1" sec-type="intro"><title>Introduction</title><p>Iron is critical to the function of a variety of proteins, including hemoglobin and myoglobin, various iron–sulfur proteins, and the electron transport chain. In addition, iron is a necessary component in the secretory pathway. For example, lysyl hydroxylase (LH, also referred to as PLOD) and collagen prolyl 4-hydroxylases (P4Hs) are two post-translational modifying enzymes localized to the lumen of endoplasmic reticulum, which use Fe<sup>2+</sup> as a cofactor (<xref ref-type="bibr" rid="bib39">Tuderman et al., 1977</xref>; <xref ref-type="bibr" rid="bib30">Pirskanen et al., 1996</xref>). These two enzymes are critical for the synthesis of collagen, a crucial part of the basement membrane, and are formed by a complicated process involving multiple co- or post-translational modifications (<xref ref-type="bibr" rid="bib27">Myllyharju and Kivirikko, 2004</xref>). While the types of collagens and genes found in mammals are very complex, only one type of collagen IV, encoded by two genes <italic>Viking</italic> (<italic>Vkg</italic>) and <italic>Cg25C</italic>, is found in <italic>Drosophila</italic>, and it constitutes a major structural component of basement membranes in the developing fly (<xref ref-type="bibr" rid="bib7">Fessler and Fessler, 1989</xref>).</p><p>In adidition to lysyl hydroxylase and prolyl hydroxylase, ferritin is another iron-dependent protein residing in the secretory pathway of <italic>Drosophila</italic>. In constrast to mammalian ferritin, which is predominantly found in the cytosol, <italic>Drosophila</italic> ferritin binds iron in the early secretory compartments and is then secreted into the circulation system (<xref ref-type="bibr" rid="bib22">Mandilaras et al., 2013</xref>; <xref ref-type="bibr" rid="bib34">Tang and Zhou, 2013a</xref>). This process is central for systemic iron supply as well as tissue iron detoxification (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>). Therefore, in comparison to mammals, it is expected that <italic>Drosophila</italic> will carry a larger amount of iron through this pathway and abnormalities in this process will lead to serious iron deficiency.</p><p>Despite considerate interest in iron homeostasis, the metabolic process of iron, particularly its intracellular trafficking, remains poorly characterized. One important question that remains unanswered is how cytoplasmic iron is transferred to the secretory pathway for the iron-dependent proteins found therein.</p><p>During the process of using the fruit fly as a model to decipher the functions of zinc transporter dZIP13, we unexpectedly discovered dZIP13 physiologically acts as an iron exporter. dZIP13 belongs to the metal transporter ZIP family (zinc-regulated and iron-regulated transporter proteins or Slc39a); members of this family was reported to generally promote zinc transport from the extracellular space or from intracellular vesicles to the cytoplasm (<xref ref-type="bibr" rid="bib20">Liuzzi et al., 2006</xref>). Our work thus identified the iron transporter required for iron loading in the secretory pathway, which is also the first time a ZIP member has been reported as an iron exporter. This finding implies that failure of iron delivery to the secretory compartments is probably the underlying cause for SCD-EDS (the spondylocheiro dysplastic Ehlers–Danlos syndrome, OMIM #612350), which is due to a mutation in hZIP13 (<xref ref-type="bibr" rid="bib8">Fukada et al., 2008</xref>; <xref ref-type="bibr" rid="bib9">Giunta et al., 2008</xref>). Because SCD-EDS displays none of the classical iron phenotypes, for example, anemia or iron accumulation toxicity, our results also suggest that iron dyshomeostasis is likely involved in a wider spectrum of biological abnormalities than previously thought.</p></sec><sec id="s2" sec-type="results"><title>Results</title><sec id="s2-1"><title>The putative <italic>Drosophila</italic> orthologue of human ZIP13 is involved in <italic>Drosophila</italic> dietary iron absorption</title><p>BLASTP searches using the amino acid sequences of mammalian ZIP family members revealed that the <italic>Drosophila</italic> genome encodes at least eight putative ZIP proteins (<xref ref-type="bibr" rid="bib21">Lye et al., 2012</xref>; <xref ref-type="bibr" rid="bib31">Qin et al., 2013</xref>). Among them, the protein encoded by <italic>CG7816</italic> shares the highest overall homology with human ZIP13 (45% identity and 58% similarity) (<xref ref-type="fig" rid="fig1">Figure 1A</xref>), and was named dZIP13 accordingly. In the phylogenetic tree, dZIP13 clusters together with hZIP13 and several other members including catsup (CG10449) and hZIP7 (<xref ref-type="fig" rid="fig1">Figure 1B</xref>), all belonging to the LIV-1 subfamily of zinc transporters or LZT proteins (<xref ref-type="bibr" rid="bib36">Taylor and Nicholson, 2003</xref>). Several typical features of ZIP family members (<xref ref-type="bibr" rid="bib14">Jeong and Eide, 2013</xref>) are found in dZIP13, including eight transmembrane domains (TM), particularly amphipathic TM4 and TM5, and a predicted extracellular/luminal location of both the amino and carboxyl termini. Notably for dZIP13 and hZIP13, there is only a single His residue in a generally histidine-rich region (2–14 His) between TM3 and TM4. The highly conserved potential metalloprotease His-Glu-<italic>X</italic>-<italic>X</italic>-His (HE<italic>XX</italic>H, where <italic>X</italic> is any amino acid) motif, located within TM5 (<xref ref-type="bibr" rid="bib2">Bin et al., 2011</xref>) of LZT proteins, is also found in dZIP13 (<xref ref-type="fig" rid="fig1">Figure 1A</xref>).<fig id="fig1" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.003</object-id><label>Figure 1.</label><caption><title>Sequence analysis of Drosophila ZIP13.</title><p>(<bold>A</bold>) Alignment of Drosophila ZIP13 (dZIP13, the top), human ZIP13 (hZIP13, the middle), and human ZIP4 (hZIP4, the bottom) proteins. Amino acid sequences for hZIP13, hZIP4, and dZIP13 (CG7816) were obtained from GenBank and aligned by HMHMM software. Black and pink shadings indicate respectively identical and conservative amino acids. The eight putative transmembrane (TM) regions are underlined and denoted as ‘TM I’ through ‘TM VIII’. (<bold>B</bold>) Phylogenetic tree analysis of human and putative Drosophila ZIP family members. The tree was generated using ClustalX version 1.81 and displayed with TreeView. Bootstrap probabilities for major clusters are shown by percentages. Accession numbers are listed for other Drosophila ZIPs used for the alignment.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.003">http://dx.doi.org/10.7554/eLife.03191.003</ext-link></p></caption><graphic xlink:href="elife03191f001"/></fig></p><p>To analyze the functions of dZIP13 in vivo, transgenic lines of <italic>Drosophila dZIP13</italic> RNAi and overexpression (<italic>dZIP13-RNAi</italic> and <italic>dZIP13-OE</italic>) were generated or obtained, and then tested for dZIP13 expression modulation. The <italic>dZIP13-RNAi</italic> and <italic>dZIP13-OE</italic> indeed efficiently altered expression of <italic>dZIP13</italic> at both the mRNA and protein levels (<xref ref-type="fig" rid="fig2s1">Figure 2—figure supplement1</xref> and <xref ref-type="fig" rid="fig2s2">Figure 2—figure supplement2</xref>). We initially anticipated dZIP13 as a zinc importer, similar to many other reported ZIP proteins. However, when <italic>dZIP13</italic> was tissue specifically knocked down or over-expressed with <italic>NP3084-Gal4</italic>, a driver specifically expressing the activator Gal4 and thus modulating dZIP13 in the midgut region, the iron levels of the whole body changed dramatically while the amount of zinc level stayed unaltered (<xref ref-type="fig" rid="fig2">Figure 2A</xref>). Compared to the control, the iron levels in the <italic>dZIP13-RNAi</italic> fly dropped to about 50% of the normal iron content, while iron amount in overexpressing fly increased. This finding was confirmed with different RNAi lines (data not shown), indicating it is not due to off-target effects. The iron effect of dZIP13 suggested to us dZIP13 might directly or indirectly affect dietary iron absorption in the gut.<fig-group><fig id="fig2" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.004</object-id><label>Figure 2.</label><caption><title><italic>dZIP13-RNAi</italic> flies display iron-rescuable defects.</title><p>(<bold>A</bold>) Body metal contents when dZIP13 expression was modulated. Shown are flies with modulated <italic>dZIP13</italic> expression in the midgut (<italic>NP3084</italic> as the Gal 4 driver). A significant decrease in the whole body iron content, but not that of zinc or copper, was observed in <italic>dZIP13-RNAi</italic> flies, while <italic>dZIP13</italic> overexpression led to an iron increase. Values represent three independent measurements and are normalized to the dry body weights; data are presented as means <underline>+</underline> SEM; <italic>n</italic> = 3 or 6. <italic>*</italic>p<0.05, *<italic>*</italic>p<0.01; two-tailed Student's <italic>t</italic> test. (<bold>B</bold>) The eclosion rate of ubiquitously-RNA-interferenced-<italic>dZIP13</italic> (<italic>Da > dZIP13</italic>-<italic>RNAi</italic>) larvae could be rescued by dietary iron supplementation. <italic>Da-Gal4</italic> was crossed to wild-type or <italic>dZIP13</italic>-<italic>RNAi</italic> flies on juice-agar plates. Newly hatched progeny were transferred to normal food, or food supplemented with ZnCl<sub>2</sub>, TEPN, FAC, or BPS. Percentages of flies that eclosed to adults were counted; <italic>n</italic> = 6 or 8. (<bold>C</bold>) A control showing that the same amount of zinc, iron, or chelators supplemented in the food had no effect on the eclosion rate of wild-type Drosophila. (<bold>D</bold>) The shortened lifespan of <italic>Da > dZIP13</italic>-<italic>RNAi</italic> adults was partially rescued by dietary iron supplementation but not zinc. Percentages of flies that eclosed to adults were counted; <italic>n</italic> = 5.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.004">http://dx.doi.org/10.7554/eLife.03191.004</ext-link></p></caption><graphic xlink:href="elife03191f002"/></fig><fig id="fig2s1" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.005</object-id><label>Figure 2—figure supplement 1.</label><caption><title>RT-PCR analysis of efficacy of <italic>dZIP13</italic> knockdown or overexpression.</title><p>RT-PCR analysis of <italic>dZIP13</italic> mRNA abundance in third instar larvae. <italic>rp49</italic> was used as the loading control. <italic>Da-GAL4</italic> was used as the expression driver.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.005">http://dx.doi.org/10.7554/eLife.03191.005</ext-link></p></caption><graphic xlink:href="elife03191fs001"/></fig><fig id="fig2s2" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.006</object-id><label>Figure 2—figure supplement 2.</label><caption><title>Western blot analysis of efficacy of <italic>dZIP13</italic> knockdown or overexpression.</title><p>Western blot showing that the RNAi used in this study suppressed dZIP13 protein to a significantly reduced level. Tubulin was used as the loading control. <italic>Da-GAL4</italic> was used as the expression driver.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.006">http://dx.doi.org/10.7554/eLife.03191.006</ext-link></p></caption><graphic xlink:href="elife03191fs002"/></fig></fig-group></p></sec><sec id="s2-2"><title>Ubiquitous reduction of dZIP13 resulted in developmental arrest that can be rescued by iron supplementation</title><p>Under normal dietary conditions, ubiquitous RNAi of <italic>dZIP13</italic> by <italic>daughterless</italic> (<italic>Da-Gal4</italic>) produced developmental arrest in the pupal stage (only about 10% eclosion rate) (<xref ref-type="fig" rid="fig2">Figure 2B</xref>). Amazingly, the eclosion defect resulting from dZIP13 knockdown could be rescued from ∼10% to ∼75% simply through dietary iron supplementation in the form of ferric ammonium citrate (FAC) (<xref ref-type="fig" rid="fig2">Figure 2B</xref>). Addition of 0.1 mM iron-specific chelator bathophenanthrolinedisulfonic acid disodium (BPS), on the other hand, exacerbated the phenotype as an even lower eclosion rate was observed (<xref ref-type="fig" rid="fig2">Figure 2B</xref>), indicating abnormal iron absorption indeed plays a critical role in causing the eclosion defect in <italic>dZIP13-RNAi</italic> flies. Zinc, a substrate of many ZIP proteins, also to some extent exacerbate the eclosion defect. When zinc was added to the diet, almost no adult flies could eclose (∼0% eclosion rate); however, addition of zinc chelator TPEN could ameliorate the phenotype slightly, although without statistical significance (<xref ref-type="fig" rid="fig2">Figure 2B</xref>). There have been several reports showing that iron absorption can be competitively inhibited by additional zinc (<xref ref-type="bibr" rid="bib32">Rossander-Hulten et al., 1991</xref>; <xref ref-type="bibr" rid="bib45">Whittaker, 1998</xref>). From that perspective it is possible that zinc addition to the food could exacerbate the iron deficiency phenotype of <italic>dZIP13-RNAi</italic> flies. Simultaneous addition of both zinc and iron could still rescue the eclosion defect very effectively (∼65% eclosion rate, statistically insignificant with iron only). The wild type flies' eclosion rate, in contrast, remained the same either in iron supplemented or deficient, zinc supplemented or deficient food (<xref ref-type="fig" rid="fig2">Figure 2C</xref>). The dramatic rescue by iron instead of zinc suggests that lack of iron is the primary defect in <italic>dZIP13-RNAi</italic> flies, and the zinc effect is minimal and likely secondary. As a result of this unexpected finding, our original focus of dZIP13's function in zinc homeostasis was subsequently switched to investigating its role in iron homeostasis.</p><p>Consistent with the results obtained in the eclosion experiments, the lifespan of <italic>dZIP13-RNAi</italic> flies was also prolonged by iron addition in the food (<xref ref-type="fig" rid="fig2">Figure 2D</xref>): the flies raised on iron supplemented food have a prolonged median lifespan (∼25 days) compared with files raised on normal food (∼4 days). Addition of zinc to the diet shortened their lifespan (median lifespan of ∼1 day). No significant differences of lifespans were found between normal food and BPS or TPEN food.</p></sec><sec id="s2-3"><title>dZIP13 knockdown results in iron deficiency of the whole body except the cytosol of the gut cells</title><p>The activity of aconitase is often used as a molecular indicator for the availability of iron in the cell (<xref ref-type="bibr" rid="bib11">Haile et al., 1992</xref>; <xref ref-type="bibr" rid="bib33">Suzuki et al., 2005</xref>). There are two types of aconitase in cells, the cytosolic aconitase (c-aconitase) and the mitochondrial aconitase (m-aconitase). Cytosolic aconitase needs to bind iron for its enzymatic activity and is an indicator of the cytosolic iron level (<xref ref-type="bibr" rid="bib11">Haile et al., 1992</xref>; <xref ref-type="bibr" rid="bib38">Tong and Rouault, 2006</xref>). As shown in <xref ref-type="fig" rid="fig3">Figure 3</xref>, the in-gel aconitase activity assay allowed clear separation of <italic>Drosophila</italic> m-aconitase and c-aconitase, providing a convenient method to evaluate the levels of iron in the two different subcellular compartments (<xref ref-type="bibr" rid="bib38">Tong and Rouault, 2006</xref>).<fig id="fig3" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.007</object-id><label>Figure 3.</label><caption><title><italic>dZIP13</italic> knockdown led to iron deficiency in the body but not the cytosol of gut cells.</title><p>(<bold>A</bold>) Cytosolic aconitase activity was increased in the gut of <italic>NP3084</italic>><italic>dZIP13</italic>-<italic>RNAi</italic> larvae and decreased in <italic>NP3084</italic>><italic>dZIP13-OE</italic> larvae, suggesting respectively iron elevation and iron deficiency in the cytoplasm. Panel (b) was quantitative measurement of (a). Results are presented as mean <underline>+</underline> SEM relative activity; <italic>n</italic> = 3. <italic>*</italic>p<0.05, *<italic>*</italic>p<0.01, **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test. (<bold>B</bold>) Cytosolic aconitase activity was decreased in the whole body minus gut (body parts other than the gut) of <italic>NP3084</italic>><italic>dZIP13</italic>-<italic>RNAi</italic> larvae and increased in <italic>NP3084</italic>><italic>dZIP13-OE</italic> larvae. Panel (b) was quantitative measurement of (a). Results are presented as mean <underline>+</underline> SEM relative activity; <italic>n</italic> = 3. <italic>*</italic>p<0.05, *<italic>*</italic>p<0.01, **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test. (<bold>C</bold>) RT-PCR analysis of iron homeostasis genes of normal flies in response to iron changes (feeding with iron or chelator). RNA was made from third instar larvae midguts. <italic>rp49</italic> was used as the loading control. (<bold>D</bold>) RT-PCR analysis of iron homeostasis genes in the midgut of dZIP13 RNAi or OE third instar larvae. Expression is driven by the midgut driver <italic>NP3084</italic>. (<bold>E</bold>) An analysis of metal contents in the gut when dZIP13 expression was modulated. Shown are metal levels from fly larvae with modulated <italic>dZIP13</italic> expression in the midgut (<italic>NP3084</italic> as the Gal 4 driver). A significant decrease in the gut iron, but not zinc or copper, was observed in <italic>dZIP13-RNAi</italic> flies; <italic>dZIP13</italic> overexpression led to an iron increase. Results are presented as mean <underline>+</underline> SEM relative activity; <italic>n</italic> = 3. <italic>*</italic>p<0.05, *<italic>*</italic>p<0.01, **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test. (<bold>F</bold>) An analysis of metal contents in the whole-body-minus-gut parts when dZIP13 expression was modulated in the larval midgut (<italic>NP3084</italic> as the Gal 4 driver). A significant decrease in the whole-body-minus-gut iron, but not zinc or copper, was observed in <italic>dZIP13-RNAi</italic> flies; <italic>dZIP13</italic> overexpression led to an iron increase. Results are presented as mean <underline>+</underline> SEM relative activity; <italic>n</italic> = 3. <italic>*</italic>p<0.05, *<italic>*</italic>p<0.01, **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.007">http://dx.doi.org/10.7554/eLife.03191.007</ext-link></p></caption><graphic xlink:href="elife03191f003"/></fig></p><p>We examined how the gut itself would be affected when dZIP13 was specifically knocked down in the gut. As shown in <xref ref-type="fig" rid="fig3">Figure 3A</xref>, <italic>dZIP13-RNAi</italic> larvae exhibited ∼35% more c-aconitase activity in the gut as compared to the control larvae while <italic>dZIP13-OE</italic> larvae showed ∼20% c-aconitase activity reduction. In contrast to this finding, in the remaining body parts (i.e., the whole body minus the gut) of <italic>dZIP13-RNAi</italic> larvae, c-aconitase activity was significantly reduced when compared to the control larvae, implying a general lack of iron in the body parts other than the gut. Conversely, c-aconitase activity was significantly elevated in <italic>dZIP13-OE,</italic> implying an iron elevation in the other body parts (<xref ref-type="fig" rid="fig3">Figure 3B</xref>).</p><p>Because the labile iron–sulfur cluster of aconitase is also subjected to conditions other than iron levels, such as oxidative stress, we further analyzed how genes involved in iron homeostasis might respond when dZIP13 expression is modulated. We reasoned that because these iron metabolism genes are sensitive to iron availability, their behaviors would also be a good indicator of cytosolic iron levels. Under iron deficiency, ferritin and iron uptake protein <italic>Malvolio (Mvl)</italic> is respectively down- and up-regulated, while under iron surplus, vice versa (<xref ref-type="fig" rid="fig3">Figure 3C</xref>) (<xref ref-type="bibr" rid="bib23">Missirlis et al., 2007</xref>; <xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>). Indeed, when dZIP13 was knocked-down, ferritin was significantly up-regulated while <italic>Mvl</italic> down-regulated, very much akin to the scenario when the larvae were fed with iron-supplemented diet (<xref ref-type="fig" rid="fig3">Figure 3D</xref>, also see <xref ref-type="fig" rid="fig4">Figure 4E</xref> for ferritin protein levels). These results indicate dZIP13-RNAi larvae sensed a state of iron-replete condition in the cytosol of their gut cells, consistent with the above aconitase activity results.<fig-group><fig id="fig4" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.008</object-id><label>Figure 4.</label><caption><title><italic>dZIP13</italic> knockdown results in reduced ferritin iron loading in the gut.</title><p>(<bold>A</bold>) Staining of ferric iron in the larval gut. The staining in the midgut constriction and ectopic ferric staining in the anterior midgut are noted separately by arrows (blue) and arrow heads (green). The anterior midgut of <italic>NP3084>dZIP13-OE</italic> fly larvae deposited obviously a higher amount of iron than the control. Ferric iron significantly accumulated in the iron cell region of <italic>NP3084>dZIP13-OE</italic> while <italic>NP3084</italic>><italic>dZIP13</italic>-<italic>RNAi</italic> adults showed almost no iron staining. Shown are representative images and in bright and dark fields. More images are shown in <xref ref-type="fig" rid="fig4s1">Figure 4—figure supplement 1</xref>. (<bold>B</bold>) Staining of ferric iron in the anterior midgut of iron-fed larvae. The anterior midgut follows the preceding distinct proventriculus (pv, red arrowheads). (<bold>C</bold>) Staining of ferric iron (bound to ferritin) on native PAGE. Same amounts of total protein extracts from control and <italic>NP3084</italic>><italic>dZIP13</italic>-<italic>RNAi</italic> or <italic>NP3084</italic>><italic>dZIP13-OE</italic> larval guts were loaded. The gel was directly stained with Prussian blue staining solution. For an intact gel image, see <xref ref-type="fig" rid="fig4s2">Figure 4—figure supplement 2</xref>. Panel (b) was quantitative measurement of (a). n = 3. <italic>*</italic>p<0.05, **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test. (<bold>D</bold>) Ferritin expression in the gut. An obviously higher amount of ferritin was expressed in the gut of <italic>NP3084>dZIP13-RNAi</italic> larvae. The expression of ferritin was indicated with a protein trap line <italic>Fer1HCH</italic><sup><italic>G188</italic></sup>, which tags the endogenous Fer1HCH through an N-terminal GFP fusion. Shown are representative results and more images are shown in <xref ref-type="fig" rid="fig4s3">Figure 4—figure supplement 3</xref>. (<bold>E</bold>) Western blot of ferritin of <italic>NP3084>dZIP13-RNA</italic>i and <italic>NP3084</italic>><italic>dZIP13</italic>-<italic>OE</italic> larvae. Anti-ferritin light chain antibody was used. Tubulin was used as a loading control. For an intact gel image, see <xref ref-type="fig" rid="fig4s4">Figure 4—figure supplement 4</xref>. Panel (b) was quantitative measurement of (a). n = 3. **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test. (<bold>F</bold>) Eclosion rescue of ferritin-RNAi by dZIP13. The eclosion rate of gut-specific (<italic>NP3084</italic>) <italic>ferritin-RNAi</italic> flies was rescued from <5% to ∼30% by <italic>dZIP13</italic> overexpression. Newly hatched progeny were transferred to normal food, and percentages of flies that eclosed to adults were counted. <italic>n</italic> = 6. **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test. (<bold>G</bold>) Rescue of iron deficiency of ferritin-RNAi by dZIP13. The reduced body iron content in gut-specific ferritin-knockdown larvae was also partially rescued by <italic>dZIP13</italic> overexpression. <italic>n</italic> = 6. *<italic>*</italic>p<0.01; two-tailed Student's <italic>t</italic> test.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.008">http://dx.doi.org/10.7554/eLife.03191.008</ext-link></p></caption><graphic xlink:href="elife03191f004"/></fig><fig id="fig4s1" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.009</object-id><label>Figure 4—figure supplement 1.</label><caption><title>Staining of ferric iron in the larval gut.</title><p>The ferric staining in the midgut constriction and the ectopic ferric staining in the anterior midgut are noted separately by arrows (blue) and arrow heads (green). The anterior midgut of <italic>NP3084>dZIP13-OE</italic> fly larvae deposited an obviously higher amount of iron than the control. Ferric iron accumulated prominently in the iron cell region of <italic>NP3084>dZIP13-OE</italic> while <italic>NP3084</italic>><italic>dZIP13</italic>-<italic>RNAi</italic> larvae showed almost no iron staining. (<bold>A</bold>), (<bold>B</bold>) and (<bold>C</bold>) are results from three independent experiments.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.009">http://dx.doi.org/10.7554/eLife.03191.009</ext-link></p></caption><graphic xlink:href="elife03191fs003"/></fig><fig id="fig4s2" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.010</object-id><label>Figure 4—figure supplement 2.</label><caption><title>Staining of ferric iron (bound to ferritin) on native PAGE.</title><p>Same amounts of total protein extracted from control and <italic>NP3084</italic>><italic>dZIP13</italic>-<italic>RNAi</italic> or <italic>NP3084</italic>><italic>dZIP13-OE</italic> larvae guts were loaded. The gel was stained with Prussian blue staining solution.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.010">http://dx.doi.org/10.7554/eLife.03191.010</ext-link></p></caption><graphic xlink:href="elife03191fs004"/></fig><fig id="fig4s3" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.011</object-id><label>Figure 4—figure supplement 3.</label><caption><title>A significantly higher amount of ferritin was detected in the gut of NP3084>dZIP13-RNAi fly larvae.</title><p>The expression of ferritin was indicated with a protein trap line <italic>Fer1HCH</italic><sup><italic>G188</italic></sup> expressing an N-terminal GFP-tagged Fer1HCH protein. Shown are images from the bright and dark fields. (<bold>A</bold>) and (<bold>B</bold>) are results from two independent experiments.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.011">http://dx.doi.org/10.7554/eLife.03191.011</ext-link></p></caption><graphic xlink:href="elife03191fs005"/></fig><fig id="fig4s4" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.012</object-id><label>Figure 4—figure supplement 4.</label><caption><title>Western blot of ferritin of <italic>NP3084>dZIP13-RNA</italic>i and <italic>NP3084>dZIP13</italic>-<italic>OE</italic> larvae.</title><p>Anti-ferritin light chain antibody was used. Tubulin was used as the loading control.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.012">http://dx.doi.org/10.7554/eLife.03191.012</ext-link></p></caption><graphic xlink:href="elife03191fs006"/></fig></fig-group></p><p>To directly quantify the total iron amount, we further performed ICP-MS (inductively coupled plasma-mass spectrometry) analysis of the gut and other body parts (whole body-gut). Both the gut and the rest of the body as a whole exhibited iron reduction after <italic>dZIP13</italic> knockdown and iron increase when <italic>dZIP13</italic> was overexpressed (<xref ref-type="fig" rid="fig3">Figure 3E</xref> and <xref ref-type="fig" rid="fig3">Figure 3F</xref>).</p><p>Therefore, when <italic>dZIP13</italic> was knocked down in the gut, the rest of the body experienced iron shortage. In the gut, however, although the total iron was lower, iron in the cytosol appeared to not be reduced, suggesting that dZIP13 is involved in iron extrusion from the gut to the body. Because ferritin is the major iron storage protein and is located in the secretory pathway in <italic>Drosophila</italic>, we speculate that when dZIP13 is down-regulated in the gut, iron may not be able to move from the cytosol to the secretory compartments, resulting in iron elevation in the cytosol, a feedback control of iron uptake and an overall reduction of iron in both the gut and the rest of the body.</p></sec><sec id="s2-4"><title>dZIP13 is essential to ferric iron loading in the secretory pathway</title><p>Because dZIP13 affects iron absorption as shown above, and it is known that the dietary iron absorption is mediated by ferritin in <italic>Drosophila</italic> (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>), we next investigated the influence of dZIP13 on ferritin iron assimilation. Ferritin, a heteropolymer composed of H and L subunits, can accommodate thousands of iron atoms in its protein shell in the ferric form. Ferritin is thought to be the major cytosolic iron-storage protein in mammalian organisms (<xref ref-type="bibr" rid="bib1">Andrews, 2005</xref>; <xref ref-type="bibr" rid="bib17">Knovich et al., 2009</xref>), while in <italic>Drosophila</italic>, unlike mammals, ferritin sequences of both the H and L chains contain secretion signals, confining them to the secretory pathway and making them abundant in the hemolymph (<xref ref-type="bibr" rid="bib28">Nichol et al., 2002</xref>). A major function of <italic>Drosophila</italic> ferritin is absorption of dietary iron through iron loading and transporting via the secretory pathway supplying iron for the systemic use (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>). If dZIP13 is responsible for iron loading into the early secretory pathway, we expect it might affect ferritin iron assimilation.</p><p>To explore this possibility, we stained the intestines from dZIP13-modulated fly larvae for ferric iron, which is mainly loaded in ferritin. In the iron cell region (a cluster of cells in the middle midgut region where iron absorption occurs) of <italic>dZIP13-RNAi</italic> larvae, we were unable to detect obvious iron signal, whereas a distinct blue iron-staining signal could be observed in the normal fly larvae (<xref ref-type="fig" rid="fig4">Figure 4A</xref>, <xref ref-type="fig" rid="fig4s1">Figure 4—figure supplement1</xref>), suggesting a lack of iron incorporation into ferritin after dZIP13 interference. Conversely, overexpression of dZIP13 led to a stronger staining in the iron cell region, and ectopically in the anterior midgut (<xref ref-type="fig" rid="fig4">Figure 4A</xref>, <xref ref-type="fig" rid="fig4s1">Figure 4—figure supplement1</xref>). This result is reminiscent of the observation that high iron levels, such as 5 mM FAC, can also induce ectopic ferric iron staining in the anterior midgut, suggesting an iron accumulation occurs in the secretory pathway of the gut cells when dZIP13 is overexpressed. Under high levels of dietary iron, iron was only faintly stained in the <italic>dZIP13-RNAi</italic> larvae, whereas staining was much stronger in dZIP13 overexpression larvae (<xref ref-type="fig" rid="fig4">Figure 4B</xref>). This indicates that in the gut of <italic>dZIP13-RNAi</italic> larvae much less ferric ion is accumulated in ferritin. A native-PAGE staining for ferric iron further confirmed that the intestinal ferritin was indeed poorly loaded with iron in the <italic>dZIP13-RNAi</italic> larvae while the iron loading in the <italic>dZIP13-OE</italic> larvae was mildly elevated (<xref ref-type="fig" rid="fig4">Figure 4C</xref>, <xref ref-type="fig" rid="fig4s2">Figure 4—figure supplement2</xref>).</p><p>To exclude the possibility that the poor iron loading observed in <italic>dZIP13-RNAi</italic> larvae was the result of poor ferritin expression, a protein trap line <italic>Fer1HCH</italic><sup><italic>G188</italic></sup>, which expresses an N-terminal GFP-tagged Fer1HCH, was used to indicate the ferritin expression pattern in the gut (<xref ref-type="bibr" rid="bib23">Missirlis et al., 2007</xref>). As shown in <xref ref-type="fig" rid="fig4">Figure 4D</xref> and reported previously (<xref ref-type="bibr" rid="bib23">Missirlis et al., 2007</xref>), in flies reared with standard food, GFP-tagged ferritin was most prominently expressed in the iron cell region. When dZIP13 expression was knocked down, expression of ferritin was ectopically and significantly induced in the anterior and posterior midguts, and was constitutively expressed in the iron cell region (<xref ref-type="fig" rid="fig4">Figure 4D</xref>, <xref ref-type="fig" rid="fig4s3">Figure 4—figure supplement3</xref>). This expression pattern of ferritin was repeated when flies were administered a diet containing 5 mM ferric ammonium citrate (<xref ref-type="bibr" rid="bib23">Missirlis et al., 2007</xref>), indicating iron is in excess in certain parts of the gut cells when <italic>dZIP13</italic> is RNA interfered, consistent with the above studies in assessing cytosolic iron status of gut cells. Induction of ferritin expression in <italic>dZIP13-RNAi</italic> larvae was confirmed with a Western blot using a ferritin antibody against ferritin. A dramatic increase of ferritin level was seen in <italic>dZIP13-RNAi</italic> larvae, with a decrease observed in the <italic>dZIP13-OE</italic> larvae (<xref ref-type="fig" rid="fig4">Figure 4E</xref>, <xref ref-type="fig" rid="fig4s4">Figure 4—figure supplement4</xref>).</p><p>An obvious genetic interaction of dZIP13 and ferritin was detected when dZIP13 was overexpressed in ferritin-RNAi flies. Midgut-specific ferritin RNAi leads to systemic iron deficiency. Ferritin RNAi with gut-specific driver (<italic>NP3084</italic>) causes decreased total body iron contents, retarded growth, and death of most of the progeny at the larval or pupal stage (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>). Notably, the eclosion rate of these flies could be rescued from <5–30% through overexpressing <italic>dZIP13</italic> (<xref ref-type="fig" rid="fig4">Figure 4F</xref>). Consistently, the decreased total body iron content of midgut-specific ferritin RNAi larvae could also be partially rescued by <italic>dZIP13</italic> overexpression (<xref ref-type="fig" rid="fig4">Figure 4G</xref>).</p><p>These results suggest that knockdown of dZIP13 would inhibit iron transport into the secretory pathway to be available to ferritin, reducing iron export from the gut for systemic use, while overexpressing dZIP13 would increase body iron amount by facilitating more iron transportation into the secretion pathway, making less iron available in the cytosol of the gut cells.</p></sec><sec id="s2-5"><title>dZIP13 is intracellularly located to ER/Golgi and involved in their iron homeostasis</title><p>Locations of hZIP13 have been reported in Golgi and some intracellular vesicles (<xref ref-type="bibr" rid="bib8">Fukada et al., 2008</xref>; <xref ref-type="bibr" rid="bib15">Jeong et al., 2012</xref>). To examine the intracellular position of dZIP13, a C-terminal myc-tagged dZIP13 was introduced into human intestinal Caco2 cells. Immunofluorescence staining indicated it partially overlapped with ER and Golgi (<xref ref-type="fig" rid="fig5">Figure 5A</xref>). A similarly tagged (at the C-terminal) dZIP13-EGFP was made and expressed in the flies and shown to be functional. This dZIP13-EGFP is also partially located to the Golgi apparatus (data not shown). To check the intracellular positions of endogenous dZIP13 in the <italic>Drosophila</italic> gut, we generated an antibody against dZIP13. The specificity of the antibody was confirmed by significantly reduced staining in <italic>dZIP13-RNAi</italic> larvae and loss of staining in dZIP13 mutant. Once more we observed an obvious overlapping of dZIP13 with the ER/Golgi apparatus in the <italic>Drosophila</italic> gut staining, along with some staining in additional intracellularlocations (<xref ref-type="fig" rid="fig5">Figure 5B</xref>). Co-localization of dZIP13 with endosome markers, however, was poor (<xref ref-type="fig" rid="fig5">Figure 5C</xref>).<fig id="fig5" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.013</object-id><label>Figure 5.</label><caption><title>dZIP13 is located to ER/Golgi and involved in their iron regulation.</title><p>(<bold>A</bold>) The localization of dZIP13 in Caco2 cells. dZIP13-myc was detected by myc antibody. This immunofluorescence staining showed that dZIP13 partially co-localizes with the ER/Golgi in Caco2 cells. (<bold>B</bold>) The localization of dZIP13 in Drosophila midgut epithelial cells. dZIP13 was detected directly by dZIP13 antibody. These images indicated dZIP13 partially co-localizes with ER/Golgi in Drosophila gut cells. (<bold>C</bold>) dZip13 does not co-localize well with endosome markers. The localizations of dZIP13 and endosomes in Drosophila midgut epithelial cells were shown. dZIP13 was detected directly with dZIP13 antibody. Lysosome-associated membrane protein 1 (LAMP1) fused with GFP was used to indicate lysosomes and late endosomes; FYVE was used to mark the early endosomes. (<bold>D</bold>) Less iron in ER/Golgi from <italic>dZIP13-RNAi</italic> larvae and more in that of <italic>dZIP13-OE</italic> larvae. Copper was not affected while zinc contents were marginally different. <italic>n</italic> = 3. <italic>*</italic>p<0.05, **<italic>*</italic>p<0.001; 2-tailed Student's <italic>t</italic> test.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.013">http://dx.doi.org/10.7554/eLife.03191.013</ext-link></p></caption><graphic xlink:href="elife03191f005"/></fig></p><p>As previously discussed, the ferritin-loading experiments indicate iron homeostasis is affected in the secretory pathway after dZIP13 RNA interference. Because dZIP13 is expressed in the secretory pathway, we wondered whether iron levels are lower in these compartments when dZIP13 expression is inhibited. Metal content of ER/Golgi was tested and results showed that the iron level of these compartments was indeed reduced in <italic>dZIP13-RNAi</italic> and increased in <italic>dZIP13-OE</italic> larvae (<xref ref-type="fig" rid="fig5">Figure 5D</xref>). Zinc level was marginally altered in these compartments, but negatively correlated to iron levels (<xref ref-type="fig" rid="fig5">Figure 5D</xref>). We are not sure, however, if it is a secondary effect of disrupted iron levels or a result of some residual zinc importing activity of dZIP13.</p></sec><sec id="s2-6"><title>Heterologous dZIP13 expression confers <italic>E. coli</italic> cells iron-dependent growth and iron resistance</title><p>No previous reports have shown a ZIP protein can be a metal exporter. The potential intracellular localization of dZIP13 makes direct assays of its metal transporting activity with intact cells difficult. We reasoned that if dZIP13 indeed functions as a membrane iron exporter, when expressed in <italic>E. coli</italic>, a heterologous platform lacking the sophisticated intracellular membrane system as in eukaryote cells, it might locate to the plasma membrane and facilitate iron cellular export directly outside of the cell. Interestingly, expression of dZIP13 in <italic>E. coli</italic> resulted in very poor growth under normal conditions. Strikingly, growth was partially restored in iron replete conditions whereas zinc had no effect (<xref ref-type="fig" rid="fig6">Figure 6A</xref>), indicating the lack of growth of <italic>E. coli</italic> with dZIP13 expression was due to intracellular iron deficiency. dZIP13 expression also rendered <italic>E. coli</italic> more resistant to iron stresses compared with the control (<xref ref-type="fig" rid="fig6">Figure 6A</xref>). Further analysis of cellular iron contents indicated that with iron-rich medium (2 mM iron), expression of dZIP13 reduced the iron level of the cells, while the change of zinc was insignificant (<xref ref-type="fig" rid="fig6">Figure 6B</xref>). These results suggest that heterologous expression of dZIP13 in <italic>E. coli</italic>, a foreign and arguably a relatively clean system, can reduce intracellular iron availability to cells.<fig id="fig6" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.014</object-id><label>Figure 6.</label><caption><title>Heterologous dZIP13 expression renders the growth of <italic>E. coli</italic> iron-dependent and iron-resistant.</title><p>(<bold>A</bold>) <italic>E. coli</italic> expressing dZIP13 required iron addition to grow and was more resistant to iron excess. (<bold>B</bold>) Less iron content was detected in <italic>E. coli</italic> expressing dZIP13 while zinc and copper were not much affected. <italic>n</italic> = 3. **<italic>*</italic>p<0.001; two-tailed Student's <italic>t</italic> test.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.014">http://dx.doi.org/10.7554/eLife.03191.014</ext-link></p></caption><graphic xlink:href="elife03191f006"/></fig></p></sec><sec id="s2-7"><title>Radioisotope transporting experiments demonstrate dZIP13 as an iron exporter</title><p>Although previous data strongly suggest dZIP13 functions as an iron exporter, they have yet to provide direct proof. One experiment to show a protein as an iron exporter is via a radioactive Fe transport assay. Ferroportin, a plasma membrane iron exporter, for example, has been successfully shown to mediate iron export in <italic>Xenopus</italic> oocytes, by using Fe isotopes and measuring intracellular and extracellular radioactivity levels (<xref ref-type="bibr" rid="bib6">Donovan et al., 2000</xref>). However, as stated above, dZIP13 is located intracellularly and its expression would only directly alter redistribution of iron inside the cell rather than exporting iron out of the cell, as was seen with ferroportin in the oocyte. In order to show dZIP13 indeed acts as an iron exporter, we decided to measure iron effluxing activity of dZIP13 when expressed in <italic>E. coli</italic>, taking advantage of the fact that the only membrane an <italic>E. coli</italic> cell has is its plasma membrane. When dZIP13 is located on the plasma membrane, the radioisotope exporting activity can be directly measured by monitoring the radioactivity in the external buffer. A time-course study of iron transportation in <italic>E. coli</italic> expressing dZIP13 is shown in <xref ref-type="fig" rid="fig7">Figure 7A</xref>. The amount of iron exported from <italic>E. coli</italic> expressing dZIP13 increased roughly linearly within the tested time and was significantly higher in comparison to the control. Labeling with anti-dZIP13 indicates that dZIP13 was indeed located on the membrane of <italic>E. coli</italic> cells, while control with the empty vector was with minimal signal (<xref ref-type="fig" rid="fig7">Figure 7B</xref>). These results demonstrate that dZIP13 in <italic>E. coli</italic> is capable of exporting iron out of the cell.<fig-group><fig id="fig7" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.015</object-id><label>Figure 7.</label><caption><title>Iron radioisotope transport indicates dZIP13 as an iron exporter.</title><p>(<bold>A</bold>) A time-course of iron released from dZIP13-expressing <italic>E. coli</italic> cells. dZIP13 expression in <italic>E. coli</italic> significantly increased the iron efflux rate than the vector control. (<bold>B</bold>) Imunofluoresence of <italic>E. coli</italic> expressing dZIP13 indicated that at least some dZIP13 was located on the membrane of <italic>E. coli</italic>. (<bold>C</bold>) NADPH-cytochrome c reductase activity assay showed that the ER–Golgi preparation was indeed enriched with a large amount of ER/Golgi. (<bold>D</bold>) A time-course of iron uptake into the ER/Golgi sample. The rate of iron uptake was much higher in <italic>dZIP13-OE</italic> and lower in <italic>dZIP13-RNAi</italic> ER/Golgi samples.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.015">http://dx.doi.org/10.7554/eLife.03191.015</ext-link></p></caption><graphic xlink:href="elife03191f007"/></fig><fig id="fig7s1" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.016</object-id><label>Figure 7—figure supplement 1.</label><caption><title>Western blot showing that the ER/Golgi samples purified contain both ER and Golgi.</title><p>Golgi and ER were detected with anti-GM130 and anti-PDI antibodies respectively.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.016">http://dx.doi.org/10.7554/eLife.03191.016</ext-link></p></caption><graphic xlink:href="elife03191fs007"/></fig><fig id="fig7s2" position="float" specific-use="child-fig"><object-id pub-id-type="doi">10.7554/eLife.03191.017</object-id><label>Figure 7—figure supplement 2.</label><caption><title>Purity of the ER/Golgi samples isolated from Drosophila.</title><p>(<bold>A</bold>) Cytochrome c oxidase assay indicated that the purified samples still contained some residual mitochondrial parts. (<bold>B</bold>) β-N-Acetylglucosaminidase (NAG) activity assay showed that the samples were essentially free of lysomal contamination.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.017">http://dx.doi.org/10.7554/eLife.03191.017</ext-link></p></caption><graphic xlink:href="elife03191fs008"/></fig></fig-group></p><p>We further isolated ER/Golgi from <italic>Drosophila</italic> larvae and tested their iron transporting activity. In this case, dZIP13 would transport iron into the ER/Golgi apparatus. By testing activities of enzymes for different compartments, we were able to determine that our extract preparations were reasonably pure except for some residual mitochondria (<xref ref-type="fig" rid="fig7">Figure 7C</xref>, <xref ref-type="fig" rid="fig7s1">Figure 7—figure supplement1</xref> and <xref ref-type="fig" rid="fig7s2">Figure 7—figure supplement2</xref>). The results shown in <xref ref-type="fig" rid="fig7">Figure 7D</xref> indicate that the iron uptake of ER/Golgi isolated from <italic>dZIP13-OE Drosophila</italic> larvae was significantly increased whereas that from <italic>dZIP13-RNAi</italic> was decreased. Again, a linear correlation between time and radioactivity was observed. Collectively, these results provide strong direct evidences in support of our hypothesis that dZIP13 is responsible for iron transport from the cytoplasm into the secretory pathway.</p></sec><sec id="s2-8"><title>Human ZIP13 can partially substitute dZIP13's functions in <italic>Drosophila</italic></title><p>Bioinformatics analysis indicates that dZIP13 shares the highest homology with human ZIP13 (<xref ref-type="fig" rid="fig1">Figure 1A</xref>, <xref ref-type="fig" rid="fig1">Figure 1B</xref>). Because ubiquitous overexpression of dZIP13 resulted in reduced body aconitase activity, we wanted to see whether overexpression of hZIP13 would cause a similar effect in the fly. Indeed, hZIP13 overexpression in <italic>Drosophila</italic> also led to a decrease of overall aconitase activity (<xref ref-type="fig" rid="fig8">Figure 8A</xref>), suggesting hZIP13 similarly affected iron metabolism in <italic>Drosophila</italic>. Moreover, a survival assay showed that expression of <italic>hZIP13</italic> rescued the eclosion rate of <italic>dZIP13</italic>-RNAi larvae from 40% to 75% (<xref ref-type="fig" rid="fig8">Figure 8B</xref>), and doubled the lifespan of <italic>dZIP13-RNAi</italic> flies (<xref ref-type="fig" rid="fig8">Figure 8C</xref>).<fig id="fig8" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.018</object-id><label>Figure 8.</label><caption><title>dZIP13 is functionally analogous to hZIP13.</title><p>(<bold>A</bold>) Decreased aconitase activity was observed after either dZIP13 or hZIP13 overexpression, but not a closely related zinc transporter hZIP7. <italic>n</italic> = 6. *<italic>*</italic>p<0.01; two-tailed Student's <italic>t</italic> test. (<bold>B</bold>) The eclosion defect of <italic>dZIP13</italic>-<italic>RNAi</italic> flies could be significantly rescued by <italic>hZIP13</italic> expression. Eclosion was rescued from ∼40% to ∼75% by <italic>hZIP13</italic>. <italic>n</italic> = 6. <italic>*</italic>p<0.05, *<italic>*</italic>p<0.01; two-tailed Student's <italic>t</italic> test. (<bold>C</bold>) The shortened lifespan of <italic>dZIP13</italic>-<italic>RNAi</italic> was also rescued by <italic>hZIP13</italic>. (<bold>D</bold>) <italic>dZIP13</italic>-<italic>RNAi</italic> flies exhibited iron-rescuable collagen defects. Shown are images of fat body cells in VkgG454/+ control larvae and <italic>dZIP13-RNAi</italic> larvae, cultured on normal food and food with 10 mM FAC. Green: Vkg-GFP, blue: DAPI. (<bold>E</bold>) The lysyl hydroxylation reaction. The reaction depends on the presence of ferrous iron.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.018">http://dx.doi.org/10.7554/eLife.03191.018</ext-link></p></caption><graphic xlink:href="elife03191f008"/></fig></p><p>Another member of the ZIP family, hZIP7, is closely related to ZIP13 (<xref ref-type="fig" rid="fig1">Figure 1B</xref>) and has been shown to be a zinc importer located on the ER/Golgi (<xref ref-type="bibr" rid="bib37">Taylor et al., 2004</xref>; <xref ref-type="bibr" rid="bib13">Huang et al., 2005</xref>). Proteins destined for secretion are at least transiently localized to the ER and could theoretically function during their temporary stay in this organelle. If ZIP13 had acted as a zinc importer as other ZIP members, we would expect the closely related hZIP7 might also exhibit effects similar to those seen with hZIP13 when expressed in the fly. However, despite similarity to hZIP13, expression of hZIP7 produced neither whole body aconitase activity change, nor rescued the defects of <italic>dZIP13-RNAi</italic> flies (<xref ref-type="fig" rid="fig8">Figure 8A–C</xref>). In fact, it appeared to have even slightly exacerbated the defects.</p><p>hZIP13 mutations cause SCD-EDS, a disease with defective collagen hydroxylation leading to a decrease of collagen cross-linking and secretion. We asked whether dZIP13 knockdown could also affect collagen formation in flies. Type IV collagen, the main constituent of basement membrane, is encoded by two collagen genes <italic>Viking</italic> (<italic>Vkg</italic>) and <italic>Cg25C,</italic> which are expressed in <italic>Drosophila</italic> fat bodies. dPlod is expressed in the collagen-producing cells (<xref ref-type="bibr" rid="bib3">Bunt et al., 2011</xref>), and participates in the assembly and secretion of collagen. We used Vkg-GFP, a GFP protein-trap that identifies the localization of the endogenous Viking protein as a marker of the type IV collagen (<xref ref-type="bibr" rid="bib25">Morin et al., 2001</xref>). Ubiquitous knockdown of dZIP13 caused substantial retention of Vkg-GFP in the fat body cells, while iron supplementation rescued the Vkg-GFP retention (<xref ref-type="fig" rid="fig8">Figure 8D</xref>). Because iron is an important cofactor/co-substrate of lysyl hydroxylase, a critical enzyme in collagen synthesis (<xref ref-type="fig" rid="fig8">Figure 8E</xref>) (<xref ref-type="bibr" rid="bib26">Murad et al., 1985</xref>), the observation of iron reduction in ER/Golgi when dZIP13 is inhibited (<xref ref-type="fig" rid="fig5">Figure 5D</xref>) suggests that the normal functions of lysyl hydroxylase and prolyl hydroxylase might be compromised under iron shortage (see ‘Discussion’ for more).</p><p>Taken together, our results indicate dZIP13 is analogous to hZIP13, and is truly the <italic>Drosophila</italic> orthologue of hZIP13. Their functions are fundamentally different from those of the other zinc importers including the closely related ZIP7.</p></sec></sec><sec id="s3" sec-type="discussion"><title>Discussion</title><p>We presented substantial evidence establishing that dZIP13 mediates iron export to the secretory pathway, identifying dZIP13 as the elusive iron transporter in the secretory pathway. Moreover, this is the first time to report that a member of the ZIP transporter family functions as an iron exporter. Previously, certain members of ZIPs, such as ZIP14 (<xref ref-type="bibr" rid="bib20">Liuzzi et al., 2006</xref>) and ZIP8 (<xref ref-type="bibr" rid="bib44">Wang et al., 2012</xref>), have been reported to be capable of transporting iron. However, they are only complex, broad-scope metal-ion importers and their in vivo involvement in iron homeostasis is yet to be established. Our in vivo studies clearly demonstrated that expressional alteration of dZIP13 mainly affects iron instead of zinc metabolism. Modulating dZIP13 expression in the gut cell resulted in opposite iron changes in the cytosol and secretory organelles, and radioisotope iron transport assay further showed that dZIP13 mediates iron exporting, providing compelling evidence in supporting dZIP13 as an iron efflux pump. Future biochemistry/biophysical work is needed to decipher the exact mechanistic detail of the transportation process and evidences thus obtained may further substantiate the conclusion of dZIP13 as an iron exporter.</p><p>The unanticipated finding of dZIP13 as an iron exporter was facilitated by the characteristic manner of dietary iron uptake in <italic>Drosophila</italic> gut, which is mediated by secreted ferritin and requires iron loading in the secretory pathway (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>). The subcellular distributions of ferritin are very different between mammals and insects. In mammals, ferritin is predominantly localized in the cytosol for storing cytosolic iron, and absorbed dietary iron is effluxed from enterocytes through ferroportin (<xref ref-type="bibr" rid="bib42">Vanoaica et al., 2010</xref>). However, in insects such as <italic>Drosophila</italic>, ferritin is mainly secreted, playing a central role in iron absorption by bringing iron out of enterocytes and into the hemolymph through the secretory pathway (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>). This feature of iron absorption demands higher levels of iron to be pumped into the secretory pathway for systemic use, and facilitated our characterization of dZIP13 as the iron pumper which fulfills this role.</p><p>In addition to the iron transport function, we also occasionally observed a minor zinc connection for dZIP13. It is possible that dZIP13 still retains some residual zinc-importing activity. However, in most cases, the zinc effect is physiologically marginal or insignificant. We would argue that the zinc dyshomeostasis is not the primary effect of dZIP13 function loss, because iron but not zinc levels were altered in the body of <italic>dZIP13-RNAi</italic> and <italic>dZIP13-OE larvae</italic>. In addition, iron but not zinc supplementation is able to rescue loss of dZIP13. Finally, no genetic interaction was observed between dZIP13 and other ZIPs in the ER/Golgi. These results argue against the idea that zinc dyshomeostasis is the primary defect in the loss of dZIP13 function, and that iron dyshomeostasis is secondary to a zinc defect. Our other characterizations of dZIP13, as reported in this work, are all consistent with this notion.</p><p>Considering the unusual nature of dZIP13 as an iron exporter while other members of the family (SLC39A) so far identified all appear to be importers, it is noteworthy that zinc efflux protein ZnT5 (SLC30A5) can mediate zinc transport in both directions (<xref ref-type="bibr" rid="bib40">Valentine et al., 2007</xref>). It would be interesting to know what sequences or structures endow dZIP13 with this unique property. At this stage we do not yet have clear answers to this question. Amino acid sequence comparisons of ZIP13 with other ZIP family members reveal some distinct differences. The most notabe difference is in transmembrane domain TM4. The TM4 amino acid sequence for all ZIP13s are DNFTHG (<xref ref-type="fig" rid="fig9">Figure 9</xref>) whereas other closely related ZIPs are HNFTDG, i.e., the highly conserved region in TM4 has a D and H residue swap between ZIP13s and other ZIP members. Our preliminary evidences suggest this variation might be an important factor because when we switched this D and H dZIP13 was no longer functional. Additional experiments are clearly needed to further explore this promising lead.<fig id="fig9" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.019</object-id><label>Figure 9.</label><caption><title>Two conserved amino acids D and H in the fourth transmembrane domain of other ZIPs are switched in ZIP13.</title><p>Shown here are the fourth transmembrane domain and adjacent sequences of ZIP13 and several other ZIPs. 1–3 are ZIP13 sequences from different organisms. 4–6 are several other representative ZIPs. Predicted TM4 segments are underlined. The highlighted two amino acids D and H are conserved in all other closely related ZIPs while their positions are switched in ZIP13s. Numbers in parenthesis indicate the starting/ending positions of the ZIPs shown. 1. ZIP13 (<italic>Danio rerio</italic>); 2. ZIP13 (CG7816) (<italic>Drosophila melanogaster</italic>); 3. ZIP13 (<italic>Homo sapiens</italic>); 4. ZIP7 (<italic>Homo sapien</italic>s); 5. ZIP8 (<italic>Homo sapiens</italic>); 6. ZIP14 (<italic>Homo sapiens</italic>).</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.019">http://dx.doi.org/10.7554/eLife.03191.019</ext-link></p></caption><graphic xlink:href="elife03191f009"/></fig></p><p>Mutations in LH family genes have been found in several human diseases including Bruck syndrome (<xref ref-type="bibr" rid="bib41">van der Slot et al., 2003</xref>; <xref ref-type="bibr" rid="bib12">Ha-Vinh et al., 2004</xref>) (OMIM #609220) and Ehlers–Danlos type VI (<xref ref-type="bibr" rid="bib47">Yeowell and Walker, 2000</xref>) (OMIM #225400). Recently mutations in ZIP13, a member of the SLC39A/Zrt-Irt-like protein (ZIP) family, have been identified as the cause for the spondylocheiro dysplastic Ehlers–Danlos syndrome (SCD-EDS), a form of EDS sharing some similar clinical presentations with EDS VI, which is caused by mutations in PLOD1 gene encoding lysyl hydroxylase (LH1) (<xref ref-type="bibr" rid="bib8">Fukada et al., 2008</xref>; <xref ref-type="bibr" rid="bib9">Giunta et al., 2008</xref>). Because ZIP transporters were generally believed to import zinc into the cytosol from the extracellular milieu or organellar lumen (<xref ref-type="bibr" rid="bib16">Kambe et al., 2006</xref>; <xref ref-type="bibr" rid="bib19">Lichten and Cousins, 2009</xref>; <xref ref-type="bibr" rid="bib14">Jeong and Eide, 2013</xref>), the pathogenesis of SCD-EDS was difficult to understand and various hypotheses were proposed to explain how the zinc importer could affect iron homeostasis (<xref ref-type="bibr" rid="bib8">Fukada et al., 2008</xref>; <xref ref-type="bibr" rid="bib9">Giunta et al., 2008</xref>; <xref ref-type="bibr" rid="bib15">Jeong et al., 2012</xref>). The identification of dZIP13 as the iron exporter for the secretory compartments suggests a more direct interpretation of SCD-EDS: ZIP13 mutations impair iron transport to ER/Golgi, significantly attenuating the activities of iron-requiring enzymes such as lysyl hydroxylase, leading to defective collagen synthesis and accumulation in the secretory pathway.</p><p>Several issues are worthy of clarification here. SCD-EDS was identified to be defective in collagen crosslinking from actions of lysyl and prolyl hydroxylases. However, lysyl and prolyl hydroxylase activities from the cellular extracts of patient cells were reported to be normal (<xref ref-type="bibr" rid="bib9">Giunta et al., 2008</xref>). This is likely the result from the enzymatic assays, which were performed in the presence of iron (<xref ref-type="bibr" rid="bib26">Murad et al., 1985</xref>; <xref ref-type="bibr" rid="bib9">Giunta et al., 2008</xref>). It has been shown that externally supplied iron is needed to do these assays (<xref ref-type="bibr" rid="bib39">Tuderman et al., 1977</xref>), suggesting iron is probably not tightly bound to these enzymes. However, the addition of iron would neutralize or mask the original iron-deficienct state of these enzymes in vivo (in the ER/Golgi of SCD-EDS patient cells), and therefore produce ‘normal’ in vitro enzymatic activities despite defective in vivo hydroxylation. These seemingly contradictory observations, therefore, are very consistent with our conclusion that ZIP13 is an iron exporter that supplies iron to ER/Golgi.</p><p><xref ref-type="bibr" rid="bib15">Jeong et al. (2012)</xref> used mammalian cells to measure metal uptake activity of ZIP13. Because ZIP13 is normally an intracellular protein, the authors claimed that when overexpressed, some ZIP13 was mistargeted to the plasma membrane, making the uptake assay possible. In that experiment, zinc uptake was observed, but iron failed to compete with zinc in the importing assay. However, no exporting activity was examined in that experiment. As reported and discussed previously, sometimes we also observed slight changes in zinc levels, though we are not sure whether this was a result of direct dZIP13 transportation or due to secondary effects of iron dyshomeostasis. It is possible that dZIP13 may still retain some residual zinc importing activity. If this is the case, then the results from Jeong et al. would not be contradictory with our own findings.</p><p>While Jeong et al. proposed zinc deficiency in the ER/Golgi, <xref ref-type="bibr" rid="bib9">Giunta et al. (2008)</xref>, <xref ref-type="bibr" rid="bib8">Fukada et al. (2008)</xref>, and <xref ref-type="bibr" rid="bib2">Bin et al. (2011)</xref> proposed zinc accumulation in the ER/Golgi underlies SCD-EDS. According to this theory, zinc accumulation in ER/Golgi can compete with iron and then affect collagen hydroxylation. Indeed, zinc has been reported as an inhibitor of prolyl hydroxylase (<xref ref-type="bibr" rid="bib39">Tuderman et al., 1977</xref>). However in our hands, we saw only a marginal increase of zinc in the ER/Golgi when dZIP13 was knocked-down, but a much more dramatic change in the iron level. Because hZIP7, a zinc importer, cannot rescue dZIP13-RNAi, we think when dZIP13 is knocked-down the primary defect is not zinc accumulation. We suggest iron dyshomeostasis instead of a zinc defect is probably the primary cause contributing to SCD-EDS. Although we cannot exclude zinc's effect, it appears that it is not the primary reason, or at most a subsidiary factor.</p><p>Another issue worth pointing out is that none of the classical iron phenotypes are observed in SCD-EDS patients. Iron is involved in heme and Fe-S synthesis, and iron deficiency is typically observed as anemia. In SCD-EDS, it is possible that iron deficiency is localized to the secretory pathway and cytosolic and mitochondrial iron levels remain not much affected. Therefore, a ZIP13 mutation would result in a type of iron dyshomeostasis that would not present itself with the typical types of symptons (e.g., skin abnormality, bone malformation, and growth retardation) observed with classical iron deficiency. We still do not know what other proteins in the secretory pathway require iron. In addition to the common EDS-like features, SCD-EDS patients do present other phenotypes such as generalized skeletal dysplasia involving the spine and striking clinical abnormalities of the hands (<xref ref-type="bibr" rid="bib9">Giunta et al., 2008</xref>). Are these additional characteristics also a result of collagen defects or due to abnormalities other than the collagen? This question remains unanswered. Nevertheless, our results add another level of complexity in the regulation of iron homeostasis and some of the consequences that arise from its disruption.</p></sec><sec id="s4" sec-type="materials|methods"><title>Materials and methods</title><sec id="s4-1"><title>Plasmids</title><p>Constructs used for transgenic flies include pUAST-dZIP13 and pUAST-Golgi-mRFP. pUAST-dZIP13 was generated by PCR amplification of the coding region of CG7816 from <italic>Drosophila</italic> cDNA and cloning into pUAST using the following primers: pUAST-dZIP13 F: 5′-GGAATTCAGCCGAAAATGACCACGAACAG-3′, pUAST-dZIP13 R: 5′-ATAAGAATGCGGCCGCCCTAGTGTTCGAATAGCATGGTCATC-3′; pUAST-Golgi-mRFP was generated by PCR amplification of monomeric RFP with rhomboid-1 (Rho1), a Golgi marker protein (<xref ref-type="bibr" rid="bib18">Lee et al., 2001</xref>; <xref ref-type="bibr" rid="bib4">Chen et al., 2006</xref>) and cloning into pUAST. Construct used for transfecting human CHO cells was pIRESneo-dZIP13-myc, constructed in pIRESneo (clontech) by fusing myc in frame to the C terminal of dZIP13 using the following primers: pIRESneo-dZIP13 F: 5′-CTAGTGATATC AGCCGAAAATGACCACGAACAG-3′, pIRESneo-dZIP13 R: 5′-CGGAATTCCTACAGGTCTTCTTCAGAGATCAGTTTCTGTTCGTGTTCGAATAGCATGGTCATC-3′. Construct used in <italic>E. coli</italic> assay was pET28a-dZIP13, which was generated by cloning dZIP13 into pET28a using the following primers: pET28a-dZIP13 F: 5′-ACG CATATG ACCACGAACAGCAGCTTCTTC-3′, pET28a-dZIP13 R: 5′-TAC GAATTC CTAGTGTTCGAATAGCATGGTCATC-3′, and then transfected into BL21 (DE3).</p><p>All the constructs were verified by sequencing.</p></sec><sec id="s4-2"><title>Fly stocks, culture media, and transgenics</title><p>Unless otherwise noted, flies were normally reared on standard cornmeal media at 25°C and third instar larvae were used. The concentrations of supplemented metals or metal chelators used were as follows: 5 mM ferric ammonium citrate (FAC), 0.1 mM bathophenanthrolinedisulfonic acid disodium (BPS) (Sigma, St. Louis, MO, USA), 25 μM N,N,N′,N′-tetrakis (2-pyridylmethyl) ethylenediamine (TPEN) (Sigma, St. Louis, MO, USA), 2 mM ZnCl<sub>2</sub> (Beijing Yili Fine Chemicals Ltd. Co., Beijing, China). Transgenic flies for each pUAST construct were generated in <italic>w</italic><sup><italic>1118</italic></sup> background by P-element-mediated transformation. Information about the flies used in this study is listed in <xref ref-type="table" rid="tbl1">Table 1</xref>.<table-wrap id="tbl1" position="float"><object-id pub-id-type="doi">10.7554/eLife.03191.020</object-id><label>Table 1.</label><caption><p>Drosophila used in this study.</p><p><bold>DOI:</bold> <ext-link ext-link-type="doi" xlink:href="10.7554/eLife.03191.020">http://dx.doi.org/10.7554/eLife.03191.020</ext-link></p></caption><table frame="hsides" rules="groups"><thead><tr><th>Drosophila</th><th>Descriptions</th><th>Origin</th></tr></thead><tbody><tr><td><italic>Da-Gal4</italic> (#8641)</td><td>Ubiquitous Gal4</td><td>Bloomington Drosophila Stock Center</td></tr><tr><td><italic>NP3084</italic> (#113094)</td><td>Expresses Gal4 in salivary glands, gastric caecae, and whole midgut in third instar larvae</td><td>Genetic Resource Center at the Kyoto Institute of Technology (DGRC)</td></tr><tr><td><italic>Vkg-GFP</italic> (#G00454)</td><td>Carries a GFP fused to <italic>viking</italic></td><td>Flytrap</td></tr><tr><td><italic>Fer1HCHG188/TM3</italic>(#G00188)</td><td>Carries a GFP fused to <italic>Fer1HCH (ferritin 1heavy-chain homolog)</italic></td><td>Flytrap</td></tr><tr><td><italic>dZIP13-RNAi</italic><break/>(#1364)</td><td><italic>CG7816</italic> RNAi line</td><td>Vienna Drosophila RNAi Center</td></tr><tr><td><italic>dZIP13-OE</italic></td><td><italic>CG7816</italic> over-expression line</td><td>This study</td></tr><tr><td><italic>FerHCH-RNAi</italic><break/>(#12925)</td><td><italic>Fer1HCH</italic> RNAi line</td><td>Vienna Drosophila RNAi Center</td></tr><tr><td><italic>hZIP7-OE</italic></td><td>Human <italic>ZIP7</italic> over-expression line</td><td>This study</td></tr><tr><td><italic>hZIP13-OE</italic></td><td>Human <italic>ZIP13</italic> over-expression line</td><td>This study</td></tr><tr><td>Golgi marker</td><td>Carries a RFP fused to Rho1</td><td>This study</td></tr><tr><td>ER marker (#ZCL1503)</td><td>Carries a GFP fused to PDI</td><td>(<xref ref-type="bibr" rid="bib25">Morin et al., 2001</xref>)</td></tr><tr><td>Early endosome marker (#39695)</td><td>Carries a GFP fused to FYVE</td><td>Bloomington Drosophila Stock Center</td></tr><tr><td>Late endosome marker (#42714)</td><td>Carries a GFP fused to LAMP</td><td>Bloomington Drosophila Stock Center</td></tr><tr><td>dZIP13 mutant (#18595)</td><td><italic>CG7816</italic> mutant line</td><td>Bloomington Drosophila Stock Center</td></tr></tbody></table></table-wrap></p></sec><sec id="s4-3"><title>Eclosion and longevity assays</title><p>To examine the effects of metals or chelators on the eclosion of <italic>dZIP13</italic>-<italic>RNAi</italic>, <italic>Da-GAL4</italic> homozygous flies were crossed to <italic>dZIP13-RNAi</italic>, and the progeny were reared on food containing different metals or metal chelators. The density of each vial was controlled to ∼100 progeny. The total number of emerging adults of each genotype was counted.</p><p>Longevity assays was performed as described previously (<xref ref-type="bibr" rid="bib46">Xiao et al., 2013</xref>). 3-day-old adult females were collected. 20 flies were placed in a food vial and each vial was kept at 25°C with 60% humidity under a 12-hr light–dark cycle. Food vials were changed every 2 days, and dead flies were counted at that time. 10 parallel group tests were conducted for each genotype, and the experiments were repeated at least three times. Percentage increases in lifespan were based on comparing the median survivals to the controls.</p></sec><sec id="s4-4"><title>Metal content assay</title><p>Flies of each genotype were reared on normal food from eggs until late third-instar larval stage. About 25 larvae or 110 guts or 50 whole body minus guts were collected, weighed, and sent for quantitative elemental analysis with inductively coupled plasma-mass spectrometry (ICP-MS) XII (Thermo Electron Corp, Waltham, MA, USA) by the Analysis Center of Tsinghua University (<xref ref-type="bibr" rid="bib43">Wang et al., 2009</xref>; <xref ref-type="bibr" rid="bib46">Xiao et al., 2013</xref>). For ER/Golgi metal content, <italic>Drosophila</italic> ER/Golgi was purified as previous described (<xref ref-type="bibr" rid="bib10">Graham, 2001</xref>). After the protein concentration was determined, ∼1.4 mg protein was sent for ICP-MS. For <italic>E. coli</italic> metal content, ∼0.33 g (dry weight) <italic>E. coli</italic> was used.</p></sec><sec id="s4-5"><title>Aconitase activity assay</title><p>Protein was extracted with PBST (137 mM NaCl, 2.7 mM KCl, 10 mM Na<sub>2</sub>HPO<sub>4</sub>, 2 mM KH<sub>2</sub>PO<sub>4</sub>, and 0.1% Triton X-100, PH 7.4) from cells or tissue samples. Protein concentration was measured by the BCA kit (Thermal). ∼60 μg protein for the adult gut extract, or ∼250 μg protein for the whole larvae extract was added to 700-μl reaction buffer (50 mM K<sub>2</sub>HPO<sub>4</sub>, pH 7.4, containing 30 µM citric acid). The increase of absorbance at 240 nm was monitored for 2 min as the relative aconitase activity.</p><p>In-gel aconitase activity assays were performed essentially as described (<xref ref-type="bibr" rid="bib38">Tong and Rouault, 2006</xref>). Gels consisted of a separating gel containing 8% acrylamide (132 mM Tris base, 132 mM borate, 3.6 mM citrate), and a stacking gel containing 4% acrylamide (67 mM Tris base, 67 mM borate, 3.6 mM cit-rate). The running buffer contained 25 mM Tris pH 8.3, 192 mM glycine, and 3.6 mM citrate. Electrophoresis was carried out at 180 V at 4°C. Aconitase activities were assayed by incubating the gel in the dark at 37°C in 100 mM Tris (pH 8.0), 1 mM NADP, 2.5 mM cis-aconitic acid, 5 mM MgCl<sub>2</sub>, 1.2 mM MTT, 0.3 mM phenazine methosulfate, and 5 U/ml isocitrate dehydrogenase.</p></sec><sec id="s4-6"><title>RT-PCR</title><p>Total RNA was extracted with TRIzol reagent (Invitrogen, Carlsbad, CA, USA). cDNA was reverse-transcribed from 1 μg total RNA with TransScript Reverse Transcriptase (TransGen Biotech Co., Beijing, China). Semiquantitative RT-PCR was performed using gene-specific primers to amplify partial regions of target genes. RNA isolation and reverse transcription were performed independently for three times, and no less than three PCR experiments were applied to each cDNA sample.</p></sec><sec id="s4-7"><title>Western blot analysis</title><p>Mouse polyclonal antibodies were raised against recombinant dZIP13-2 protein fragment (MTEEKMAKEGYKDPADSKLLRSGSADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKRSGFSRWDAARAQKEEERKESIKQLE). Briefly, the cDNA fragments encoding the cytosolic side of this protein (dZIP13-2) were synthesized and cloned into pTwin1 (NEB) vector. The recombinant protein was expressed in <italic>E. coli</italic> and purified by chitin beads (NEB), and injected into mice for antibody generation (Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China). The antibody was affinity purified and pre-absorbed before use. Anti-Fer2LCH was as described before (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>). Anti-tubulin rat monoclonal antibody (ab6160), anti-GM130 rabbit polyclonal antibody (ab30637), and anti-PDI mouse monoclonal antibody (ab2792) were obtained from Abcam (Cambridge, MA, USA). Secondary antibodies include HRP-conjugated goat anti-mouse IgG, goat anti-rabbit IgG and goat anti-rat IgG (Zhongshan Goldenbridge Biotechnology, Beijing, China). For Western blot analysis, fly samples were homogenized in the buffer containing 1% Triton X-100 plus 10% proteinase inhibitor cocktail (Sigma), centrifuged, separated on 10% SDS-PAGE, and transferred to nitrocellulose membranes (Millipore, Watford, UK). Signals were developed with ECL detection kit (Vigorous Biotechnology, Beijing, China).</p></sec><sec id="s4-8"><title>Immunohistochemistry and fluorescence microscopy</title><p>Caco-2 cells were maintained in MEM (Invitrogen) containing 10% fetal bovine serum (FBS, Gibco BRL, Gaithersburg, MD, USA) and MEM NEAA (Gibco) at 37°C. Cells were transfected with pIRESneo-<italic>dZIP13-myc</italic> and constructs of ER/Golgi markers using lipofectamine (Invitrogen). After 24 hr, cells were fixed, taken pictures after staining for the myc antibody (green) and the Golgi marker (anti- Giantin,1:500) or ER marker (anti-PDI, 1:500). Anti-c-Myc rabbit polyclonal antibody (1:500) (ab51156), anti-Giantin rabbit polyclonal antibody (ab80864) and anti-PDI mouse monoclonal antibody (ab2792) were obtained from Abcam (Cambridge, MA, USA). Secondary antibodies include cy3-conjugated goat anti-mouse and cy3-conjugated goat anti-rabbit IgG (Zhongshan Goldenbridge Biotechnology, Beijing, China).</p><p>For dZIP13 staining in <italic>E. coli</italic>, fixation and permeabilization of cells transformed with pET28a were performed as described previously (<xref ref-type="bibr" rid="bib5">Den Blaauwen et al., 2003</xref>). Poly-L-lysine-coated coverslips loaded with fixed cells were washed three times with PBS, and nonspecific binding sites were blocked for 1 hr in PBS containing 1% bovine serum albumin. Coverslips were incubated with anti-dZIP13 antibody (1:100) for 1 hr, washed three times with PBS, and incubated for an additional 1 hr with FITC- conjugated goat anti-mouse IgG (1:1000). The coverslips were then washed three times with PBS, mounted onto glass slides, and taken pictures.</p><p>For fly samples, tissues indicated were dissected, fixed, stained, and mounted following standard procedures (<xref ref-type="bibr" rid="bib29">Pastor-Pareja and Xu, 2011</xref>). The following antibodies and dyes were used: mouse anti-dZIP13 (1:100), goat anti-mouse IgG conjugated to FITC or cy3 (1:1000, Zhongshan Goldenbridge Biotechnology) and DAPI (1:5, Beyotime C1005). For DAPI staining, samples were incubated in 50 ng/ml DAPI for 10 min. Slides were mounted with 50% glycerol/PBS. Confocal images were taken with a Zeiss LSM710 Meta confocal microscope.</p><p>Fluorescence of <italic>Fer1HCHG188</italic> larvae was examined and recorded with a Nikon ECLIPES 80i microscope attached to a Nikon DXM1200F digital camera (Nikon, Tokyo, Japan).</p></sec><sec id="s4-9"><title>Iron staining</title><p>Detection of ferric iron in the midgut or in-gel ferric analysis was performed as described previously (<xref ref-type="bibr" rid="bib35">Tang and Zhou, 2013b</xref>).</p></sec><sec id="s4-10"><title>Determination of <sup>55</sup>Fe release from <italic>E. coli</italic></title><p>20 ml freshly inoculated <italic>E. coli</italic> was grown to a density of about OD600 = 0.05 in LB containing kanamycin. The cells were incubated with 10 μCi <sup>55</sup>Fe (PerkinElmer, NEZ04300) in the same medium containing 100 μM ascorbate (Sigma) for 1.5 hr. Then 0.5 mM IPTG was added into the medium and incubated for another 1.5 hr. The bacteria were collected at 8000×g for 5 min, washed with ice-cold PBS containing 100 μΜ EDTA to remove iron non-specifically bound to the cell surface, and twice with ice cold PBS. To measure <sup>55</sup>Fe release, the bacterial cells were then incubated with 2 ml PBS at 37°C, 200 μl medium was sampled at each time point. Supernatants were collected after centrifugation and counted by liquid scintillation (1450 MicroBeta TriLux, PerkinElmer Life Sciences).</p><p>% <sup>55</sup>Fe release = (cpm in supernatant)/(cpm in time 0) × 100%</p></sec><sec id="s4-11"><title>Determination of <sup>55</sup>Fe uptake into ER/Golgi</title><p><italic>Drosophila</italic> ER/Golgi purification was performed as previous described (<xref ref-type="bibr" rid="bib10">Graham, 2001</xref>). After determining the protein concentration, the ER/Golgi solution was diluted into 0.5 μg/μl protein in the presence of 0.25 M sucrose. To measure iron uptake, ER/Golgi samples were added with 50 μM ascorbate (Sigma), 50 μM FeCl<sub>2</sub>, and 10 μCi <sup>55</sup>Fe and incubated at 37°C. 200 μl samples were collected by filters (Millipore, VCWP01300) every 10 min, and washed three times with isotonic solution (Sigma, I3533). The filters were counted by liquid scintillation (1450 MicroBeta TriLux, PerkinElmer Life Sciences).</p></sec><sec id="s4-12"><title>Mitochondria purification</title><p>The preparation was performed as previously described (<xref ref-type="bibr" rid="bib24">Miwa et al., 2003</xref>). Third instar larvae were collected and homogenized in a buffer containing 250 mM sucrose, 5 mM Tris–HCl, 2 mM EGTA, 1% (wt/vol) bovine serum albumin, pH 7.4 at 4°C. Protein concentration was measured by the BCA kit (Thermal).</p></sec><sec id="s4-13"><title>Activity of NADPH-cytochrome c reductase, cytochrome c oxidase and β-N-Acetylglucosaminidase</title><p>Activities of NADPH-cytochrome c reductase, cytochrome c oxidase, and β-N-Acetylglucosaminidase were measured by the kit (Sigma #CY0100, # CYTOCOX1, # CS0780, St. Louis, MO, USA) according to the manufacturer's instructions.</p></sec><sec id="s4-14"><title>Statistical analysis</title><p>Data were analyzed by Student's t-test between groups, and while multiple groups were compared ANOVA was used. Statistical results were presented as means ± SEM. Asterisks indicate critical levels of significance (*p<0.05, **p<0.01, and ***p<0.001).</p></sec></sec></body><back><ack id="ack"><title>Acknowledgements</title><p>We are grateful to the Bloomington Stock Center, the <italic>Drosophila</italic> Genetic Resource Center at the Kyoto Institute of Technology, Flytrap, and the Vienna <italic>Drosophila</italic> RNAi Center for fly stocks. We thank Dr Yixian Cui for technical assistance.</p></ack><sec sec-type="additional-information"><title>Additional information</title><fn-group content-type="competing-interest"><title>Competing interests</title><fn fn-type="conflict" id="conf1"><p>The authors declare that no competing interests exist.</p></fn></fn-group><fn-group content-type="author-contribution"><title>Author contributions</title><fn fn-type="con" id="con1"><p>GX, Conception and design, Acquisition of data, Analysis and interpretation of data, Drafting or revising the article</p></fn><fn fn-type="con" id="con2"><p>ZW, Conception and design, Acquisition of data, Analysis and interpretation of data, Drafting or revising the article</p></fn><fn fn-type="con" id="con3"><p>QF, Acquisition of data, Analysis and interpretation of data, Drafting or revising the article</p></fn><fn fn-type="con" id="con4"><p>XT, Acquisition of data, Analysis and interpretation of data</p></fn><fn fn-type="con" id="con5"><p>BZ, Conception and design, Analysis and interpretation of data, Drafting or revising the article</p></fn></fn-group></sec><ref-list><title>References</title><ref id="bib1"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Andrews</surname><given-names>NC</given-names></name></person-group><year>2005</year><article-title>Molecular control of iron metabolism</article-title><source>Best Practice & Research Clinical Haematology</source><volume>18</volume><fpage>159</fpage><lpage>169</lpage><pub-id pub-id-type="doi">10.1016/j.beha.2004.10.004</pub-id></element-citation></ref><ref id="bib2"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Bin</surname><given-names>BH</given-names></name><name><surname>Fukada</surname><given-names>T</given-names></name><name><surname>Hosaka</surname><given-names>T</given-names></name><name><surname>Yamasaki</surname><given-names>S</given-names></name><name><surname>Ohashi</surname><given-names>W</given-names></name><name><surname>Hojyo</surname><given-names>S</given-names></name><name><surname>Miyai</surname><given-names>T</given-names></name><name><surname>Nishida</surname><given-names>K</given-names></name><name><surname>Yokoyama</surname><given-names>S</given-names></name><name><surname>Hirano</surname><given-names>T</given-names></name></person-group><year>2011</year><article-title>Biochemical characterization of human ZIP13 protein: a homo-dimerized zinc transporter involved in the spondylocheiro dysplastic Ehlers-Danlos syndrome</article-title><source>The Journal of Biological Chemistry</source><volume>286</volume><fpage>40255</fpage><lpage>40265</lpage><pub-id pub-id-type="doi">10.1074/jbc.M111.256784</pub-id></element-citation></ref><ref id="bib3"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Bunt</surname><given-names>S</given-names></name><name><surname>Denholm</surname><given-names>B</given-names></name><name><surname>Skaer</surname><given-names>H</given-names></name></person-group><year>2011</year><article-title>Characterisation of the Drosophila procollagen lysyl hydroxylase, dPlod. Gene expression patterns</article-title><source>Gene Expression Patters</source><volume>11</volume><fpage>72</fpage><lpage>78</lpage><pub-id pub-id-type="doi">10.1016/j.gep.2010.09.006</pub-id></element-citation></ref><ref id="bib4"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Chen</surname><given-names>CL</given-names></name><name><surname>Shim</surname><given-names>MS</given-names></name><name><surname>Chung</surname><given-names>J</given-names></name><name><surname>Yoo</surname><given-names>HS</given-names></name><name><surname>Ha</surname><given-names>JM</given-names></name><name><surname>Kim</surname><given-names>JY</given-names></name><name><surname>Choi</surname><given-names>J</given-names></name><name><surname>Zang</surname><given-names>SL</given-names></name><name><surname>Hou</surname><given-names>X</given-names></name><name><surname>Carlson</surname><given-names>BA</given-names></name><name><surname>Hatfield</surname><given-names>DL</given-names></name><name><surname>Lee</surname><given-names>BJ</given-names></name></person-group><year>2006</year><article-title>G-rich, a Drosophila selenoprotein, is a Golgi-resident type III membrane protein</article-title><source>Biochemical and Biophysical Research Communications</source><volume>348</volume><fpage>1296</fpage><lpage>1301</lpage><pub-id pub-id-type="doi">10.1016/j.bbrc.2006.07.203</pub-id></element-citation></ref><ref id="bib5"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Den Blaauwen</surname><given-names>T</given-names></name><name><surname>Aarsman</surname><given-names>ME</given-names></name><name><surname>Vischer</surname><given-names>NO</given-names></name><name><surname>Nanninga</surname><given-names>N</given-names></name></person-group><year>2003</year><article-title>Penicillin-binding protein PBP2 of Escherichia coli localizes preferentially in the lateral wall and at mid-cell in comparison with the old cell pole</article-title><source>Molecular Microbiology</source><volume>47</volume><fpage>539</fpage><lpage>547</lpage><pub-id pub-id-type="doi">10.1046/j.1365-2958.2003.03316.x</pub-id></element-citation></ref><ref id="bib6"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Donovan</surname><given-names>A</given-names></name><name><surname>Brownlie</surname><given-names>A</given-names></name><name><surname>Zhou</surname><given-names>Y</given-names></name><name><surname>Shepard</surname><given-names>J</given-names></name><name><surname>Pratt</surname><given-names>SJ</given-names></name><name><surname>Moynihan</surname><given-names>J</given-names></name><name><surname>Paw</surname><given-names>BH</given-names></name><name><surname>Drejer</surname><given-names>A</given-names></name><name><surname>Barut</surname><given-names>B</given-names></name><name><surname>Zapata</surname><given-names>A</given-names></name><name><surname>Law</surname><given-names>TC</given-names></name><name><surname>Brugnara</surname><given-names>C</given-names></name><name><surname>Lux</surname><given-names>SE</given-names></name><name><surname>Pinkus</surname><given-names>GS</given-names></name><name><surname>Pinkus</surname><given-names>JL</given-names></name><name><surname>Kingsley</surname><given-names>PD</given-names></name><name><surname>Palis</surname><given-names>J</given-names></name><name><surname>Fleming</surname><given-names>MD</given-names></name><name><surname>Andrews</surname><given-names>NC</given-names></name><name><surname>Zon</surname><given-names>LI</given-names></name></person-group><year>2000</year><article-title>Positional cloning of zebrafish ferroportin1 identifies a conserved vertebrate iron exporter</article-title><source>Nature</source><volume>403</volume><fpage>776</fpage><lpage>781</lpage><pub-id pub-id-type="doi">10.1038/35001596</pub-id></element-citation></ref><ref id="bib7"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Fessler</surname><given-names>JH</given-names></name><name><surname>Fessler</surname><given-names>LI</given-names></name></person-group><year>1989</year><article-title>Drosophila extracellular matrix</article-title><source>Annual Review of Cell Biology</source><volume>5</volume><fpage>309</fpage><lpage>339</lpage><pub-id pub-id-type="doi">10.1146/annurev.cb.05.110189.001521</pub-id></element-citation></ref><ref id="bib8"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Fukada</surname><given-names>T</given-names></name><name><surname>Civic</surname><given-names>N</given-names></name><name><surname>Furuichi</surname><given-names>T</given-names></name><name><surname>Shimoda</surname><given-names>S</given-names></name><name><surname>Mishima</surname><given-names>K</given-names></name><name><surname>Higashiyama</surname><given-names>H</given-names></name><name><surname>Idaira</surname><given-names>Y</given-names></name><name><surname>Asada</surname><given-names>Y</given-names></name><name><surname>Kitamura</surname><given-names>H</given-names></name><name><surname>Yamasaki</surname><given-names>S</given-names></name><name><surname>Hojyo</surname><given-names>S</given-names></name><name><surname>Nakayama</surname><given-names>M</given-names></name><name><surname>Ohara</surname><given-names>O</given-names></name><name><surname>Koseki</surname><given-names>H</given-names></name><name><surname>Dos Santos</surname><given-names>HG</given-names></name><name><surname>Bonafe</surname><given-names>L</given-names></name><name><surname>Ha-Vinh</surname><given-names>R</given-names></name><name><surname>Zankl</surname><given-names>A</given-names></name><name><surname>Unger</surname><given-names>S</given-names></name><name><surname>Kraenzlin</surname><given-names>ME</given-names></name><name><surname>Beckmann</surname><given-names>JS</given-names></name><name><surname>Saito</surname><given-names>I</given-names></name><name><surname>Rivolta</surname><given-names>C</given-names></name><name><surname>Ikegawa</surname><given-names>S</given-names></name><name><surname>Superti-Furga</surname><given-names>A</given-names></name><name><surname>Hirano</surname><given-names>T</given-names></name></person-group><year>2008</year><article-title>The zinc transporter SLC39A13/ZIP13 is required for connective tissue development; its involvement in BMP/TGF-beta signaling pathways</article-title><source>PLOS ONE</source><volume>3</volume><fpage>e3642</fpage><pub-id pub-id-type="doi">10.1371/journal.pone.0003642</pub-id></element-citation></ref><ref id="bib9"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Giunta</surname><given-names>C</given-names></name><name><surname>Elçioglu</surname><given-names>NH</given-names></name><name><surname>Albrecht</surname><given-names>B</given-names></name><name><surname>Eich</surname><given-names>G</given-names></name><name><surname>Chambaz</surname><given-names>C</given-names></name><name><surname>Janecke</surname><given-names>AR</given-names></name><name><surname>Yeowell</surname><given-names>H</given-names></name><name><surname>Weis</surname><given-names>M</given-names></name><name><surname>Eyre</surname><given-names>DR</given-names></name><name><surname>Kraenzlin</surname><given-names>M</given-names></name><name><surname>Steinmann</surname><given-names>B</given-names></name></person-group><year>2008</year><article-title>Spondylocheiro dysplastic form of the Ehlers-Danlos syndrome–an autosomal-recessive entity caused by mutations in the zinc transporter gene SLC39A13</article-title><source>American Journal of Human Genetics</source><volume>82</volume><fpage>1290</fpage><lpage>1305</lpage><pub-id pub-id-type="doi">10.1016/j.ajhg.2008.05.001</pub-id></element-citation></ref><ref id="bib10"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Graham</surname><given-names>JM</given-names></name></person-group><year>2001</year><article-title>Isolation of Golgi membranes from tissues and cells by differential and density gradient centrifugation</article-title><source>Current Protocols in Cell Biology</source><comment>Chapter 3:Unit 3.9</comment><pub-id pub-id-type="doi">10.1002/0471143030.cb0309s10</pub-id></element-citation></ref><ref id="bib11"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Haile</surname><given-names>DJ</given-names></name><name><surname>Rouault</surname><given-names>TA</given-names></name><name><surname>Harford</surname><given-names>JB</given-names></name><name><surname>Kennedy</surname><given-names>MC</given-names></name><name><surname>Blondin</surname><given-names>GA</given-names></name><name><surname>Beinert</surname><given-names>H</given-names></name><name><surname>Klausner</surname><given-names>RD</given-names></name></person-group><year>1992</year><article-title>Cellular regulation of the iron-responsive element binding protein: disassembly of the cubane iron-sulfur cluster results in high-affinity RNA binding</article-title><source>Proceedings of the National Academy of Sciences of the United States of America</source><volume>89</volume><fpage>11735</fpage><lpage>11739</lpage><pub-id pub-id-type="doi">10.1073/pnas.89.24.11735</pub-id></element-citation></ref><ref id="bib12"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Ha-Vinh</surname><given-names>R</given-names></name><name><surname>Alanay</surname><given-names>Y</given-names></name><name><surname>Bank</surname><given-names>RA</given-names></name><name><surname>Campos-Xavier</surname><given-names>AB</given-names></name><name><surname>Zankl</surname><given-names>A</given-names></name><name><surname>Superti-Furga</surname><given-names>A</given-names></name><name><surname>Bonafé</surname><given-names>L</given-names></name></person-group><year>2004</year><article-title>Phenotypic and molecular characterization of Bruck syndrome (osteogenesis imperfecta with contractures of the large joints) caused by a recessive mutation in PLOD2</article-title><source>American Journal of Medical genetics Part A</source><volume>131</volume><fpage>115</fpage><lpage>120</lpage><pub-id pub-id-type="doi">10.1002/ajmg.a.30231</pub-id></element-citation></ref><ref id="bib13"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Huang</surname><given-names>L</given-names></name><name><surname>Kirschke</surname><given-names>CP</given-names></name><name><surname>Zhang</surname><given-names>Y</given-names></name><name><surname>Yu</surname><given-names>YY</given-names></name></person-group><year>2005</year><article-title>The ZIP7 gene (Slc39a7) encodes a zinc transporter involved in zinc homeostasis of the Golgi apparatus</article-title><source>The Journal of Biological Chemistry</source><volume>280</volume><fpage>15456</fpage><lpage>15463</lpage><pub-id pub-id-type="doi">10.1074/jbc.M412188200</pub-id></element-citation></ref><ref id="bib14"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Jeong</surname><given-names>J</given-names></name><name><surname>Eide</surname><given-names>DJ</given-names></name></person-group><year>2013</year><article-title>The SLC39 family of zinc transporters</article-title><source>Molecular Aspects of Medicine</source><volume>34</volume><fpage>612</fpage><lpage>619</lpage><pub-id pub-id-type="doi">10.1016/j.mam.2012.05.011</pub-id></element-citation></ref><ref id="bib15"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Jeong</surname><given-names>J</given-names></name><name><surname>Walker</surname><given-names>JM</given-names></name><name><surname>Wang</surname><given-names>F</given-names></name><name><surname>Park</surname><given-names>JG</given-names></name><name><surname>Palmer</surname><given-names>AE</given-names></name><name><surname>Giunta</surname><given-names>C</given-names></name><name><surname>Rohrbach</surname><given-names>M</given-names></name><name><surname>Steinmann</surname><given-names>B</given-names></name><name><surname>Eide</surname><given-names>DJ</given-names></name></person-group><year>2012</year><article-title>Promotion of vesicular zinc efflux by ZIP13 and its implications for spondylocheiro dysplastic Ehlers-Danlos syndrome</article-title><source>Proceedings of the National Academy of Sciences of the United States of America</source><volume>109</volume><fpage>E3530</fpage><lpage>E3538</lpage><pub-id pub-id-type="doi">10.1073/pnas.1211775110</pub-id></element-citation></ref><ref id="bib16"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Kambe</surname><given-names>T</given-names></name><name><surname>Suzuki</surname><given-names>T</given-names></name><name><surname>Nagao</surname><given-names>M</given-names></name><name><surname>Yamaguchi-Iwai</surname><given-names>Y</given-names></name></person-group><year>2006</year><article-title>Sequence similarity and functional relationship among eukaryotic ZIP and CDF transporters</article-title><source>Genomics, Proteomics & Bioinformatics</source><volume>4</volume><fpage>1</fpage><lpage>9</lpage><pub-id pub-id-type="doi">10.1016/S1672-0229(06)60010-7</pub-id></element-citation></ref><ref id="bib17"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Knovich</surname><given-names>MA</given-names></name><name><surname>Storey</surname><given-names>JA</given-names></name><name><surname>Coffman</surname><given-names>LG</given-names></name><name><surname>Torti</surname><given-names>SV</given-names></name><name><surname>Torti</surname><given-names>FM</given-names></name></person-group><year>2009</year><article-title>Ferritin for the clinician</article-title><source>Blood Reviews</source><volume>23</volume><fpage>95</fpage><lpage>104</lpage><pub-id pub-id-type="doi">10.1016/j.blre.2008.08.001</pub-id></element-citation></ref><ref id="bib18"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Lee</surname><given-names>JR</given-names></name><name><surname>Urban</surname><given-names>S</given-names></name><name><surname>Garvey</surname><given-names>CF</given-names></name><name><surname>Freeman</surname><given-names>M</given-names></name></person-group><year>2001</year><article-title>Regulated intracellular ligand transport and proteolysis control EGF signal activation in Drosophila</article-title><source>Cell</source><volume>107</volume><fpage>161</fpage><lpage>171</lpage><pub-id pub-id-type="doi">10.1016/S0092-8674(01)00526-8</pub-id></element-citation></ref><ref id="bib19"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Lichten</surname><given-names>LA</given-names></name><name><surname>Cousins</surname><given-names>RJ</given-names></name></person-group><year>2009</year><article-title>Mammalian zinc transporters: nutritional and physiologic regulation</article-title><source>Annual Review of Nutrition</source><volume>29</volume><fpage>153</fpage><lpage>176</lpage><pub-id pub-id-type="doi">10.1146/annurev-nutr-033009-083312</pub-id></element-citation></ref><ref id="bib20"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Liuzzi</surname><given-names>JP</given-names></name><name><surname>Aydemir</surname><given-names>F</given-names></name><name><surname>Nam</surname><given-names>H</given-names></name><name><surname>Knutson</surname><given-names>MD</given-names></name><name><surname>Cousins</surname><given-names>RJ</given-names></name></person-group><year>2006</year><article-title>Zip14 (Slc39a14) mediates non-transferrin-bound iron uptake into cells</article-title><source>Proceedings of the National Academy of Sciences of the United States of America</source><volume>103</volume><fpage>13612</fpage><lpage>13617</lpage><pub-id pub-id-type="doi">10.1073/pnas.0606424103</pub-id></element-citation></ref><ref id="bib21"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Lye</surname><given-names>JC</given-names></name><name><surname>Richards</surname><given-names>CD</given-names></name><name><surname>Dechen</surname><given-names>K</given-names></name><name><surname>Paterson</surname><given-names>D</given-names></name><name><surname>de Jonge</surname><given-names>MD</given-names></name><name><surname>Howard</surname><given-names>DL</given-names></name><name><surname>Warr</surname><given-names>CG</given-names></name><name><surname>Burke</surname><given-names>R</given-names></name></person-group><year>2012</year><article-title>Systematic functional characterization of putative zinc transport genes and identification of zinc toxicosis phenotypes in <italic>Drosophila melanogaster</italic></article-title><source>The Journal of Experimental Biology</source><volume>215</volume><fpage>3254</fpage><lpage>3265</lpage><pub-id pub-id-type="doi">10.1242/jeb.069260</pub-id></element-citation></ref><ref id="bib22"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Mandilaras</surname><given-names>K</given-names></name><name><surname>Pathmanathan</surname><given-names>T</given-names></name><name><surname>Missirlis</surname><given-names>F</given-names></name></person-group><year>2013</year><article-title>Iron absorption in <italic>Drosophila melanogaster</italic></article-title><source>Nutrients</source><volume>5</volume><fpage>1622</fpage><lpage>1647</lpage><pub-id pub-id-type="doi">10.3390/nu5051622</pub-id></element-citation></ref><ref id="bib23"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Missirlis</surname><given-names>F</given-names></name><name><surname>Kosmidis</surname><given-names>S</given-names></name><name><surname>Brody</surname><given-names>T</given-names></name><name><surname>Mavrakis</surname><given-names>M</given-names></name><name><surname>Holmberg</surname><given-names>S</given-names></name><name><surname>Odenwald</surname><given-names>WF</given-names></name><name><surname>Skoulakis</surname><given-names>EM</given-names></name><name><surname>Rouault</surname><given-names>TA</given-names></name></person-group><year>2007</year><article-title>Homeostatic mechanisms for iron storage revealed by genetic manipulations and live imaging of Drosophila ferritin</article-title><source>Genetics</source><volume>177</volume><fpage>89</fpage><lpage>100</lpage><pub-id pub-id-type="doi">10.1534/genetics.107.075150</pub-id></element-citation></ref><ref id="bib24"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Miwa</surname><given-names>S</given-names></name><name><surname>St-Pierre</surname><given-names>J</given-names></name><name><surname>Partridge</surname><given-names>L</given-names></name><name><surname>Brand</surname><given-names>MD</given-names></name></person-group><year>2003</year><article-title>Superoxide and hydrogen peroxide production by Drosophila mitochondria</article-title><source>Free Radical Biology & Medicine</source><volume>35</volume><fpage>938</fpage><lpage>948</lpage><pub-id pub-id-type="doi">10.1016/S0891-5849(03)00464-7</pub-id></element-citation></ref><ref id="bib25"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Morin</surname><given-names>X</given-names></name><name><surname>Daneman</surname><given-names>R</given-names></name><name><surname>Zavortink</surname><given-names>M</given-names></name><name><surname>Chia</surname><given-names>W</given-names></name></person-group><year>2001</year><article-title>A protein trap strategy to detect GFP-tagged proteins expressed from their endogenous loci in Drosophila</article-title><source>Proceedings of the National Academy of Sciences of the United States of America</source><volume>98</volume><fpage>15050</fpage><lpage>15055</lpage><pub-id pub-id-type="doi">10.1073/pnas.261408198</pub-id></element-citation></ref><ref id="bib26"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Murad</surname><given-names>S</given-names></name><name><surname>Sivarajah</surname><given-names>A</given-names></name><name><surname>Pinnell</surname><given-names>SR</given-names></name></person-group><year>1985</year><article-title>Serum stimulation of lysyl hydroxylase activity in cultured human skin fibroblasts</article-title><source>Connective Tissue Research</source><volume>13</volume><fpage>181</fpage><lpage>186</lpage><pub-id pub-id-type="doi">10.3109/03008208509152396</pub-id></element-citation></ref><ref id="bib27"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Myllyharju</surname><given-names>J</given-names></name><name><surname>Kivirikko</surname><given-names>KI</given-names></name></person-group><year>2004</year><article-title>Collagens, modifying enzymes and their mutations in humans, flies and worms</article-title><source>Trends in Genetics</source><volume>20</volume><fpage>33</fpage><lpage>43</lpage><pub-id pub-id-type="doi">10.1016/j.tig.2003.11.004</pub-id></element-citation></ref><ref id="bib28"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Nichol</surname><given-names>H</given-names></name><name><surname>Law</surname><given-names>JH</given-names></name><name><surname>Winzerling</surname><given-names>JJ</given-names></name></person-group><year>2002</year><article-title>Iron metabolism in insects</article-title><source>Annual Review of Entomology</source><volume>47</volume><fpage>535</fpage><lpage>559</lpage><pub-id pub-id-type="doi">10.1146/annurev.ento.47.091201.145237</pub-id></element-citation></ref><ref id="bib29"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Pastor-Pareja</surname><given-names>JC</given-names></name><name><surname>Xu</surname><given-names>T</given-names></name></person-group><year>2011</year><article-title>Shaping cells and organs in Drosophila by opposing roles of fat body-secreted Collagen IV and perlecan</article-title><source>Developmental Cell</source><volume>21</volume><fpage>245</fpage><lpage>256</lpage><pub-id pub-id-type="doi">10.1016/j.devcel.2011.06.026</pub-id></element-citation></ref><ref id="bib30"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Pirskanen</surname><given-names>A</given-names></name><name><surname>Kaimio</surname><given-names>AM</given-names></name><name><surname>Myllyla</surname><given-names>R</given-names></name><name><surname>Kivirikko</surname><given-names>KI</given-names></name></person-group><year>1996</year><article-title>Site-directed mutagenesis of human lysyl hydroxylase expressed in insect cells. Identification of histidine residues and an aspartic acid residue critical for catalytic activity</article-title><source>The Journal of Biological Chemistry</source><volume>271</volume><fpage>9398</fpage><lpage>9402</lpage><pub-id pub-id-type="doi">10.1074/jbc.271.16.9398</pub-id></element-citation></ref><ref id="bib31"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Qin</surname><given-names>Q</given-names></name><name><surname>Wang</surname><given-names>X</given-names></name><name><surname>Zhou</surname><given-names>B</given-names></name></person-group><year>2013</year><article-title>Functional studies of Drosophila zinc transporters reveal the mechanism for dietary zinc absorption and regulation</article-title><source>BMC Biology</source><volume>11</volume><fpage>101</fpage><pub-id pub-id-type="doi">10.1186/1741-7007-11-101</pub-id></element-citation></ref><ref id="bib32"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Rossander-Hulten</surname><given-names>L</given-names></name><name><surname>Brune</surname><given-names>M</given-names></name><name><surname>Sandstrom</surname><given-names>B</given-names></name><name><surname>Lonnerdal</surname><given-names>B</given-names></name><name><surname>Hallberg</surname><given-names>L</given-names></name></person-group><year>1991</year><article-title>Competitive inhibition of iron absorption by manganese and zinc in humans</article-title><source>American Journal of Clinical Nutrition</source><volume>54</volume><fpage>152</fpage><lpage>156</lpage></element-citation></ref><ref id="bib33"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Suzuki</surname><given-names>T</given-names></name><name><surname>Ishihara</surname><given-names>K</given-names></name><name><surname>Migaki</surname><given-names>H</given-names></name><name><surname>Ishihara</surname><given-names>K</given-names></name><name><surname>Nagao</surname><given-names>M</given-names></name><name><surname>Yamaguchi-Iwai</surname><given-names>Y</given-names></name><name><surname>Kambe</surname><given-names>T</given-names></name></person-group><year>2005</year><article-title>Two different zinc transport complexes of cation diffusion facilitator proteins localized in the secretory pathway operate to activate alkaline phosphatases in vertebrate cells</article-title><source>The Journal of Biological Chemistry</source><volume>280</volume><fpage>30956</fpage><lpage>30962</lpage><pub-id pub-id-type="doi">10.1074/jbc.M506902200</pub-id></element-citation></ref><ref id="bib34"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Tang</surname><given-names>X</given-names></name><name><surname>Zhou</surname><given-names>B</given-names></name></person-group><year>2013a</year><article-title>Iron homeostasis in insects: Insights from Drosophila studies</article-title><source>IUBMB Life</source><volume>65</volume><fpage>863</fpage><lpage>872</lpage><pub-id pub-id-type="doi">10.1002/iub.1211</pub-id></element-citation></ref><ref id="bib35"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Tang</surname><given-names>X</given-names></name><name><surname>Zhou</surname><given-names>B</given-names></name></person-group><year>2013b</year><article-title>Ferritin is the key to dietary iron absorption and tissue iron detoxification in <italic>Drosophila melanogaster</italic></article-title><source>FASEB journal</source><volume>27</volume><fpage>288</fpage><lpage>298</lpage><pub-id pub-id-type="doi">10.1096/fj.12-213595</pub-id></element-citation></ref><ref id="bib37"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Taylor</surname><given-names>KM</given-names></name><name><surname>Morgan</surname><given-names>HE</given-names></name><name><surname>Johnson</surname><given-names>A</given-names></name><name><surname>Nicholson</surname><given-names>RI</given-names></name></person-group><year>2004</year><article-title>Structure-function analysis of HKE4, a member of the new LIV-1 subfamily of zinc transporters</article-title><source>The Biochemical Journal</source><volume>377</volume><fpage>131</fpage><lpage>139</lpage><pub-id pub-id-type="doi">10.1042/BJ20031183</pub-id></element-citation></ref><ref id="bib36"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Taylor</surname><given-names>KM</given-names></name><name><surname>Nicholson</surname><given-names>RI</given-names></name></person-group><year>2003</year><article-title>The LZT proteins; the LIV-1 subfamily of zinc transporters</article-title><source>Biochimica et Biophysica Acta</source><volume>1611</volume><fpage>16</fpage><lpage>30</lpage><pub-id pub-id-type="doi">10.1016/S0005-2736(03)00048-8</pub-id></element-citation></ref><ref id="bib38"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Tong</surname><given-names>WH</given-names></name><name><surname>Rouault</surname><given-names>TA</given-names></name></person-group><year>2006</year><article-title>Functions of mitochondrial ISCU and cytosolic ISCU in mammalian iron-sulfur cluster biogenesis and iron homeostasis</article-title><source>Cell metabolism</source><volume>3</volume><fpage>199</fpage><lpage>210</lpage><pub-id pub-id-type="doi">10.1016/j.cmet.2006.02.003</pub-id></element-citation></ref><ref id="bib39"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Tuderman</surname><given-names>L</given-names></name><name><surname>Myllyla</surname><given-names>R</given-names></name><name><surname>Kivirikko</surname><given-names>KI</given-names></name></person-group><year>1977</year><article-title>Mechanism of the prolyl hydroxylase reaction. 1. Role of co-substrates</article-title><source>European Journal of Biochemistry</source><volume>80</volume><fpage>341</fpage><lpage>348</lpage><pub-id pub-id-type="doi">10.1111/j.1432-1033.1977.tb11888.x</pub-id></element-citation></ref><ref id="bib40"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Valentine</surname><given-names>RA</given-names></name><name><surname>Jackson</surname><given-names>KA</given-names></name><name><surname>Christie</surname><given-names>GR</given-names></name><name><surname>Mathers</surname><given-names>JC</given-names></name><name><surname>Taylor</surname><given-names>PM</given-names></name><name><surname>Ford</surname><given-names>D</given-names></name></person-group><year>2007</year><article-title>ZnT5 variant B is a bidirectional zinc transporter and mediates zinc uptake in human intestinal Caco-2 cells</article-title><source>Journal of Biological Chemistry</source><volume>282</volume><fpage>14389</fpage><lpage>14393</lpage><pub-id pub-id-type="doi">10.1074/jbc.M701752200</pub-id></element-citation></ref><ref id="bib41"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>van der Slot</surname><given-names>AJ</given-names></name><name><surname>Zuurmond</surname><given-names>AM</given-names></name><name><surname>Bardoel</surname><given-names>AF</given-names></name><name><surname>Wijmenga</surname><given-names>C</given-names></name><name><surname>Pruijs</surname><given-names>HE</given-names></name><name><surname>Sillence</surname><given-names>DO</given-names></name><name><surname>Brinckmann</surname><given-names>J</given-names></name><name><surname>Abraham</surname><given-names>DJ</given-names></name><name><surname>Black</surname><given-names>CM</given-names></name><name><surname>Verzijl</surname><given-names>N</given-names></name><name><surname>DeGroot</surname><given-names>J</given-names></name><name><surname>Hanemaaijer</surname><given-names>R</given-names></name><name><surname>TeKoppele</surname><given-names>JM</given-names></name><name><surname>Huizinga</surname><given-names>TW</given-names></name><name><surname>Bank</surname><given-names>RA</given-names></name></person-group><year>2003</year><article-title>Identification of PLOD2 as telopeptide lysyl hydroxylase, an important enzyme in fibrosis</article-title><source>The Journal of Biological Chemistry</source><volume>278</volume><fpage>40967</fpage><lpage>40972</lpage><pub-id pub-id-type="doi">10.1074/jbc.M307380200</pub-id></element-citation></ref><ref id="bib42"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Vanoaica</surname><given-names>L</given-names></name><name><surname>Darshan</surname><given-names>D</given-names></name><name><surname>Richman</surname><given-names>L</given-names></name><name><surname>Schumann</surname><given-names>K</given-names></name><name><surname>Kuhn</surname><given-names>LC</given-names></name></person-group><year>2010</year><article-title>Intestinal ferritin H is required for an accurate control of iron absorption</article-title><source>Cell Metabolism</source><volume>12</volume><fpage>273</fpage><lpage>282</lpage><pub-id pub-id-type="doi">10.1016/j.cmet.2010.08.003</pub-id></element-citation></ref><ref id="bib44"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Wang</surname><given-names>CY</given-names></name><name><surname>Jenkitkasemwong</surname><given-names>S</given-names></name><name><surname>Duarte</surname><given-names>S</given-names></name><name><surname>Sparkman</surname><given-names>BK</given-names></name><name><surname>Shawki</surname><given-names>A</given-names></name><name><surname>Mackenzie</surname><given-names>B</given-names></name><name><surname>Knutson</surname><given-names>MD</given-names></name></person-group><year>2012</year><article-title>ZIP8 is an iron and zinc transporter whose cell-surface expression is up-regulated by cellular iron loading</article-title><source>Journal of Biological Chemistry</source><volume>287</volume><fpage>34032</fpage><lpage>34043</lpage><pub-id pub-id-type="doi">10.1074/jbc.M112.367284</pub-id></element-citation></ref><ref id="bib43"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Wang</surname><given-names>X</given-names></name><name><surname>Wu</surname><given-names>Y</given-names></name><name><surname>Zhou</surname><given-names>B</given-names></name></person-group><year>2009</year><article-title>Dietary zinc absorption is mediated by ZnT1 in Drosophila melanogaster</article-title><source>FASEB Journal</source><volume>23</volume><fpage>2650</fpage><lpage>2661</lpage><pub-id pub-id-type="doi">10.1096/fj.08-126649</pub-id></element-citation></ref><ref id="bib45"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Whittaker</surname><given-names>P</given-names></name></person-group><year>1998</year><article-title>Iron and zinc interactions in humans</article-title><source>American Journal of Clinical Nutrition</source><volume>68</volume><supplement>2 suppl</supplement><fpage>442S</fpage><lpage>446S</lpage></element-citation></ref><ref id="bib46"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Xiao</surname><given-names>G</given-names></name><name><surname>Fan</surname><given-names>Q</given-names></name><name><surname>Wang</surname><given-names>X</given-names></name><name><surname>Zhou</surname><given-names>B</given-names></name></person-group><year>2013</year><article-title>Huntington disease arises from a combinatory toxicity of polyglutamine and copper binding</article-title><source>Proceedings of the National Academy of Sciences of the United States of America</source><volume>110</volume><fpage>14995</fpage><lpage>15000</lpage><pub-id pub-id-type="doi">10.1073/pnas.1308535110</pub-id></element-citation></ref><ref id="bib47"><element-citation publication-type="journal"><person-group person-group-type="author"><name><surname>Yeowell</surname><given-names>HN</given-names></name><name><surname>Walker</surname><given-names>LC</given-names></name></person-group><year>2000</year><article-title>Mutations in the lysyl hydroxylase 1 gene that result in enzyme deficiency and the clinical phenotype of Ehlers-Danlos syndrome type VI</article-title><source>Molecular Genetics and Metabolism</source><volume>71</volume><fpage>212</fpage><lpage>224</lpage><pub-id pub-id-type="doi">10.1006/mgme.2000.3076</pub-id></element-citation></ref></ref-list></back><sub-article article-type="article-commentary" id="SA1"><front-stub><article-id pub-id-type="doi">10.7554/eLife.03191.021</article-id><title-group><article-title>Decision letter</article-title></title-group><contrib-group content-type="section"><contrib contrib-type="editor"><name><surname>Schekman</surname><given-names>Randy</given-names></name><role>Reviewing editor</role><aff><institution>Howard Hughes Medical Institute, University of California, Berkeley</institution>, <country>United States</country></aff></contrib></contrib-group></front-stub><body><boxed-text><p>eLife posts the editorial decision letter and author response on a selection of the published articles (subject to the approval of the authors). An edited version of the letter sent to the authors after peer review is shown, indicating the substantive concerns or comments; minor concerns are not usually shown. Reviewers have the opportunity to discuss the decision before the letter is sent (see <ext-link ext-link-type="uri" xlink:href="http://elifesciences.org/review-process">review process</ext-link>). Similarly, the author response typically shows only responses to the major concerns raised by the reviewers.</p></boxed-text><p>Thank you for sending your work entitled “Slc39a13 supplies iron into the secretory pathway in <italic>Drosophila melanogaster</italic>” for consideration at <italic>eLife.</italic> Your article has been favorably evaluated by Randy Schekman (Senior editor) and 3 reviewers.</p><p>The Senior editor and the reviewers discussed their comments before we reached this decision, and the Senior editor has assembled the following comments to help you prepare a revised submission.</p><p>In this manuscript the authors examine the role of drosophila Zip13 in the transport of iron and zinc. Zip13 is of particular interest because mutations in humans are associated with a sub type of Ehlers-Danlos, a connective tissue disorder. They present strong and convincing evidence that Zip13 is primarily involved in the transport of iron rather than zinc. This is not without precedent as the ZIP family of transporters has been found to include both iron and zinc transporters in several species. The authors also present evidence that ZIP13 localizes to intracellular vesicles and directs iron efflux from the cytosol to the secretory pathway.</p><p>The data regarding the role of Zip13 in iron rather than zinc transport is entirely convincing and highly significant. The significance is increased because of the relevance to human disease. The data regarding the role of Zip13 as an iron efflux transporter is less convincing. As this would be a very unusual property for a metal transporter – some family members functioning as importers with one functioning as an efflux pump – the strength of the evidence needed to support this conclusion may be beyond the scope of this manuscript.</p><p>Several concerns are:</p><p>1) The use of the in-gel aconitase assay as a measure of cytosolic iron. The labile iron-sulfur cluster of cytosolic aconitase is indeed lost in iron-deficient cells, but conditions other than iron deficiency can also lead to cluster disassembly, ie oxidative stress, nitrosative stress, both of which could be occurring here. Furthermore, the in-gels assay is only semi-quantitative at best. Many of the phenotypes associated with the knockdown or overexpression of Zip13 could also be accounted for by loss or gain of cellular iron uptake. In fact, the reduced level of whole cell iron in the gut cells of knockdowns (<xref ref-type="fig" rid="fig3">Figure 3C</xref>) supports a role in iron uptake rather than efflux.</p><p>2) The use of <italic>E. coli</italic> for expression studies. The lipid environment and mechanisms for inserting polytopic proteins into membranes are very different in prokaryotes vs. eukaryotes. Yeast would have been a much better choice for a model cell in this case. Nonetheless, the data support the authors’ conclusions.</p><p>3) The lack of an endosomal marker control in the co-localization studies. If Zip13 is really in ER/Golgi, then an endosomal marker would fail to co-localize.</p><p>4) The use of a GFP tagged protein without demonstrating that the tag is not cleaved from the Zip13 in cells. This is needed to confirm that the GFP signal corresponds to that of the rest of the Zip13. The diffuse background staining seen in some images suggests this could be a problem.</p><p>However, in support of the authors’ conclusions:</p><p>1) the data in <xref ref-type="fig" rid="fig7">Figure 7</xref> offer good support of the authors' hypothesis that Zip13 is mediating efflux from an intracellular compartment.</p><p>2) The data regarding the rescue of fly Zip13 knockdowns with human Zip13 are convincing.</p><p>3) The use of the Viking-GFP trap is also highly suggestive that the flies have a defect in collagen production.</p><p>In summary, the data suggesting Zip13 is involved in iron transport are strong and significant. The data indicating it is an efflux pump are weaker and not entirely convincing. It would be reasonable to acknowledge the limitations of the efflux data and present them as one possible interpretation of preliminary data, but confirmation would require additional evidence.</p></body></sub-article><sub-article article-type="reply" id="SA2"><front-stub><article-id pub-id-type="doi">10.7554/eLife.03191.022</article-id><title-group><article-title>Author response</article-title></title-group></front-stub><body><p><italic>[…] The data regarding the role of Zip13 in iron rather than zinc transport is entirely convincing and highly significant. The significance is increased because of the relevance to human disease. The data regarding the role of Zip13 as an iron efflux transporter is less convincing. As this would be a very unusual property for a metal transporter – some family members functioning as importers with one functioning as an efflux pump – the strength of the evidence needed to support this conclusion may be beyond the scope of this manuscript</italic>.</p><p><italic>Several concerns are</italic>:</p><p><italic>1) The use of the in-gel aconitase assay as a measure of cytosolic iron. The labile iron-sulfur cluster of cytosolic aconitase is indeed lost in iron-deficient cells, but conditions other than iron deficiency can also lead to cluster disassembly, ie oxidative stress, nitrosative stress, both of which could be occurring here. Furthermore, the in-gels assay is only semi-quantitative at best. Many of the phenotypes associated with the knockdown or overexpression of Zip13 could also be accounted for by loss or gain of cellular iron uptake. In fact, the reduced level of whole cell iron in the gut cells of knockdowns (</italic><xref ref-type="fig" rid="fig3"><italic>Figure.3C</italic></xref><italic>) supports a role in iron uptake rather than efflux</italic>.</p><p>Yes, aconitase activity can also be subjected to oxidative stress. To further corroborate our statement that Zip13 knockdown in the gut indeed led to cytosolic iron increase and Zip13 overexpression cytosolic iron decrease, we examined how genes involved in iron homeostasis would behave in these cases (i.e., do they behave as in iron-rich or iron-poor condition?). Ferritin and iron uptaker Malvolio (fly NRAMP homologue) were chosen. Under iron-replete conditions gut ferritin is induced in both the transcript and protein level, while Malvolio is repressed, and vice versa. We then analyzed ZIP13-RNAi and ZIP13-OE flies. ZIP13-RNAi saw a dramatic increase of ferritin and a depression of Malvolio, exactly coinciding with what has happened under iron replete situation (Newly added data shown in <xref ref-type="fig" rid="fig3">Figure 3C, D</xref>, and corresponding text added in the Results). So physiologically speaking, when dZIP13 is knocked-down, gut cells “feel” an iron surplus state, and respond by dramatically increased ferritin expression and reduced expression of iron uptaker Malvolio. These are indirect lines of evidence, but constitute fairly strong indirect lines of evidence together with the aconitase assay in suggesting gut cytosolic iron is reduced when dZIP13 is overexpressed and increased when knockdown.</p><p>Contrary to the cytosolic state, that of the secretory compartment is opposite in these cases, i.e., in ZIP13-RNAi and ZIP13-OE flies, iron in the secretory compartments would be reduced and increased respectively. The reason that overall iron reduction is observed in dZIP13-RNAi gut is mostly likely that in fly, ferritin, to which most iron is bound, is in the secretory pathway (unlike mammalians most ferritin is in the cytosol). Indeed, ferric staining highly depends on the presence of ferritin. In other words, the lower total cellular iron in dZIP13-RNAi gut is likely because that gut cells are in a state of iron surplus in the cytosol and a feedback control of iron uptake is thus exerted leading to a reduction of total cellular iron level (cytosolic iron + secretory iron).</p><p>The similar expressional change patterns of Mvl and ferritin through dZIP13 RNAi or iron feeding argue against the suggestion that dZIP13 might be involved in iron uptake because if dZIP13 were an iron uptaker, dZIP13-RNAi gut cells would have responded as if lack of iron. Instead, they responded as if they were experiencing an iron overdose.</p><p><italic>2) The use of E. coli for expression studies. The lipid environment and mechanisms for inserting polytopic proteins into membranes are very different in prokaryotes vs. eukaryotes. Yeast would have been a much better choice for a model cell in this case. Nonetheless, the data support the authors’ conclusions</italic>.</p><p>Iron transport assay has normally to be performed with surface-resident protein, by measuring extracellular and intracellular radioactivities. For an intracellular membrane protein such as dZIP13 this would be hard to do technically, unless with purified organelle. In other words, expression in yeast would most likely result in intracellular residence of dZIP13, in which case direct iron transport assay with whole cells would be hard to do.</p><p>E. coli has no intracellular membrane. So as long as the protein is located to the membrane it will be in the plasma membrane and enable direct measurement of radioactive iron transport. We mentioned this rationale in the original text under the section “Radioisotope transporting experiments demonstrate dZIP13 as an iron exporter”.</p><p>We also purified fly ER/Golgi organelle and measured iron transport. The result showed that indeed dZIP13 mediates iron transport to ER/Golgi.</p><p><italic>3) The lack of an endosomal marker control in the co-localization studies. If Zip13 is really in ER/Golgi, then an endosomal marker would fail to co-localize</italic>.</p><p>We added two endosomal markers, an early endosomal marker FYVE (Bloomington #39695) and a later endosomal marker LAMP (Bloomington #42714). The results showed that dZIP13 does not co-localize well, if at all, with endosomal markers (new <xref ref-type="fig" rid="fig5">Figure 5C</xref>).</p><p><italic>4) The use of a GFP tagged protein without demonstrating that the tag is not cleaved from the Zip13 in cells. This is needed to confirm that the GFP signal corresponds to that of the rest of the Zip13. The diffuse background staining seen in some images suggests this could be a problem.</italic></p><p>Following this advice, Anti-GFP antibody was used to analyze protein extracts from Da>EGFP (as a control) and Da>dZIP13-EGFP 3rd larvae. The results imply that the EGFP tag is not cleaved from dZIP13 protein in vivo (see <xref ref-type="fig" rid="fig10">Author response image 1</xref>), indicating the original signal seen should be largely from dZIP13-EGFP. The original diffuse background signal is likely due to the fact that the picture was not a cofocal image, and was taken under a Nikon ECLIPES 80i microscope.<fig id="fig10" position="float"><label>Author response image 1.</label><caption><p>Western blot of dZIP13-EGFP larval extract for EGFP to asses EGFP fusion protein stability. Anti-GFP antibody was used. The GFP lane is the extract from Da>GFP flies (4ug). The control lane is normal fly sample (no EGFP expression) (80ug). Little free EGFP was detected in dZIP13-EGFP sample (80ug). An extra band below that of dZIP13-EGFP is likely a background signal because it is also detected in normal fly sample (control lane).</p></caption><graphic xlink:href="elife03191f010"/></fig></p><p>Because of the lesser quality of this picture, its partial redundancy with <xref ref-type="fig" rid="fig5">Figure 5A and B</xref> (which respectively show a myc fusion and dZIP13 antibody staining), and likely misunderstanding arising from it, we decided to remove this particular picture from the current revision.</p><p><italic>However, in support of the authors’ conclusions:</italic></p><p><italic>1) the data in</italic> <xref ref-type="fig" rid="fig7"><italic>Figure 7</italic></xref> <italic>offer good support of the authors' hypothesis that Zip13 is mediating efflux from an intracellular compartment</italic>.</p><p><italic>2) The data regarding the rescue of fly Zip13 knockdowns with human Zip13 are convincing</italic>.</p><p><italic>3) The use of the Viking-GFP trap is also highly suggestive that the flies have a defect in collagen production</italic>.</p><p><italic>In summary, the data suggesting Zip13 is involved in iron transport are strong and significant. The data indicating it is an efflux pump are weaker and not entirely convincing. It would be reasonable to acknowledge the limitations of the efflux data and present them as one possible interpretation of preliminary data, but confirmation would require additional evidence.</italic></p><p>After the revisions, we consider the evidence supporting dZIP13 as iron efflux pump are reasonably or fairly strong. The main supporting evidence, among other evidence, follows:</p><p>A) direct evidence is presented to show that when dZIP13 expression is knocked-down, the ER/Golgi lacks iron, while strong indirect evidence is provided (additional evidence provided in this revision as described above) to show cytosol is replete with iron in this case, and vice versa.</p><p>B) radioisotope iron transport assays with E. coli and ER/Golgi indicate directly dZIP13 as iron efflux pump.</p><p>These would be considered very strong evidence for showing a protein as an iron effluxer. However, as also pointed out by the editor/reviewers, it is very unusual when other reported cases of the family members (ZIP or SLC39A) are all importers and this one turns out as an exporter. Having said this, it is also noteworthy that zinc efflux protein ZnT5 (SLC30A5) can mediate zinc transport in both directions (<xref ref-type="bibr" rid="bib40">Valentine et al., 2007</xref>). In the revision, we added these comments in the Discussion.</p><p>At the end of the first paragraph:</p><p>“Our studies clearly demonstrated that expressional alteration of dZIP13 mainly affects iron instead of zinc metabolism. Modulating dZIP13 expression in the gut cell resulted opposite iron change in the cytosol and secretory organelles, and radioisotope iron transport assay further showed that dZIP13 mediates iron exporting, providing compelling evidence in supporting dZIP13 as an iron efflux pump. Future biochemistry/biophysical work is needed to decipher the exact mechanistic detail of the transportation process and evidence thus obtained may further substantiate the conclusion of dZIP13 as an iron effluxing protein.”</p><p>And at the beginning of fourth paragraph:</p><p>“Considering the unusual nature of dZIP13 as an iron exporter while other members of the family (SLC39A) so far identified all appear to be importers, it is noteworthy that zinc efflux protein ZnT5 (SLC30A5) can mediates zinc transport in both directions (<xref ref-type="bibr" rid="bib40">Valentine et al., 2007</xref>).”</p></body></sub-article></article> |