Skip to content
Permalink
Branch: master
Find file Copy path
Find file Copy path
Fetching contributors…
Cannot retrieve contributors at this time
369 lines (369 sloc) 27.2 KB
{
"Locus": "NC_045512 29903 bp ss-RNA linear VRL 17-JAN-2020",
"Definition": "Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete",
"Accession": "NC_045512",
"Version": "NC_045512.2",
"Dblink": "BioProject: PRJNA485481",
"Keywords": "RefSeq.",
"Source": {
"Wuhan_seafood_market_pneumonia_virus": {
"ORGANISM": "Wuhan seafood market pneumonia virusViruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae;Orthocoronavirinae; Betacoronavirus; unclassified Betacoronavirus."
}
},
"Reference": {
"1___bases_1_to_29903_": {
"AUTHORS": "Wu,F., Zhao,S., Yu,B., Chen,Y.-M., Wang,W., Hu,Y., Song,Z.-G.,Tao,Z.-W., Tian,J.-H., Pei,Y.-Y., Yuan,M.L., Zhang,Y.-L.,Dai,F.-H., Liu,Y., Wang,Q.-M., Zheng,J.-J., Xu,L., Holmes,E.C. andZhang,Y.-Z.",
"TITLE": "A novel coronavirus associated with a respiratory disease in Wuhanof Hubei province, China",
"JOURNAL": "Unpublished"
},
"2___bases_1_to_29903_": {
"CONSRTM": "NCBI Genome Project",
"TITLE": "Direct Submission",
"JOURNAL": "Submitted (17-JAN-2020) National Center for BiotechnologyInformation, NIH, Bethesda, MD 20894, USA"
},
"3___bases_1_to_29903_": {
"AUTHORS": "Wu,F., Zhao,S., Yu,B., Chen,Y.-M., Wang,W., Hu,Y., Song,Z.-G.,Tao,Z.-W., Tian,J.-H., Pei,Y.-Y., Yuan,M.L., Zhang,Y.-L.,Dai,F.-H., Liu,Y., Wang,Q.-M., Zheng,J.-J., Xu,L., Holmes,E.C. andZhang,Y.-Z.",
"TITLE": "Direct Submission",
"JOURNAL": "Submitted (05-JAN-2020) Shanghai Public Health Clinical Center &School of Public Health, Fudan University, Shanghai, China"
}
},
"Comment": "PROVISIONAL REFSEQ: This record has not yet been subject to final",
"Features": {
"Location_Qualifiers": {
"source": {
"From_1_to_29903": {
"organism": "Wuhan seafood market pneumonia virus",
"mol_type": "genomic RNA",
"isolate": "Wuhan-Hu-1",
"host": "Homo sapiens",
"db_xref": "taxon:2697049",
"country": "China",
"collection_date": "Dec-2019"
}
},
"5'UTR": "1..265",
"gene": {
"From_266_to_21555": {
"gene": "orf1ab",
"locus_tag": "GU280_gp01",
"db_xref": "GeneID:43560238"
},
"From_21563_to_25384": {
"gene": "S",
"locus_tag": "GU280_gp02",
"db_xref": "GeneID:43560230"
},
"From_25393_to_26220": {
"gene": "ORF3a",
"locus_tag": "GU280_gp03",
"db_xref": "GeneID:43560231"
},
"From_26245_to_26472": {
"gene": "E",
"locus_tag": "GU280_gp04",
"db_xref": "GeneID:43560232"
},
"From_26523_to_27191": {
"gene": "M",
"locus_tag": "GU280_gp05",
"db_xref": "GeneID:43560233"
},
"From_27202_to_27387": {
"gene": "ORF6",
"locus_tag": "GU280_gp06",
"db_xref": "GeneID:43560234"
},
"From_27394_to_27759": {
"gene": "ORF7a",
"locus_tag": "GU280_gp07",
"db_xref": "GeneID:43560235"
},
"From_27894_to_28259": {
"gene": "ORF8",
"locus_tag": "GU280_gp08",
"db_xref": "GeneID:43560236"
},
"From_28274_to_29533": {
"gene": "N",
"locus_tag": "GU280_gp09",
"db_xref": "GeneID:43560237"
},
"From_29558_to_29674": {
"gene": "ORF10",
"locus_tag": "GU280_gp10",
"db_xref": "GeneID:43569679"
}
},
"CDS": {
"join_From_266_to_13468_From_13468_to_21555_": {
"gene": "orf1ab",
"locus_tag": "GU280_gp01\/ribosomal_slippage",
"note": "translated by -1 ribosomal frameshift",
"codon_start": "1",
"product": "orf1ab polyprotein (pp1ab)",
"protein_id": "YP_009724389.1",
"db_xref": "GeneID:43560238",
"translation": "MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN"
},
"From_21563_to_25384": {
"gene": "S",
"locus_tag": "GU280_gp02",
"note": "structural protein",
"codon_start": "1",
"product": "surface glycoprotein",
"protein_id": "YP_009724390.1",
"db_xref": "GeneID:43560230",
"translation": "MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT"
},
"From_25393_to_26220": {
"gene": "ORF3a",
"locus_tag": "GU280_gp03",
"codon_start": "1",
"product": "ORF3a protein",
"protein_id": "YP_009724391.1",
"db_xref": "GeneID:43560231",
"translation": "MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL"
},
"From_26245_to_26472": {
"gene": "E",
"locus_tag": "GU280_gp04",
"note": "structural protein; E protein",
"codon_start": "1",
"product": "envelope protein",
"protein_id": "YP_009724392.1",
"db_xref": "GeneID:43560232",
"translation": "MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV"
},
"From_26523_to_27191": {
"gene": "M",
"locus_tag": "GU280_gp05",
"note": "structural protein",
"codon_start": "1",
"product": "membrane glycoprotein",
"protein_id": "YP_009724393.1",
"db_xref": "GeneID:43560233",
"translation": "MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ"
},
"From_27202_to_27387": {
"gene": "ORF6",
"locus_tag": "GU280_gp06",
"codon_start": "1",
"product": "ORF6 protein",
"protein_id": "YP_009724394.1",
"db_xref": "GeneID:43560234",
"translation": "MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID"
},
"From_27394_to_27759": {
"gene": "ORF7a",
"locus_tag": "GU280_gp07",
"codon_start": "1",
"product": "ORF7a protein",
"protein_id": "YP_009724395.1",
"db_xref": "GeneID:43560235",
"translation": "MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE"
},
"From_27894_to_28259": {
"gene": "ORF8",
"locus_tag": "GU280_gp08",
"codon_start": "1",
"product": "ORF8 protein",
"protein_id": "YP_009724396.1",
"db_xref": "GeneID:43560236",
"translation": "MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI"
},
"From_28274_to_29533": {
"gene": "N",
"locus_tag": "GU280_gp09",
"note": "structural protein",
"codon_start": "1",
"product": "nucleocapsid phosphoprotein",
"protein_id": "YP_009724397.2",
"db_xref": "GeneID:43560237",
"translation": "MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA"
},
"From_29558_to_29674": {
"gene": "ORF10",
"locus_tag": "GU280_gp10",
"codon_start": "1",
"product": "ORF10 protein",
"protein_id": "YP_009725255.1",
"db_xref": "GeneID:43569679",
"translation": "MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT"
}
},
"3'UTR": "29675..29903"
}
},
"Origin": {
"_ArrayType_": "uint8",
"_ArraySize_": [1,29903],
"_ArrayZipSize_": [1,29903],
"_ArrayZipType_": "zlib",
"_ArrayZipData_": "eJx9nUuWHEkOA8/KxwUvwPu/qaQZPNSbGWmkUlVkhH9IEAA9s2u3qmb27++t7t3u/v27qv9+
8Pc1///7eU9t//3avx/el38v+v37d9lwyd+X/ODv1/z+7r9v933Z9ff/vyvm92X/fvD39/we
Wr/X/Z7Hl/eyv1tP/cZRvwvrhvP77t81vxHc/bjt7xU3/N9P+/fk+1nfaH+/f4/7vaj+uWpu
hPW7qJjs39V/D5vfC38T/FuE5fqb3O+y30jqXn5jqd9Pf1f//t4b6+/ufxf/BnGDva9+I+TW
zfim7vdvGje83zzuvsU4bz9+o/ktkwv5W7bfIG5Z6sbc99zfANie3w78Rv9boVuFm/xv9L9h
TTGm36W/G/9e9Zvg78/fOObuPDfp34oN630Pqr3Z3jL/ZvUb0t6E7rlzy5VFuxvOb3i/UPjF
TmbQvw1nlfjNst9tb/9vXW4Efy/4u89vtr+ftpt5l/wecLHxWxNW+/cil+t32a3r3Bqyf2ze
b+FvxLeTTJLB/4b22xi2dee+viH/nv73lFuDIpRZ3t94LkGIxRvwPf031bp1uPW8sGdDL7Xu
scTHzfoec8+89LnY9L4zZBSJ0LdWQ+DWJcnvt8OuG/DN+nc9u3LROgYAYXPTustIkrpI2PWF
vPq3S8U3Nlf8feu3qb8XkgC3tr+RHF740tu0Ysl/z1nBYyZxa/De4pgad+ML7iCMWX4ZNpcY
PPGe7i0vym7sZOMye9L6YsQoZYtIp1+wXMwweNafIO7JlBJIkwVg+36By8XJyoOq2+w+2Du8
87blzt0sLiV+4EEi1eXyBQS7VocFF+RkzDrZZomI30vDZM3lyC8aWWdW4mJV8AWZL1bJbW7b
LlHzskvGBGTNRTfJcTPhqUAbUzscI4cBB/Dq4sQIXxOfMLmYM28LRGJh2B1rRm5yF/+mdVlz
+zFg4oL5DPcm0dkuknsnZeyHdQueAF1UMh5aBxBD9i1Pv50EVI3OEmPB93HM5trNr5njL8VJ
9i1y/f4U1S0DrCX1CEz65QxVcA3RORi/CLn9ma+sHAYDPDeT33MtV5d+RRndhG0T/heQdX9z
0YEAS3q3uHv1oewtxlxU3Mqz49l0EvHyaALn5R2292HvCrwFkBaw2iT7C+Wxji3rDaDNfecw
nSy94MyuJZ8odSzQuuWXZDfat8uda7KlPuvwmBQ0mVYsuicIaqnYPOWWc0EUY2CMkA6AEFZX
j9jNWoch07mELaLAbJjMq9sVsUbdHlAS5FZX1DvouSFASz3ghSVvE17u3gQhnGEfjBDGhBag
UlYcouKmIJTdF3cNG3IlReKzZX2cBzMQBljHFQ7gfqB0VyHlHpdQF8KhmRXyWd+S3bYC/m1y
F1l/U6As3pfOunNRuddkbldqnHWHuLivMz7wx9sc1Fy+GfqQ2GTjUoyge+CtdWOsAoe1hEgq
1iwJWCkbdcUEbuGODLed47vmKenewKEXuIkkUVLrUrzYGDjWhoq0dx4xNuWsTKL8vo29kmhV
dZ8YDXjHra7uyZwrxafcGkqqDGV7k7V5Sn9PJLK851AKjQhrBP88TDjsQRKUWczafCgvyF+B
KlhuCSrwv/1iOFAAxSqjBdi1vqtoGlVyD4B9QZbgI6AJlWi+8sHaGL3cbwizo+l3qyXowYwn
DFQwahGg6T+gfTt0y7jhCdmUI7ZceZDYgamVMzBzZvmr+CRqwUBWLJmVNImuHcq1LxWnAqOS
4DXpQr9TXlVgAJHsqSsVnh/fwDapfUud/Hs4LeygPQmPw1cGZo6MYze1C8EqP4G4IQnap9Xj
HRLUt6oi7lH+i59tqaCgCnlEN5Ma9dLh4UY97WiQy4GBuHYvjBxBGUI7ryiwcr0PUZmH8kCB
sJZwtrItLKRhmAaBTbhCxtqqy6MUiYcjtYmZejSAipPgIcFNlJQPIj8ijvQc2XEhCimvqQ1j
gpC9xWJ2mPUcAswE6oT3ljOgnYlEQ8+77ru7NEo0PMYjl/gwv1Nbe4UJ6UhQTQsA3nFIi0a2
+E7LMjQE4oC4ffXkLNlCYWlph3xeSEn1wqEYSkOZF2rayqSoKxXFeCvMroLgZfo/+SzbTACJ
JS0phPKDRdF0/8DaWAWpCSxhv02kWrFurh5ELMooc97s44KrsQOcyKsUzVxlyA39A6YQIJJ8
igiKpjflYcE1bJ9SXz6Ysvy9YNkyrm4972bHptAb4dtrkq6yOY/aihliPt36WFPGEiPVTY5f
AKOJlkrViSTpRKkbQa8tpyb/ig+17pG8lGw1Ey1A0BEZwnyVyfVVaJgO0qrGvKKYSp8GKtJZ
WcwWKmar4o8k3bDjfEjpkpiqw8i4BMNaRSp5Dpt6kb1WqMa/2tQiZOalHyXiiQt3bphLwM2N
loUEqRLeVVGVSaKrKaAYJtW4dxKweghZoeJyw3+qDWy+wvGYCeUlzLzVWxPCMd92h+rABiaK
SZZe65of3j5Et4RZOxN8LCpuHRsshSvzF0QiD3j6jTE20UZRUtTfCkMR1UTT0sXaLMOoLEb0
Rn3rDkLzTOe2BAgIExaNzXG7jC7YR6RLEV4jfNbDg8L5XMmwNySHDGNNjpKly7Xl1fWp4E+9
bfhJ4YhYuTbF3e+Ym/3CjRCY0kLvDj28OfPPkZxgMMrSnL+QBbZTlkL89hs+y/sG09omwl7Y
oLuDezeSxAgrq/dWqo+0kIKi3/HiSsabkiIFKhdt+uONaKHV7MV48npRYZ+/GdUKrhGZHVpV
nTXoURZFnei9/FbySPRAhDcUt/H6UhC5Z++TJxuQelXgiXadVDTaYkGSrTQSMFKw+lm2fhvD
BCUBMNPIScy2EVcd2L7mxqZSYB9bNGu//dUtNG8xg7TCmKHcPp6/PLnVIzcbLhqotSIC4tEQ
3U31JN8kk58Eq2fYk5+JyXm5syF4yBorpSx2hR8pvgRHYV/utVUcmg6v/y18vzGT36qDmAD0
F3ATXSFd93VIm8hhMUULSxyIaJ+K5ftnB5hd211qKw9rfR0PkeqjzQxCv0ifx00liCcVStUX
6+LJun2ub1yb98LeD96z8r3Rs6/6EFGNzf6+86hpsHkREvvIt1DTcV/tTEGGJ4tDu2R9FKP1
R5JMmPUa5McR+Hu9rJz40iN8VBB6tp1nR3+8LqLQWvqZjdnv/fQaUjGdOYZtHgDSKk54QIRw
xZmUTaXxlpoopT5Ug47EvLiGkY+tYGOluGjHKFWID/IOT2DVVCttCLeNPNHvWwsEWmfSY3qF
mDAoGRKSZpiA4B5sGkrVw8Crd0APFdf+rDGG+CL17Cjw/6S3Plvr5xSP1YhzvP6q0AzkfMU6
ssrI+Sjx+NwWeqqMbPR5i6Wr/saHDc430SMa1y5A14srHaQHJ6iAtiMKtEQdT1aj47hajLV5
Qj7bYKV5+0Lo5islMPjKhoCixNKp6uyYmUE8IDwrtmkuB0hNgULBwXxXr0xSOA8BoMr+NPci
vNrCu60miWuxtNVeL0EogRuq1FI41B4gEB1Mio+uPvxKBGsUbbaYmi7Ui9komUmgbXqeasNV
j6z7lZIVW4bdwD543p1TWHmvA2/hwIoz1a8UBiKklEezFRHp1tUjSaCVTdFEyj/ELLZQ61Jt
xhYI3ZcK+GDOcCxbtqZEX62tpa+nwfDYXRo9dLezra2Chg+AyjYHlTNrFzV+AayClPqcxkrN
qud3dcfwBvx1yyWomk4UrrH/ZonlnIRafSLvZa0uVUfld6ertJ45IU/hjhv+r9etkq5PoZSl
gYh/Tl1q1n54vtZHc1x1M3gzcPsnnMzwR21Gt+RzTQEjjxN44sQyBH2DGupi2VHsTjSU7ah3
5xRm435N+cj5WY+fvNMmzOThTFjEBE+83Y0jrRNE7z5xLfSrHtd6FPN2ENNRhyoCYRjzjwIb
HaHcG32QfvTv6Hon3qjRR2qoexV6pYSP4VEhQyoiAbxSAlabvOVz1Y/yebpkcb5lXpaQet0x
qHbiMHQ4O+K85UGP3LylULES0ev5JXA6kpTlIoBXJo7yn7gmCSrJTc5qmIgVJHm09UlyYplj
TAqOj6vs9zxi6XmDY8/1A61S6FEE3wGe625XlKYyndMKJ39XoaR+mrTXsV+AL7dyVIdKPP2+
/vhzW1PYsTu/I5nqOGusK/XWrGFxDWFcDoAvvWDchg4u/kN+8RdqPTYFDZLCnXKUQGqQ+GSy
I5XJnJro3159udlEF+5fKpKcpp+MbemGNoXYYtuX0DyMQoloD8Kqb+0mFs1sOoFjQ2xC2Co0
6im20l7Qta70ubBKxKdC8ks/Okc02rN+AfKWWrp9IAwhnyWdbFDC6ISdPlt/pqtEEffMm2wq
1ETSKWBdKwx8jQ4HkLZVSbsJjgXirInTmUPFaA2rn89D42QjpZQ6Nq8L9jpyHTQNu8hqEED9
SXjFGdakgUh4t1vuDV0B4EyZqPGfzDJUPHvA2G7WIUCIORN2df9cB+h48kAWHa0dXrX1CPjo
Gt7i/FMsJ3xM1UJttWBkGcNRQ3nN31FzNHTTpnHZUeBwGlH+OvBu8HaquajQYgx/clBDZb9J
zgfT0YE3LzEwQ0V7jiXbTssT0f1B/tjHXk1UYbr94YvF5rvxw1fRYrVicHFaRv2gt9cOY0Lb
RtJszq6p2S8vJMVJikjk8KKkEbUrpy87TbWWO9ji1wrOYZyxb1Kf1LD/MGJ+WToriKRZQRe3
LWp3q/HIW1XW7PZx5euds0Yr0ub0KyCLb7jPgzB6d3XUPFq7drZWoxXW0EGscowZtoX8OTmv
7BumM7FTH2/ANqrYNMsRpI9F0Og3MvUC5FlknbnC97XHruFCzZDfw8Ru4IrNNGw24bIawRWw
sG299QKvLSL6UghJE48I+TzLHJqWVrMlhfBEC+9zktnNp2w/v34/w0CXUqZQ1D4bc6nCKQWC
lelozFDVjOHSui4b1HIbcR1ddz0WjmxwXdEe6sr6Y6hjf5CBYZiMsHHi4zIc8E8kQLTMWseD
L2rdZ1E7xaB3vZNFJ6XN83qnRKz1cbUQEMkgsjXnO1yCuy20wvM249yj9ys1tz/8fWV3rH8V
eCmHZJgRaX69o/QTibOEIxB+5DDNsNYEyysaXUWflaLFRNT2EzvIJ6+I05ESxBt2F9PfJ1VQ
8p94b50pNPX9aNMD+gxke2COPM4A2HUryfXEXgxXbYe1TTOcVF2PUcCOxEi0M2fSTIyS66Je
N7sSEsV1lZ4XRwcnfYKt99LbmRAHzskx10lUrM0vOfwECXtVZS3wj+SZ1ZzHpBS28fH8QhIC
7qf2FyMgMblwA9QTJ1m0ZU0K3c2RoGhYw6x1GJorpZ5rSQxGvIT95GprYG7MHaY6yuERICAY
HTP2NlueEsrx1mpGL5GYFeDwD7FfL3eEbM/YUUDrnSqO9X+si8lbHD2ln0XWV02nD2o6Gw+D
LNMimGDRyYdnyESYYEpWHo6FysEQW2cK1JADJcoB/r1B5vBGYqjlKj4U1vKy47qU9JPC5jhU
nNW6n7Z8uhWmpMkYiu/8QkytiiEd80B4rtJJCby4xgOgI+2OqkpIoYtV8VQs6VAMNHSlIx8a
0pqflcMCMpaNhBqcyujLiaUHKQVAKPWVjkS4nGdW0Py+o+g1DCUqalMY/Gs18GTd99poF0Mm
zKA8vAHo0hnNKk0onm6zAHz8Q54v+0lTMmTltAybNTnTgh+DA8F3LcqJv6iV9tEE1FevNzTG
BGEK9oFxuMLj6z8jbCvwOr1b02OHE79hA8yvnxYvzhHalKinspC3rnPHMcA5DeOdZ6V57pNF
pzR9c99EAm/u8SzTErP9KEDUQARVDswSI2BDIEp5YUiPuqM3pZHi8o8MNZ7V6O0RqS7ZncdO
D9G1Q5zAO0/R8aQgaKVv1WHS9nskoSsToBxdMXaBcIeiuNUrUZlRHvq1rRg6oNEZSnFQbBsh
Htz3fTGrQ4RdnWyCm76fR09cZJs7bzuVIc9UhtTGnEhST+VkKdFVJl2b+L7WRYgYwu8s3tXE
I0oLNFJI0FHQ6KBqMfR+G/Eo58RpAw2o2ukVpFyWDYGmDbN5B6POO9XnA1iPysasoP5M9i6a
dHXlRnacAujKaxiZmTZaeXocXrUMGghEXfHBPkA0EN0wqsizunX4WJEKOxZqjVYaBop5pokO
8P1hk0MxuQ22mT5PxT0b5XdaWA/c1HmxSB9gwi/1EoSFVHh3dsL6CdHHxK3HOUGJ1xc7VKR7
71SaB/CYOcicit5apTtShkWYUES9teXdG+qBzK31p/CXzGfRu0NgjStdBZNo9Ubkyz3vBH19
sWGDItnRcvbuxPPV1ekYSfXMus2kOpM1Qj589kL6BHY1ymjc9TBv/JpKMUT1nndb2nW6Cgma
f7QI3tTKKVuZrotCJHfpOEVAPSBiEgpH7TWweCc2wmMCGngaBYSCDkDEXLllFeOoYolgP929
KOL20KSpde+X7Xn2OCS6wKSU7wiyTt4PjjfMtqXzcSl81ht/G/ZGkCCvOHr9Dum61WNg8FAp
IaZ0nc0+/fR6jZoIJxmj1Sk2kYGcYMB/DqW+5Om0lNRSBABMYExDDMB9IWbZh0xH0i3mP4dy
WDNEZaLq9GH6wEprOZoytaMXsOlIB58+vEnoETlHo2Bo4w9ipvbyhE5lGHmW9CLluOUQz954
NIG68K9SJ7zQc55/xGyIY+1STfASbkmpEcBL4hSwskWOOVTOhqKNmoCH62IL2t8Zvk1hX/Xm
M3JgB4gS886mEyMwECfnQcCHdhM7TZ7WRkjQUy4VeMiQ8N1Y9PX809IMH6k21X/j9BIjlztT
z/9IWmj2SZLl7WzUfMHDk1M/9fWwHCintghG5+eVm15PaME29X4WmEsCLiI6VMqlaGcjK9d1
qpidhKrL+InpklNHzS0FD4YIOcCaS+HbGLa29z1/xHttJauZVU7j1SPhG5I/UpqNk8mcYZk8
Cwy0nnm9TurEhECesN4Gg3FrllPKAHP9dQSURkCEW+SXJ0rrMStL3PqeArA7JLe+HYRuLx+u
kPPddyWTag9fqE3lsW1IUOVdIpGNklf/nPqCFoxdFeD3BKnnmu6YEmOVvUdoopU2bzULikz6
w1gUEzj6l4g+mzLVEYas1Y1mtjrI8wQcLdF+2ccZl0q+K9euvLliO3mHUye1dx+B+wC/4jO1
CET8att32GwCck1M7fF5evAh/3Ze0oKec/ddPxUBxaOeimGDyWTyzU+9WAtQ2AW8qMOagPN/
SFXe0VDrRwsgyGwkdK5ibAyGKqwOKhRHIRAo8g3lTd1/fk+n0hpkhsfLL1YgIZILiOTxC9gQ
PF/uR5nYvHXwGWCRFWCU5HMgJxsOTyBpdE26BI9bNAbeO/56Pdo7H+qHe8Da1REVFwhzhzV2
DRXIouhrflJk4l92fiRlKItGaa0bcOluxte3jvvxB6gwq6HMMSVsLUoDeSHyhcO83Stb2hXO
HlsphuI+ngyKj7I0cgeKRsJXtpHd0TOGmVscwUnEnZC3n0Tq1K2o91Z66EzD/Fx3GjlrQSkV
sf5yqNRHYg/IJOWfb4oeaVcKp3hHnRlpQ08qXjXRIhFPS4eD0hVnhOo25NkDxFvfvHkLgqRS
VS0qSK0XpEgUvdS0YuOqkjZd8tIGQYGk+1O4QGNvtMcKIh7KrNx4wzIg4NP2eR+VyluT1gE4
Y9PMXa4UW/Ymu8ZwjaUPZ3UCLdprlMp+ebfNuD4w1TDXZ/MFWyatr9bdo2J5UDG9Jt6tvqvF
XjbWtNbsBLzeIJN6nYfdZFul8lbyfNGUuBF2vg9zARVewprtYwiVRBUdPX2gwQpN/gfF02dQ
MJR88LUFJsAx8LloNDHQ0Nb8iZbbNBKqMy8VMi+8WY0iyyLx3MBdbRDqyH6Vy7WdnCRg/aG6
SNdi4nEy4HCqOcdjyfv8yS8sCYFyBytUraOkZj1N51FCumSAT8kX31FQ33eK3NEk5zU3r5Aq
DRC97X504EapIr7gqbj9GnmeEXhpJJWnoTSMJKxAU1lGR5GFdmYdar41MajYLTdj6cVUFk0j
nCabIbiV+ivqEVD3hiNjtVWnYIC2eEwzumHPNwBjzPun6v/duLwf1D0q9Q7a6jtv8NjKq2s5
rUqRknDi54TXo+6nwtqfa/FUdsUCaCo7G5QKMVZbdErsnHdmy5rWlBJgnlos/RgOSuQAVJ7I
PeldEUUk6MZPhHpujJe4fuA7RvTmV6wP5g7cxP+RgcsdrmwTWLCejZ+/yrencSxArdqKSGFV
ZPEjURgcTHZJKZ+P2MLPIWAsclTTHFfJ2leOIJfiqcK1K0iCGZ4DMLVPOOsSJ81L4VciG/Wi
lYGxR0ZZ9bEkdcNao6tTeg9Bcbidn2DL4pcGHXhs4yndwJVJ6h0fpeA4mw0NahnIb07pW1I1
6D3lGIORxl/MWvknv3x2PYBu1cfNG02nZkwSudkHVOXTWUObHaigdeqvJsScEA888USI+imK
YZKEsVVettkApZjQcV4w7ODbZkaHI1HL2FDeY9L17NO1wmwaTgT45jBU2ceWimwIthU+Vobu
MDMp2xabkwcR7h0Cs6EZ1Fiy5Pt4vUIiQFbzQHkCkKvWLTdIYGi7R5pIH46LIGENVtpRq74G
BMJxNY+oHRXbOQIkenrTBEE+zZP/5qR1YFS2JDfOgq6Sa9GQEkuaF4YIEkbnPbOQBpSCGTFi
SbodD9E3QPENPIUQ77FTamHvhIhvFiDuGrYdQiYkvBEuKqL13IsmX8ea8Fw1weX9YUdFseAg
1qSZhTSQrKgJJT2QaXgclUCFpsKvDWWc/ywgKfblmgE+4vT8Q7cSAXwqIVz5FZ4sVxIqQs12
d4WJTlqhHZl3/YEy98Wzst6MobcBV2sJodBKiN1oS1Cp3/H0XT5rduNDrTRmCUsspwBzVwQ0
DotxYd2gtL6U3H7+cqtycCgrPU500UiCgmzFtYhyoFgW7xQrPkhGnCIt8Zai3SC6s+jsIQZm
pyhTyzq1M3wBt+KQcCsBJ08y622Aj7Foc6XC1SkO0g4pNdtEy7OzxJCAVHXYfE4peNjOWilk
s8WjLFV3RXObSgSJgPfadKYDK2kkZPNiVv1T7ZIZGw7OLJ5+7bRAPO1AStQ/4yz/NJEeJSob
OzbcM3FXm5ifRDJWzsy7W6SEKg2h86BjY+WRd/ySzsnj3d/xNODoh+0/vDwW2Cpnbk3jIuWc
6oiPrUbMa7G3iM0Kf77fD1YnwUXl62+fV1kjOZgNiHljsagefQoxEYHJ1BzweoCu4hXE5Jx+
GmzYPwq8Pk1FcZEDXciNOPlsH/h5W4NxylIAs3EpaJHNBHgr6TQF2OjOS7+TK5eAo/UL0Ie2
yh3Gk3JbCfKdfBxofU7fphYEvjQW03YF6zjoa3WzfrcMFPprf0YOCjwiEegAkyH+SVTj0zeu
nDIvKq7SDQ45fdZ0v0fAtluPciWItzIdAsGoYFGruHXZ3TAzrFtAOKrZFa9ikk8SlY9u7qO/
UD/6TzFeOI/57Bvv0OJM50RQIGLjz5Z+RXSqgtt70CRzo572NH46d4/3v1+2yoMCxv+220Hv
aSmKakozT2bhpsduXQMsvow3ypSRAd2RBPXMCB3/rOFnmFwJ8Lga0UhBgArFehOh00mSlu87
bzxqGNTt/cjaGm1I+sd5NNsYjjB/gAGrFTjWfi1a67Vb9vn6VNx6Sn9SEpM/+/qIiVmTQegj
FDtt0Y0B55WEW+cpCQMp+1EaCV6Z8hShTxMGESfaT2bfEuT3hhlNEPN9IkDG1Zh0jTqeGrun
fwtdqZzO31coOwkLLXTXZPLGBtgOLj57V2aUo1IxkjYVgZbhqrmAiFtQ6DzeljIOWwHWNZ2h
+prOqiqC2oShbdk7OWmoMWlPrjpF0C7+qKVCB9eOZhGLS5uqQ6oWklOh1GhjwBl2nVxZm9Oa
eVqWNsU+WMavWak7W6OBtWvUEQqjOYAUrhDmsZJDbMk719yTAVIkm9hpeDCeiCd1O2zTnuSO
5az/scsW0kifTB6eDVBO3AsPiVe3SGvnofHXwRJIp79MRK6uY6+QSpkxaJ8qGyndxtVE/F2w
pYcs9Mr9zrxYGkVNrru96uh9JKCe6JWDGiiCyCbopLwEC8To0GFkagULaGv7pvs2Z1Lw/dv3
88X5syrH9iDgfKDZPHVon1zc3NhEJqx61AhFwb6ULN0zWGO2UJ5VyQa7tm9Vv2zAs9wwTvB9
AgyUBfzbaETaJm8rQwg3lUkntX2EytMQbEOGB8SAnkwwx446aeRhcoREXnUp8hHhWJNLL5ga
BKOp6DzTlFt31AOwQ1nXYQ3Vqk6pTjHHzC+TgJAZPZ6IPEaxgQKRbEO9LP/4c/E5LlEnqNMf
3299jswB3mgaCgwX+KSCDLGtcgTz/bc1hlf3PGuoeDveJ1nrLfgRpPL3ElizsdzE3XT9Cv8w
UB6EG2Nc7j4KXLaFv3oSNJuYvxdS7/lGaj69jw1DISG0O9c7iQ3Pbum01IDGrOJFe2Led+DE
1VDwrf3BQxxw4SjAhx+hchJaZnApNWpz8FykVL62bYbEgaIup12wPDs01I0RQLU4kBiE+IOw
yDYNkk3S6FbOo8DRqu6BpXPnGZF+3In2ArwGrvjwYPU2FNGc7W4/u79kchzPtQvNDrwPQFgP
vYgZvESvcKI3eS/J/fneGJzaySkHtqGzYV3vQMBm0TVkqTFXCd1aqHQ1R1kvUCdtujYIqbSe
YQCq2tbXWUC+oFMQYCmb0ispnk4tH9w/PTbZ78EIwdx2+0uWrAMqIOur8jYmdnYf7j8DRRFs
c9p7WXhdZ9sLxT77w/AMIIa4dENG3Vbq8K1YMxpkzw+LhJcUfJYJC4Dw4otkHMYamgpXa15k
lbsKRTJPKq4usOysA9jlqDqIgjRJlzjvxz5ciKAH5B/n1VhyUfbNDJVBbQQOcIQ58NMCbpdr
iGn+nm1m3mCCdFZrf7RvZ3DHx6Po1TmjYjkhxsd/30OptUI8xHUq5zDC5vZRg+CtFaR982K8
iZJUj3RIpoGRpvhCoBIh+lG6Jg8tRL+N1gC1niKGOtRuNDuCrkS/RRBvGna6l/GP/7Pn7nVm
ZXf16Yd9R13YIeVjBci2X90ymVsplY508fFmAd83U8qAXsvqqfmOJ7nayKlYIuoV6BKZN7lP
y3xs+3KYZfMmJLN/fc+a7ZD9dN7EwurgcvTWxGeHoK6yuUxbB46yai6Z7NQkoL81r3+kIvGN
xH/89L1/776p1Kc2euX+07zEoimbSWR25T9QM1cH4pMcwvOfMeh3HIF+QEkLyHp2etqIYmMH
Dk97BvGDUAXBivOgGxtHQwcEjVHcAW1oER8XSyVrpEiFwgDhM65V6ed4N1i7fJNbEbnXumIt
rDmMsuxNaATxSV+agDOh9wdGFcau8+mjq60Y7ZtnckaqUZF8b6xYPNfSBhqqHYtK3ssulY88
yPG/7hG1sxYTYD82o0dqHjglElpng8I1Ez+6Y15BKCbUQgbfYvKTFPQPwKpV3POdnIr95Dzn
gev9nnwqQSqS3rz3fVNnf9qPYbzcIAJ5VVmu6zMcZLdYNbCZriRUu85aRjQvR6b5MJ3wCHdw
O/MfLZj+COC1H1tngIyHjO+gUI2EtUWh8mvW3EMJpfGLZafHuEJXG1SWtvyTu4WyFF1824J5
G01cCi1TBG46C7Fex1a4GkOZpEPZryXAZbp3ejNpkz+3YOQjuCjUQGU+mw5flCv1c9CWdsz6
dF02ZZWcXvtLZ+FKEMXP46SAeD2JDPtIFS0TpLCcNsoKxqNSsnwg0PezuQmMVeReAZqQMeDG
pp49uOLtIx56iG5bTpxSXaI72ntROZmgWs5PIhs11Sd0ns/aLV/X0VoNR2pjJXr+///+B6/1
wZE=
"
}
}
You can’t perform that action at this time.