From 026c45df04b9dfc1a55ecd1eff1fff2cb3c19fb1 Mon Sep 17 00:00:00 2001
From: Joe Blubaugh <joe.blubaugh@grafana.com>
Date: Fri, 9 Sep 2022 12:57:52 +0800
Subject: [PATCH] Revert upstream alertmanager to v0.24.0 (#2924)

This is a workaround for: https://github.com/prometheus/alertmanager/issues/3064

To prevent panics  when unmarshalling email headers from configuration.

(cherry picked from commit 68b619729466c6d984bed26e5eb1c3dfbbac3d31)
---
 go.mod                                        |    7 +-
 go.sum                                        |   14 +-
 pkg/alertmanager/alertmanager.go              |    2 +-
 vendor/github.com/benbjohnson/clock/LICENSE   |   21 -
 vendor/github.com/benbjohnson/clock/README.md |  105 -
 vendor/github.com/benbjohnson/clock/clock.go  |  378 --
 .../github.com/benbjohnson/clock/context.go   |   86 -
 .../prometheus/alertmanager/api/api.go        |   11 +-
 .../prometheus/alertmanager/api/v1/api.go     |    8 +-
 .../prometheus/alertmanager/api/v2/api.go     |   28 +-
 .../prometheus/alertmanager/api/v2/compat.go  |    3 +-
 .../prometheus/alertmanager/api/v2/testing.go |   70 -
 .../alertmanager/cluster/channel.go           |    3 +-
 .../alertmanager/cluster/cluster.go           |    7 +-
 .../alertmanager/cluster/connection_pool.go   |    2 +-
 .../alertmanager/cluster/delegate.go          |    3 +-
 .../alertmanager/cluster/tls_config.go        |    4 +-
 .../alertmanager/cluster/tls_connection.go    |    1 +
 .../alertmanager/cluster/tls_transport.go     |    2 +-
 .../prometheus/alertmanager/config/config.go  |    6 +-
 .../alertmanager/config/coordinator.go        |    2 +-
 .../alertmanager/config/notifiers.go          |   22 +-
 .../alertmanager/dispatch/dispatch.go         |    2 +
 .../prometheus/alertmanager/dispatch/route.go |    3 +
 .../prometheus/alertmanager/nflog/nflog.go    |    3 +-
 .../prometheus/alertmanager/notify/notify.go  |    4 +-
 .../alertmanager/notify/opsgenie/opsgenie.go  |   20 +-
 .../alertmanager/notify/slack/slack.go        |   17 +-
 .../prometheus/alertmanager/notify/sns/sns.go |    8 +-
 .../alertmanager/notify/telegram/telegram.go  |   12 +-
 .../prometheus/alertmanager/notify/util.go    |   11 +-
 .../notify/victorops/victorops.go             |    1 +
 .../alertmanager/notify/wechat/wechat.go      |    4 +-
 .../alertmanager/provider/mem/mem.go          |   51 +-
 .../alertmanager/provider/provider.go         |    6 +-
 .../alertmanager/silence/silence.go           |   43 +-
 .../prometheus/alertmanager/store/store.go    |    9 +-
 .../alertmanager/template/template.go         |    8 +-
 .../alertmanager/timeinterval/timeinterval.go |   11 +-
 .../prometheus/alertmanager/types/types.go    |   31 +-
 vendor/golang.org/x/text/cases/cases.go       |  162 -
 vendor/golang.org/x/text/cases/context.go     |  376 --
 vendor/golang.org/x/text/cases/fold.go        |   34 -
 vendor/golang.org/x/text/cases/icu.go         |   62 -
 vendor/golang.org/x/text/cases/info.go        |   82 -
 vendor/golang.org/x/text/cases/map.go         |  816 ----
 .../golang.org/x/text/cases/tables10.0.0.go   | 2256 -----------
 .../golang.org/x/text/cases/tables11.0.0.go   | 2317 -----------
 .../golang.org/x/text/cases/tables12.0.0.go   | 2360 -----------
 .../golang.org/x/text/cases/tables13.0.0.go   | 2400 ------------
 vendor/golang.org/x/text/cases/tables9.0.0.go | 2216 -----------
 vendor/golang.org/x/text/cases/trieval.go     |  214 -
 vendor/golang.org/x/text/internal/internal.go |   49 -
 .../x/text/internal/language/common.go        |   16 -
 .../x/text/internal/language/compact.go       |   29 -
 .../text/internal/language/compact/compact.go |   61 -
 .../internal/language/compact/language.go     |  260 --
 .../text/internal/language/compact/parents.go |  120 -
 .../text/internal/language/compact/tables.go  | 1015 -----
 .../x/text/internal/language/compact/tags.go  |   91 -
 .../x/text/internal/language/compose.go       |  167 -
 .../x/text/internal/language/coverage.go      |   28 -
 .../x/text/internal/language/language.go      |  627 ---
 .../x/text/internal/language/lookup.go        |  412 --
 .../x/text/internal/language/match.go         |  226 --
 .../x/text/internal/language/parse.go         |  604 ---
 .../x/text/internal/language/tables.go        | 3464 -----------------
 .../x/text/internal/language/tags.go          |   48 -
 vendor/golang.org/x/text/internal/match.go    |   67 -
 vendor/golang.org/x/text/internal/tag/tag.go  |  100 -
 vendor/golang.org/x/text/language/coverage.go |  187 -
 vendor/golang.org/x/text/language/doc.go      |  102 -
 vendor/golang.org/x/text/language/go1_1.go    |   39 -
 vendor/golang.org/x/text/language/go1_2.go    |   12 -
 vendor/golang.org/x/text/language/language.go |  605 ---
 vendor/golang.org/x/text/language/match.go    |  735 ----
 vendor/golang.org/x/text/language/parse.go    |  250 --
 vendor/golang.org/x/text/language/tables.go   |  298 --
 vendor/golang.org/x/text/language/tags.go     |  145 -
 vendor/modules.txt                            |   14 +-
 80 files changed, 170 insertions(+), 23925 deletions(-)
 delete mode 100644 vendor/github.com/benbjohnson/clock/LICENSE
 delete mode 100644 vendor/github.com/benbjohnson/clock/README.md
 delete mode 100644 vendor/github.com/benbjohnson/clock/clock.go
 delete mode 100644 vendor/github.com/benbjohnson/clock/context.go
 delete mode 100644 vendor/github.com/prometheus/alertmanager/api/v2/testing.go
 delete mode 100644 vendor/golang.org/x/text/cases/cases.go
 delete mode 100644 vendor/golang.org/x/text/cases/context.go
 delete mode 100644 vendor/golang.org/x/text/cases/fold.go
 delete mode 100644 vendor/golang.org/x/text/cases/icu.go
 delete mode 100644 vendor/golang.org/x/text/cases/info.go
 delete mode 100644 vendor/golang.org/x/text/cases/map.go
 delete mode 100644 vendor/golang.org/x/text/cases/tables10.0.0.go
 delete mode 100644 vendor/golang.org/x/text/cases/tables11.0.0.go
 delete mode 100644 vendor/golang.org/x/text/cases/tables12.0.0.go
 delete mode 100644 vendor/golang.org/x/text/cases/tables13.0.0.go
 delete mode 100644 vendor/golang.org/x/text/cases/tables9.0.0.go
 delete mode 100644 vendor/golang.org/x/text/cases/trieval.go
 delete mode 100644 vendor/golang.org/x/text/internal/internal.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/common.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/compact.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/compact/compact.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/compact/language.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/compact/parents.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/compact/tables.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/compact/tags.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/compose.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/coverage.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/language.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/lookup.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/match.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/parse.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/tables.go
 delete mode 100644 vendor/golang.org/x/text/internal/language/tags.go
 delete mode 100644 vendor/golang.org/x/text/internal/match.go
 delete mode 100644 vendor/golang.org/x/text/internal/tag/tag.go
 delete mode 100644 vendor/golang.org/x/text/language/coverage.go
 delete mode 100644 vendor/golang.org/x/text/language/doc.go
 delete mode 100644 vendor/golang.org/x/text/language/go1_1.go
 delete mode 100644 vendor/golang.org/x/text/language/go1_2.go
 delete mode 100644 vendor/golang.org/x/text/language/language.go
 delete mode 100644 vendor/golang.org/x/text/language/match.go
 delete mode 100644 vendor/golang.org/x/text/language/parse.go
 delete mode 100644 vendor/golang.org/x/text/language/tables.go
 delete mode 100644 vendor/golang.org/x/text/language/tags.go

diff --git a/go.mod b/go.mod
index d6a51ffd44..3ee7a4d8aa 100644
--- a/go.mod
+++ b/go.mod
@@ -28,7 +28,7 @@ require (
 	github.com/opentracing-contrib/go-stdlib v1.0.0
 	github.com/opentracing/opentracing-go v1.2.0
 	github.com/pkg/errors v0.9.1
-	github.com/prometheus/alertmanager v0.24.1-0.20220805150254-c732372d7d3b
+	github.com/prometheus/alertmanager v0.24.0
 	github.com/prometheus/client_golang v1.13.0
 	github.com/prometheus/client_model v0.2.0
 	github.com/prometheus/common v0.37.0
@@ -99,7 +99,6 @@ require (
 	github.com/aws/aws-sdk-go-v2/service/sso v1.9.0 // indirect
 	github.com/aws/aws-sdk-go-v2/service/sts v1.14.0 // indirect
 	github.com/aws/smithy-go v1.10.0 // indirect
-	github.com/benbjohnson/clock v1.3.0 // indirect
 	github.com/beorn7/perks v1.0.1 // indirect
 	github.com/bradfitz/gomemcache v0.0.0-20190913173617-a41fca850d0b // indirect
 	github.com/cenkalti/backoff/v4 v4.1.3 // indirect
@@ -232,6 +231,10 @@ require (
 	sigs.k8s.io/yaml v1.3.0 // indirect
 )
 
+// Version after v0.24.0 have a change in the email notifier that can panic on certain inputs. See:
+// https://github.com/prometheus/alertmanager/issues/3064
+replace github.com/prometheus/alertmanager => github.com/prometheus/alertmanager v0.24.0
+
 // Override since git.apache.org is down.  The docs say to fetch from github.
 replace git.apache.org/thrift.git => github.com/apache/thrift v0.0.0-20180902110319-2566ecd5d999
 
diff --git a/go.sum b/go.sum
index 8971a00e7e..7b95c69a61 100644
--- a/go.sum
+++ b/go.sum
@@ -129,6 +129,7 @@ github.com/asaskevich/govalidator v0.0.0-20210307081110-f21760c49a8d h1:Byv0BzEl
 github.com/asaskevich/govalidator v0.0.0-20210307081110-f21760c49a8d/go.mod h1:WaHUgvxTVq04UNunO+XhnAqY/wQc+bxr74GqbsZ/Jqw=
 github.com/aws/aws-sdk-go v1.27.0/go.mod h1:KmX6BPdI08NWTb3/sm4ZGu5ShLoqVDhKgpiN924inxo=
 github.com/aws/aws-sdk-go v1.38.35/go.mod h1:hcU610XS61/+aQV88ixoOzUoG7v3b31pl2zKMmprdro=
+github.com/aws/aws-sdk-go v1.43.11/go.mod h1:y4AeaBuwd2Lk+GepC1E9v0qOiTws0MIWAX4oIKwKHZo=
 github.com/aws/aws-sdk-go v1.44.66 h1:xdH4EvHyUnkm4I8d536ui7yMQKYzrkbSDQ2LvRRHqsg=
 github.com/aws/aws-sdk-go v1.44.66/go.mod h1:y4AeaBuwd2Lk+GepC1E9v0qOiTws0MIWAX4oIKwKHZo=
 github.com/aws/aws-sdk-go-v2 v1.13.0 h1:1XIXAfxsEmbhbj5ry3D3vX+6ZcUYvIqSm4CWWEuGZCA=
@@ -156,7 +157,6 @@ github.com/aws/smithy-go v1.10.0/go.mod h1:SObp3lf9smib00L/v3U2eAKG8FyQ7iLrJnQiA
 github.com/baidubce/bce-sdk-go v0.9.81 h1:n8KfThLG9fvGv3A+RtTt/jKhg/FPPRpo+iNnS2r+iPI=
 github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA=
 github.com/benbjohnson/clock v1.3.0 h1:ip6w0uFQkncKQ979AypyG0ER7mqUSBdKLOgAle/AT8A=
-github.com/benbjohnson/clock v1.3.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA=
 github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q=
 github.com/beorn7/perks v1.0.0/go.mod h1:KWe93zE9D1o94FZ5RNwFwVgaQK1VOXiVxmqh+CedLV8=
 github.com/beorn7/perks v1.0.1 h1:VlbKKnNfV8bJzeqoa4cOKqO6bYr3WgKZxO8Z16+hsOM=
@@ -164,6 +164,7 @@ github.com/beorn7/perks v1.0.1/go.mod h1:G2ZrVWU2WbWT9wwq4/hrbKbnv/1ERSJQ0ibhJ6r
 github.com/bgentry/speakeasy v0.1.0/go.mod h1:+zsyZBPWlz7T6j88CTgSN5bM796AkVf0kBD4zp0CCIs=
 github.com/bketelsen/crypt v0.0.4/go.mod h1:aI6NrJ0pMGgvZKL1iVgXLnfIFJtfV+bKCoqOes/6LfM=
 github.com/blang/semver/v4 v4.0.0 h1:1PFHFE6yCCTv8C1TeyNNarDzntLi7wMI5i/pzqYIsAM=
+github.com/cenkalti/backoff/v4 v4.1.2/go.mod h1:scbssz8iZGpm3xbr14ovlUdkxfGXNInqkPWOWmG2CLw=
 github.com/cenkalti/backoff/v4 v4.1.3 h1:cFAlzYUlVYDysBEH2T5hyJZMh3+5+WCBvSnK6Q8UtC4=
 github.com/cenkalti/backoff/v4 v4.1.3/go.mod h1:scbssz8iZGpm3xbr14ovlUdkxfGXNInqkPWOWmG2CLw=
 github.com/census-instrumentation/opencensus-proto v0.2.1/go.mod h1:f6KPmirojxKA12rnyqOA5BBL4O983OfeGPqjHWSTneU=
@@ -291,6 +292,7 @@ github.com/go-openapi/jsonreference v0.20.0 h1:MYlu0sBgChmCfJxxUKZ8g1cPWFOB37YSZ
 github.com/go-openapi/jsonreference v0.20.0/go.mod h1:Ag74Ico3lPc+zR+qjn4XBUmXymS4zJbYVCZmcgkasdo=
 github.com/go-openapi/loads v0.21.1 h1:Wb3nVZpdEzDTcly8S4HMkey6fjARRzb7iEaySimlDW0=
 github.com/go-openapi/loads v0.21.1/go.mod h1:/DtAMXXneXFjbQMGEtbamCZb+4x7eGwkvZCvBmwUG+g=
+github.com/go-openapi/runtime v0.23.1/go.mod h1:AKurw9fNre+h3ELZfk6ILsfvPN+bvvlaU/M9q/r9hpk=
 github.com/go-openapi/runtime v0.24.1 h1:Sml5cgQKGYQHF+M7yYSHaH1eOjvTykrddTE/KtQVjqo=
 github.com/go-openapi/runtime v0.24.1/go.mod h1:AKurw9fNre+h3ELZfk6ILsfvPN+bvvlaU/M9q/r9hpk=
 github.com/go-openapi/spec v0.20.4/go.mod h1:faYFR1CvsJZ0mNsmsphTMSoRrNV3TEDoAM7FOEWeq8I=
@@ -624,6 +626,7 @@ github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
 github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
 github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
 github.com/kylelemons/godebug v1.1.0 h1:RPNrshWIDI6G2gRW9EHilWtl7Z6Sb1BR0xunSBf0SNc=
+github.com/kylelemons/godebug v1.1.0/go.mod h1:9/0rRGxNHcop5bhtWyNeEfOS8JIWk580+fNqagV/RAw=
 github.com/leanovate/gopter v0.2.4 h1:U4YLBggDFhJdqQsG4Na2zX7joVTky9vHaj/AGEwSuXU=
 github.com/leanovate/gopter v0.2.4/go.mod h1:gNcbPWNEWRe4lm+bycKqxUYoH5uoVje5SkOJ3uoLer8=
 github.com/leodido/go-urn v1.2.0/go.mod h1:+8+nEpDfqqsY+g338gtMEUOtuK+4dEMhiQEgxpxOKII=
@@ -755,8 +758,8 @@ github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRI
 github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
 github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndrE9hABlRI=
 github.com/posener/complete v1.2.3/go.mod h1:WZIdtGGp+qx0sLrYKtIRAruyNpv6hFCicSgv7Sy7s/s=
-github.com/prometheus/alertmanager v0.24.1-0.20220805150254-c732372d7d3b h1:dslVh3TxUSKjFRTLV438koLfxrLexh/02ZCRKQU2rOg=
-github.com/prometheus/alertmanager v0.24.1-0.20220805150254-c732372d7d3b/go.mod h1:GT1aDuNNr9eV5nbTkNowWosvODtRcC5J6N7hb2wyBTU=
+github.com/prometheus/alertmanager v0.24.0 h1:HBWR3lk4uy3ys+naDZthDdV7yEsxpaNeZuUS+hJgrOw=
+github.com/prometheus/alertmanager v0.24.0/go.mod h1:r6fy/D7FRuZh5YbnX6J3MBY0eI4Pb5yPYS7/bPSXXqI=
 github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw=
 github.com/prometheus/client_golang v1.0.0/go.mod h1:db9x61etRT2tGnBNRi70OPL5FsnadC4Ky3P0J6CfImo=
 github.com/prometheus/client_golang v1.4.0/go.mod h1:e9GMxYsXl05ICDXkRhurwBS4Q3OK1iX/F2sw+iXX5zU=
@@ -895,6 +898,7 @@ github.com/yuin/goldmark v1.1.27/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9de
 github.com/yuin/goldmark v1.1.32/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74=
 github.com/yuin/goldmark v1.2.1/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74=
 github.com/yuin/goldmark v1.3.5/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k=
+github.com/yuin/goldmark v1.4.1/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k=
 github.com/yuin/gopher-lua v0.0.0-20200816102855-ee81675732da h1:NimzV1aGyq29m5ukMK0AMWEhFaL/lrEOaephfuoiARg=
 go.etcd.io/etcd/api/v3 v3.5.0/go.mod h1:cbVKeC6lCfl7j/8jBhAK6aIYO9XOjdptoxU/nLQcPvs=
 go.etcd.io/etcd/api/v3 v3.5.4 h1:OHVyt3TopwtUQ2GKdd5wu3PmmipR4FTwCqoEjSyRdIc=
@@ -1017,6 +1021,7 @@ golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
 golang.org/x/mod v0.4.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
 golang.org/x/mod v0.4.1/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
 golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
+golang.org/x/mod v0.5.1/go.mod h1:5OXOZSfqPIIbmVBIIKWRFfZjPR0E5r58TLhUjH0a2Ro=
 golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4 h1:6zppjxzCulZykYSLyVDYbneBfbaBIQPYMevg0bEwv2s=
 golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
 golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
@@ -1068,6 +1073,7 @@ golang.org/x/net v0.0.0-20210428140749-89ef3d95e781/go.mod h1:OJAsFXCWl8Ukc7SiCT
 golang.org/x/net v0.0.0-20210503060351-7fd8e65b6420/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20210525063256-abc453219eb5/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20210726213435-c6fcb2dbf985/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
+golang.org/x/net v0.0.0-20211015210444-4f30a5c0130f/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk=
 golang.org/x/net v0.0.0-20220225172249-27dd8689420f/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk=
@@ -1198,6 +1204,7 @@ golang.org/x/sys v0.0.0-20210823070655-63515b42dcdf/go.mod h1:oPkhp1MJrh7nUepCBc
 golang.org/x/sys v0.0.0-20210908233432-aa78b53d3365/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20211007075335-d3039528d8ac/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.0.0-20211019181941-9d821ace8654/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20211124211545-fe61309f8881/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20211210111614-af8b64212486/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
@@ -1300,6 +1307,7 @@ golang.org/x/tools v0.1.3/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk=
 golang.org/x/tools v0.1.4/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk=
 golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk=
 golang.org/x/tools v0.1.6-0.20210726203631-07bc1bf47fb2/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk=
+golang.org/x/tools v0.1.9/go.mod h1:nABZi5QlRsZVlzPpHl034qft6wpY4eDcsTt5AaioBiU=
 golang.org/x/tools v0.1.12 h1:VveCTK38A2rkS8ZqFY25HIDFscX5X9OoEhJd3quQmXU=
 golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
 golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
diff --git a/pkg/alertmanager/alertmanager.go b/pkg/alertmanager/alertmanager.go
index 12f8229a84..a9a68a91da 100644
--- a/pkg/alertmanager/alertmanager.go
+++ b/pkg/alertmanager/alertmanager.go
@@ -240,7 +240,7 @@ func New(cfg *Config, reg *prometheus.Registry) (*Alertmanager, error) {
 		callback = newAlertsLimiter(am.cfg.UserID, am.cfg.Limits, reg)
 	}
 
-	am.alerts, err = mem.NewAlerts(context.Background(), am.marker, 30*time.Minute, callback, am.logger, reg)
+	am.alerts, err = mem.NewAlerts(context.Background(), am.marker, 30*time.Minute, callback, am.logger)
 	if err != nil {
 		return nil, fmt.Errorf("failed to create alerts: %v", err)
 	}
diff --git a/vendor/github.com/benbjohnson/clock/LICENSE b/vendor/github.com/benbjohnson/clock/LICENSE
deleted file mode 100644
index ce212cb1ce..0000000000
--- a/vendor/github.com/benbjohnson/clock/LICENSE
+++ /dev/null
@@ -1,21 +0,0 @@
-The MIT License (MIT)
-
-Copyright (c) 2014 Ben Johnson
-
-Permission is hereby granted, free of charge, to any person obtaining a copy
-of this software and associated documentation files (the "Software"), to deal
-in the Software without restriction, including without limitation the rights
-to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-copies of the Software, and to permit persons to whom the Software is
-furnished to do so, subject to the following conditions:
-
-The above copyright notice and this permission notice shall be included in all
-copies or substantial portions of the Software.
-
-THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
-SOFTWARE.
diff --git a/vendor/github.com/benbjohnson/clock/README.md b/vendor/github.com/benbjohnson/clock/README.md
deleted file mode 100644
index 4f1f82fc6d..0000000000
--- a/vendor/github.com/benbjohnson/clock/README.md
+++ /dev/null
@@ -1,105 +0,0 @@
-clock
-=====
-
-[![go.dev reference](https://img.shields.io/badge/go.dev-reference-007d9c?logo=go&logoColor=white&style=flat-square)](https://pkg.go.dev/mod/github.com/benbjohnson/clock)
-
-Clock is a small library for mocking time in Go. It provides an interface
-around the standard library's [`time`][time] package so that the application
-can use the realtime clock while tests can use the mock clock.
-
-The module is currently maintained by @djmitche.
-
-[time]: https://pkg.go.dev/github.com/benbjohnson/clock
-
-## Usage
-
-### Realtime Clock
-
-Your application can maintain a `Clock` variable that will allow realtime and
-mock clocks to be interchangeable. For example, if you had an `Application` type:
-
-```go
-import "github.com/benbjohnson/clock"
-
-type Application struct {
-	Clock clock.Clock
-}
-```
-
-You could initialize it to use the realtime clock like this:
-
-```go
-var app Application
-app.Clock = clock.New()
-...
-```
-
-Then all timers and time-related functionality should be performed from the
-`Clock` variable.
-
-
-### Mocking time
-
-In your tests, you will want to use a `Mock` clock:
-
-```go
-import (
-	"testing"
-
-	"github.com/benbjohnson/clock"
-)
-
-func TestApplication_DoSomething(t *testing.T) {
-	mock := clock.NewMock()
-	app := Application{Clock: mock}
-	...
-}
-```
-
-Now that you've initialized your application to use the mock clock, you can
-adjust the time programmatically. The mock clock always starts from the Unix
-epoch (midnight UTC on Jan 1, 1970).
-
-
-### Controlling time
-
-The mock clock provides the same functions that the standard library's `time`
-package provides. For example, to find the current time, you use the `Now()`
-function:
-
-```go
-mock := clock.NewMock()
-
-// Find the current time.
-mock.Now().UTC() // 1970-01-01 00:00:00 +0000 UTC
-
-// Move the clock forward.
-mock.Add(2 * time.Hour)
-
-// Check the time again. It's 2 hours later!
-mock.Now().UTC() // 1970-01-01 02:00:00 +0000 UTC
-```
-
-Timers and Tickers are also controlled by this same mock clock. They will only
-execute when the clock is moved forward:
-
-```go
-mock := clock.NewMock()
-count := 0
-
-// Kick off a timer to increment every 1 mock second.
-go func() {
-    ticker := mock.Ticker(1 * time.Second)
-    for {
-        <-ticker.C
-        count++
-    }
-}()
-runtime.Gosched()
-
-// Move the clock forward 10 seconds.
-mock.Add(10 * time.Second)
-
-// This prints 10.
-fmt.Println(count)
-```
diff --git a/vendor/github.com/benbjohnson/clock/clock.go b/vendor/github.com/benbjohnson/clock/clock.go
deleted file mode 100644
index 40555b3037..0000000000
--- a/vendor/github.com/benbjohnson/clock/clock.go
+++ /dev/null
@@ -1,378 +0,0 @@
-package clock
-
-import (
-	"context"
-	"sort"
-	"sync"
-	"time"
-)
-
-// Re-export of time.Duration
-type Duration = time.Duration
-
-// Clock represents an interface to the functions in the standard library time
-// package. Two implementations are available in the clock package. The first
-// is a real-time clock which simply wraps the time package's functions. The
-// second is a mock clock which will only change when
-// programmatically adjusted.
-type Clock interface {
-	After(d time.Duration) <-chan time.Time
-	AfterFunc(d time.Duration, f func()) *Timer
-	Now() time.Time
-	Since(t time.Time) time.Duration
-	Until(t time.Time) time.Duration
-	Sleep(d time.Duration)
-	Tick(d time.Duration) <-chan time.Time
-	Ticker(d time.Duration) *Ticker
-	Timer(d time.Duration) *Timer
-	WithDeadline(parent context.Context, d time.Time) (context.Context, context.CancelFunc)
-	WithTimeout(parent context.Context, t time.Duration) (context.Context, context.CancelFunc)
-}
-
-// New returns an instance of a real-time clock.
-func New() Clock {
-	return &clock{}
-}
-
-// clock implements a real-time clock by simply wrapping the time package functions.
-type clock struct{}
-
-func (c *clock) After(d time.Duration) <-chan time.Time { return time.After(d) }
-
-func (c *clock) AfterFunc(d time.Duration, f func()) *Timer {
-	return &Timer{timer: time.AfterFunc(d, f)}
-}
-
-func (c *clock) Now() time.Time { return time.Now() }
-
-func (c *clock) Since(t time.Time) time.Duration { return time.Since(t) }
-
-func (c *clock) Until(t time.Time) time.Duration { return time.Until(t) }
-
-func (c *clock) Sleep(d time.Duration) { time.Sleep(d) }
-
-func (c *clock) Tick(d time.Duration) <-chan time.Time { return time.Tick(d) }
-
-func (c *clock) Ticker(d time.Duration) *Ticker {
-	t := time.NewTicker(d)
-	return &Ticker{C: t.C, ticker: t}
-}
-
-func (c *clock) Timer(d time.Duration) *Timer {
-	t := time.NewTimer(d)
-	return &Timer{C: t.C, timer: t}
-}
-
-func (c *clock) WithDeadline(parent context.Context, d time.Time) (context.Context, context.CancelFunc) {
-	return context.WithDeadline(parent, d)
-}
-
-func (c *clock) WithTimeout(parent context.Context, t time.Duration) (context.Context, context.CancelFunc) {
-	return context.WithTimeout(parent, t)
-}
-
-// Mock represents a mock clock that only moves forward programmically.
-// It can be preferable to a real-time clock when testing time-based functionality.
-type Mock struct {
-	mu     sync.Mutex
-	now    time.Time   // current time
-	timers clockTimers // tickers & timers
-}
-
-// NewMock returns an instance of a mock clock.
-// The current time of the mock clock on initialization is the Unix epoch.
-func NewMock() *Mock {
-	return &Mock{now: time.Unix(0, 0)}
-}
-
-// Add moves the current time of the mock clock forward by the specified duration.
-// This should only be called from a single goroutine at a time.
-func (m *Mock) Add(d time.Duration) {
-	// Calculate the final current time.
-	t := m.now.Add(d)
-
-	// Continue to execute timers until there are no more before the new time.
-	for {
-		if !m.runNextTimer(t) {
-			break
-		}
-	}
-
-	// Ensure that we end with the new time.
-	m.mu.Lock()
-	m.now = t
-	m.mu.Unlock()
-
-	// Give a small buffer to make sure that other goroutines get handled.
-	gosched()
-}
-
-// Set sets the current time of the mock clock to a specific one.
-// This should only be called from a single goroutine at a time.
-func (m *Mock) Set(t time.Time) {
-	// Continue to execute timers until there are no more before the new time.
-	for {
-		if !m.runNextTimer(t) {
-			break
-		}
-	}
-
-	// Ensure that we end with the new time.
-	m.mu.Lock()
-	m.now = t
-	m.mu.Unlock()
-
-	// Give a small buffer to make sure that other goroutines get handled.
-	gosched()
-}
-
-// runNextTimer executes the next timer in chronological order and moves the
-// current time to the timer's next tick time. The next time is not executed if
-// its next time is after the max time. Returns true if a timer was executed.
-func (m *Mock) runNextTimer(max time.Time) bool {
-	m.mu.Lock()
-
-	// Sort timers by time.
-	sort.Sort(m.timers)
-
-	// If we have no more timers then exit.
-	if len(m.timers) == 0 {
-		m.mu.Unlock()
-		return false
-	}
-
-	// Retrieve next timer. Exit if next tick is after new time.
-	t := m.timers[0]
-	if t.Next().After(max) {
-		m.mu.Unlock()
-		return false
-	}
-
-	// Move "now" forward and unlock clock.
-	m.now = t.Next()
-	m.mu.Unlock()
-
-	// Execute timer.
-	t.Tick(m.now)
-	return true
-}
-
-// After waits for the duration to elapse and then sends the current time on the returned channel.
-func (m *Mock) After(d time.Duration) <-chan time.Time {
-	return m.Timer(d).C
-}
-
-// AfterFunc waits for the duration to elapse and then executes a function.
-// A Timer is returned that can be stopped.
-func (m *Mock) AfterFunc(d time.Duration, f func()) *Timer {
-	t := m.Timer(d)
-	t.C = nil
-	t.fn = f
-	return t
-}
-
-// Now returns the current wall time on the mock clock.
-func (m *Mock) Now() time.Time {
-	m.mu.Lock()
-	defer m.mu.Unlock()
-	return m.now
-}
-
-// Since returns time since `t` using the mock clock's wall time.
-func (m *Mock) Since(t time.Time) time.Duration {
-	return m.Now().Sub(t)
-}
-
-// Until returns time until `t` using the mock clock's wall time.
-func (m *Mock) Until(t time.Time) time.Duration {
-	return t.Sub(m.Now())
-}
-
-// Sleep pauses the goroutine for the given duration on the mock clock.
-// The clock must be moved forward in a separate goroutine.
-func (m *Mock) Sleep(d time.Duration) {
-	<-m.After(d)
-}
-
-// Tick is a convenience function for Ticker().
-// It will return a ticker channel that cannot be stopped.
-func (m *Mock) Tick(d time.Duration) <-chan time.Time {
-	return m.Ticker(d).C
-}
-
-// Ticker creates a new instance of Ticker.
-func (m *Mock) Ticker(d time.Duration) *Ticker {
-	m.mu.Lock()
-	defer m.mu.Unlock()
-	ch := make(chan time.Time, 1)
-	t := &Ticker{
-		C:    ch,
-		c:    ch,
-		mock: m,
-		d:    d,
-		next: m.now.Add(d),
-	}
-	m.timers = append(m.timers, (*internalTicker)(t))
-	return t
-}
-
-// Timer creates a new instance of Timer.
-func (m *Mock) Timer(d time.Duration) *Timer {
-	m.mu.Lock()
-	defer m.mu.Unlock()
-	ch := make(chan time.Time, 1)
-	t := &Timer{
-		C:       ch,
-		c:       ch,
-		mock:    m,
-		next:    m.now.Add(d),
-		stopped: false,
-	}
-	m.timers = append(m.timers, (*internalTimer)(t))
-	return t
-}
-
-func (m *Mock) removeClockTimer(t clockTimer) {
-	for i, timer := range m.timers {
-		if timer == t {
-			copy(m.timers[i:], m.timers[i+1:])
-			m.timers[len(m.timers)-1] = nil
-			m.timers = m.timers[:len(m.timers)-1]
-			break
-		}
-	}
-	sort.Sort(m.timers)
-}
-
-// clockTimer represents an object with an associated start time.
-type clockTimer interface {
-	Next() time.Time
-	Tick(time.Time)
-}
-
-// clockTimers represents a list of sortable timers.
-type clockTimers []clockTimer
-
-func (a clockTimers) Len() int           { return len(a) }
-func (a clockTimers) Swap(i, j int)      { a[i], a[j] = a[j], a[i] }
-func (a clockTimers) Less(i, j int) bool { return a[i].Next().Before(a[j].Next()) }
-
-// Timer represents a single event.
-// The current time will be sent on C, unless the timer was created by AfterFunc.
-type Timer struct {
-	C       <-chan time.Time
-	c       chan time.Time
-	timer   *time.Timer // realtime impl, if set
-	next    time.Time   // next tick time
-	mock    *Mock       // mock clock, if set
-	fn      func()      // AfterFunc function, if set
-	stopped bool        // True if stopped, false if running
-}
-
-// Stop turns off the ticker.
-func (t *Timer) Stop() bool {
-	if t.timer != nil {
-		return t.timer.Stop()
-	}
-
-	t.mock.mu.Lock()
-	registered := !t.stopped
-	t.mock.removeClockTimer((*internalTimer)(t))
-	t.stopped = true
-	t.mock.mu.Unlock()
-	return registered
-}
-
-// Reset changes the expiry time of the timer
-func (t *Timer) Reset(d time.Duration) bool {
-	if t.timer != nil {
-		return t.timer.Reset(d)
-	}
-
-	t.mock.mu.Lock()
-	t.next = t.mock.now.Add(d)
-	defer t.mock.mu.Unlock()
-
-	registered := !t.stopped
-	if t.stopped {
-		t.mock.timers = append(t.mock.timers, (*internalTimer)(t))
-	}
-
-	t.stopped = false
-	return registered
-}
-
-type internalTimer Timer
-
-func (t *internalTimer) Next() time.Time { return t.next }
-func (t *internalTimer) Tick(now time.Time) {
-	// a gosched() after ticking, to allow any consequences of the
-	// tick to complete
-	defer gosched()
-
-	t.mock.mu.Lock()
-	if t.fn != nil {
-		// defer function execution until the lock is released, and
-		defer t.fn()
-	} else {
-		t.c <- now
-	}
-	t.mock.removeClockTimer((*internalTimer)(t))
-	t.stopped = true
-	t.mock.mu.Unlock()
-}
-
-// Ticker holds a channel that receives "ticks" at regular intervals.
-type Ticker struct {
-	C      <-chan time.Time
-	c      chan time.Time
-	ticker *time.Ticker  // realtime impl, if set
-	next   time.Time     // next tick time
-	mock   *Mock         // mock clock, if set
-	d      time.Duration // time between ticks
-}
-
-// Stop turns off the ticker.
-func (t *Ticker) Stop() {
-	if t.ticker != nil {
-		t.ticker.Stop()
-	} else {
-		t.mock.mu.Lock()
-		t.mock.removeClockTimer((*internalTicker)(t))
-		t.mock.mu.Unlock()
-	}
-}
-
-// Reset resets the ticker to a new duration.
-func (t *Ticker) Reset(dur time.Duration) {
-	if t.ticker != nil {
-		t.ticker.Reset(dur)
-		return
-	}
-
-	t.mock.mu.Lock()
-	defer t.mock.mu.Unlock()
-
-	t.d = dur
-	t.next = t.mock.now.Add(dur)
-}
-
-type internalTicker Ticker
-
-func (t *internalTicker) Next() time.Time { return t.next }
-func (t *internalTicker) Tick(now time.Time) {
-	select {
-	case t.c <- now:
-	default:
-	}
-	t.next = now.Add(t.d)
-	gosched()
-}
-
-// Sleep momentarily so that other goroutines can process.
-func gosched() { time.Sleep(1 * time.Millisecond) }
-
-var (
-	// type checking
-	_ Clock = &Mock{}
-)
diff --git a/vendor/github.com/benbjohnson/clock/context.go b/vendor/github.com/benbjohnson/clock/context.go
deleted file mode 100644
index eb67594f2c..0000000000
--- a/vendor/github.com/benbjohnson/clock/context.go
+++ /dev/null
@@ -1,86 +0,0 @@
-package clock
-
-import (
-	"context"
-	"fmt"
-	"sync"
-	"time"
-)
-
-func (m *Mock) WithTimeout(parent context.Context, timeout time.Duration) (context.Context, context.CancelFunc) {
-	return m.WithDeadline(parent, m.Now().Add(timeout))
-}
-
-func (m *Mock) WithDeadline(parent context.Context, deadline time.Time) (context.Context, context.CancelFunc) {
-	if cur, ok := parent.Deadline(); ok && cur.Before(deadline) {
-		// The current deadline is already sooner than the new one.
-		return context.WithCancel(parent)
-	}
-	ctx := &timerCtx{clock: m, parent: parent, deadline: deadline, done: make(chan struct{})}
-	propagateCancel(parent, ctx)
-	dur := m.Until(deadline)
-	if dur <= 0 {
-		ctx.cancel(context.DeadlineExceeded) // deadline has already passed
-		return ctx, func() {}
-	}
-	ctx.Lock()
-	defer ctx.Unlock()
-	if ctx.err == nil {
-		ctx.timer = m.AfterFunc(dur, func() {
-			ctx.cancel(context.DeadlineExceeded)
-		})
-	}
-	return ctx, func() { ctx.cancel(context.Canceled) }
-}
-
-// propagateCancel arranges for child to be canceled when parent is.
-func propagateCancel(parent context.Context, child *timerCtx) {
-	if parent.Done() == nil {
-		return // parent is never canceled
-	}
-	go func() {
-		select {
-		case <-parent.Done():
-			child.cancel(parent.Err())
-		case <-child.Done():
-		}
-	}()
-}
-
-type timerCtx struct {
-	sync.Mutex
-
-	clock    Clock
-	parent   context.Context
-	deadline time.Time
-	done     chan struct{}
-
-	err   error
-	timer *Timer
-}
-
-func (c *timerCtx) cancel(err error) {
-	c.Lock()
-	defer c.Unlock()
-	if c.err != nil {
-		return // already canceled
-	}
-	c.err = err
-	close(c.done)
-	if c.timer != nil {
-		c.timer.Stop()
-		c.timer = nil
-	}
-}
-
-func (c *timerCtx) Deadline() (deadline time.Time, ok bool) { return c.deadline, true }
-
-func (c *timerCtx) Done() <-chan struct{} { return c.done }
-
-func (c *timerCtx) Err() error { return c.err }
-
-func (c *timerCtx) Value(key interface{}) interface{} { return c.parent.Value(key) }
-
-func (c *timerCtx) String() string {
-	return fmt.Sprintf("clock.WithDeadline(%s [%s])", c.deadline, c.deadline.Sub(c.clock.Now()))
-}
diff --git a/vendor/github.com/prometheus/alertmanager/api/api.go b/vendor/github.com/prometheus/alertmanager/api/api.go
index 59bfb76da6..f50ebee1c5 100644
--- a/vendor/github.com/prometheus/alertmanager/api/api.go
+++ b/vendor/github.com/prometheus/alertmanager/api/api.go
@@ -20,11 +20,6 @@ import (
 	"runtime"
 	"time"
 
-	"github.com/go-kit/log"
-	"github.com/prometheus/client_golang/prometheus"
-	"github.com/prometheus/common/model"
-	"github.com/prometheus/common/route"
-
 	apiv1 "github.com/prometheus/alertmanager/api/v1"
 	apiv2 "github.com/prometheus/alertmanager/api/v2"
 	"github.com/prometheus/alertmanager/cluster"
@@ -33,6 +28,11 @@ import (
 	"github.com/prometheus/alertmanager/provider"
 	"github.com/prometheus/alertmanager/silence"
 	"github.com/prometheus/alertmanager/types"
+	"github.com/prometheus/client_golang/prometheus"
+	"github.com/prometheus/common/model"
+	"github.com/prometheus/common/route"
+
+	"github.com/go-kit/log"
 )
 
 // API represents all APIs of Alertmanager.
@@ -128,6 +128,7 @@ func New(opts Options) (*API, error) {
 		log.With(l, "version", "v2"),
 		opts.Registry,
 	)
+
 	if err != nil {
 		return nil, err
 	}
diff --git a/vendor/github.com/prometheus/alertmanager/api/v1/api.go b/vendor/github.com/prometheus/alertmanager/api/v1/api.go
index 39018a7589..29789867fd 100644
--- a/vendor/github.com/prometheus/alertmanager/api/v1/api.go
+++ b/vendor/github.com/prometheus/alertmanager/api/v1/api.go
@@ -171,7 +171,7 @@ func (api *API) receivers(w http.ResponseWriter, req *http.Request) {
 func (api *API) status(w http.ResponseWriter, req *http.Request) {
 	api.mtx.RLock()
 
-	status := struct {
+	var status = struct {
 		ConfigYAML    string            `json:"configYAML"`
 		ConfigJSON    *config.Config    `json:"configJSON"`
 		VersionInfo   map[string]string `json:"versionInfo"`
@@ -618,13 +618,13 @@ func (api *API) listSilences(w http.ResponseWriter, r *http.Request) {
 		}
 	}
 
-	sort.Slice(active, func(i, j int) bool {
+	sort.Slice(active, func(i int, j int) bool {
 		return active[i].EndsAt.Before(active[j].EndsAt)
 	})
-	sort.Slice(pending, func(i, j int) bool {
+	sort.Slice(pending, func(i int, j int) bool {
 		return pending[i].StartsAt.Before(pending[j].EndsAt)
 	})
-	sort.Slice(expired, func(i, j int) bool {
+	sort.Slice(expired, func(i int, j int) bool {
 		return expired[i].EndsAt.After(expired[j].EndsAt)
 	})
 
diff --git a/vendor/github.com/prometheus/alertmanager/api/v2/api.go b/vendor/github.com/prometheus/alertmanager/api/v2/api.go
index 5148d0573a..da4797dc08 100644
--- a/vendor/github.com/prometheus/alertmanager/api/v2/api.go
+++ b/vendor/github.com/prometheus/alertmanager/api/v2/api.go
@@ -73,11 +73,9 @@ type API struct {
 	Handler http.Handler
 }
 
-type (
-	groupsFn         func(func(*dispatch.Route) bool, func(*types.Alert, time.Time) bool) (dispatch.AlertGroups, map[prometheus_model.Fingerprint][]string)
-	getAlertStatusFn func(prometheus_model.Fingerprint) types.AlertStatus
-	setAlertStatusFn func(prometheus_model.LabelSet)
-)
+type groupsFn func(func(*dispatch.Route) bool, func(*types.Alert, time.Time) bool) (dispatch.AlertGroups, map[prometheus_model.Fingerprint][]string)
+type getAlertStatusFn func(prometheus_model.Fingerprint) types.AlertStatus
+type setAlertStatusFn func(prometheus_model.LabelSet)
 
 // NewAPI returns a new Alertmanager API v2
 func NewAPI(
@@ -227,14 +225,14 @@ func (api *API) getAlertsHandler(params alert_ops.GetAlertsParams) middleware.Re
 
 	matchers, err := parseFilter(params.Filter)
 	if err != nil {
-		level.Debug(logger).Log("msg", "Failed to parse matchers", "err", err)
+		level.Error(logger).Log("msg", "Failed to parse matchers", "err", err)
 		return alertgroup_ops.NewGetAlertGroupsBadRequest().WithPayload(err.Error())
 	}
 
 	if params.Receiver != nil {
 		receiverFilter, err = regexp.Compile("^(?:" + *params.Receiver + ")$")
 		if err != nil {
-			level.Debug(logger).Log("msg", "Failed to compile receiver regex", "err", err)
+			level.Error(logger).Log("msg", "Failed to compile receiver regex", "err", err)
 			return alert_ops.
 				NewGetAlertsBadRequest().
 				WithPayload(
@@ -356,7 +354,7 @@ func (api *API) getAlertGroupsHandler(params alertgroup_ops.GetAlertGroupsParams
 
 	matchers, err := parseFilter(params.Filter)
 	if err != nil {
-		level.Debug(logger).Log("msg", "Failed to parse matchers", "err", err)
+		level.Error(logger).Log("msg", "Failed to parse matchers", "err", err)
 		return alertgroup_ops.NewGetAlertGroupsBadRequest().WithPayload(err.Error())
 	}
 
@@ -494,7 +492,7 @@ func (api *API) getSilencesHandler(params silence_ops.GetSilencesParams) middlew
 		for _, matcherString := range params.Filter {
 			matcher, err := labels.ParseMatcher(matcherString)
 			if err != nil {
-				level.Debug(logger).Log("msg", "Failed to parse matchers", "err", err)
+				level.Error(logger).Log("msg", "Failed to parse matchers", "err", err)
 				return alert_ops.NewGetAlertsBadRequest().WithPayload(err.Error())
 			}
 
@@ -526,11 +524,13 @@ func (api *API) getSilencesHandler(params silence_ops.GetSilencesParams) middlew
 	return silence_ops.NewGetSilencesOK().WithPayload(sils)
 }
 
-var silenceStateOrder = map[types.SilenceState]int{
-	types.SilenceStateActive:  1,
-	types.SilenceStatePending: 2,
-	types.SilenceStateExpired: 3,
-}
+var (
+	silenceStateOrder = map[types.SilenceState]int{
+		types.SilenceStateActive:  1,
+		types.SilenceStatePending: 2,
+		types.SilenceStateExpired: 3,
+	}
+)
 
 // SortSilences sorts first according to the state "active, pending, expired"
 // then by end time or start time depending on the state.
diff --git a/vendor/github.com/prometheus/alertmanager/api/v2/compat.go b/vendor/github.com/prometheus/alertmanager/api/v2/compat.go
index 112bfc4f2f..6b948c2f06 100644
--- a/vendor/github.com/prometheus/alertmanager/api/v2/compat.go
+++ b/vendor/github.com/prometheus/alertmanager/api/v2/compat.go
@@ -18,11 +18,10 @@ import (
 	"time"
 
 	"github.com/go-openapi/strfmt"
-	prometheus_model "github.com/prometheus/common/model"
-
 	open_api_models "github.com/prometheus/alertmanager/api/v2/models"
 	"github.com/prometheus/alertmanager/silence/silencepb"
 	"github.com/prometheus/alertmanager/types"
+	prometheus_model "github.com/prometheus/common/model"
 )
 
 // GettableSilenceFromProto converts *silencepb.Silence to open_api_models.GettableSilence.
diff --git a/vendor/github.com/prometheus/alertmanager/api/v2/testing.go b/vendor/github.com/prometheus/alertmanager/api/v2/testing.go
deleted file mode 100644
index c813d350d3..0000000000
--- a/vendor/github.com/prometheus/alertmanager/api/v2/testing.go
+++ /dev/null
@@ -1,70 +0,0 @@
-// Copyright 2022 Prometheus Team
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-
-package v2
-
-import (
-	"encoding/json"
-	"testing"
-	"time"
-
-	"github.com/go-openapi/strfmt"
-	"github.com/stretchr/testify/require"
-
-	open_api_models "github.com/prometheus/alertmanager/api/v2/models"
-	"github.com/prometheus/alertmanager/pkg/labels"
-	"github.com/prometheus/alertmanager/silence/silencepb"
-)
-
-func createSilence(t *testing.T, ID, creator string, start, ends time.Time) (open_api_models.PostableSilence, []byte) {
-	t.Helper()
-
-	comment := "test"
-	matcherName := "a"
-	matcherValue := "b"
-	isRegex := false
-	startsAt := strfmt.DateTime(start)
-	endsAt := strfmt.DateTime(ends)
-
-	sil := open_api_models.PostableSilence{
-		ID: ID,
-		Silence: open_api_models.Silence{
-			Matchers:  open_api_models.Matchers{&open_api_models.Matcher{Name: &matcherName, Value: &matcherValue, IsRegex: &isRegex}},
-			StartsAt:  &startsAt,
-			EndsAt:    &endsAt,
-			CreatedBy: &creator,
-			Comment:   &comment,
-		},
-	}
-	b, err := json.Marshal(&sil)
-	require.NoError(t, err)
-
-	return sil, b
-}
-
-func createSilenceMatcher(t *testing.T, name, pattern string, matcherType silencepb.Matcher_Type) *silencepb.Matcher {
-	t.Helper()
-
-	return &silencepb.Matcher{
-		Name:    name,
-		Pattern: pattern,
-		Type:    matcherType,
-	}
-}
-
-func createLabelMatcher(t *testing.T, name, value string, matchType labels.MatchType) *labels.Matcher {
-	t.Helper()
-
-	matcher, _ := labels.NewMatcher(matchType, name, value)
-	return matcher
-}
diff --git a/vendor/github.com/prometheus/alertmanager/cluster/channel.go b/vendor/github.com/prometheus/alertmanager/cluster/channel.go
index ba0b834cd1..f4ea4dc075 100644
--- a/vendor/github.com/prometheus/alertmanager/cluster/channel.go
+++ b/vendor/github.com/prometheus/alertmanager/cluster/channel.go
@@ -21,9 +21,8 @@ import (
 	"github.com/go-kit/log/level"
 	"github.com/gogo/protobuf/proto"
 	"github.com/hashicorp/memberlist"
-	"github.com/prometheus/client_golang/prometheus"
-
 	"github.com/prometheus/alertmanager/cluster/clusterpb"
+	"github.com/prometheus/client_golang/prometheus"
 )
 
 // Channel allows clients to send messages for a specific state type that will be
diff --git a/vendor/github.com/prometheus/alertmanager/cluster/cluster.go b/vendor/github.com/prometheus/alertmanager/cluster/cluster.go
index ba7fdb9e7f..6de11c5399 100644
--- a/vendor/github.com/prometheus/alertmanager/cluster/cluster.go
+++ b/vendor/github.com/prometheus/alertmanager/cluster/cluster.go
@@ -119,7 +119,7 @@ func (s PeerStatus) String() string {
 const (
 	DefaultPushPullInterval  = 60 * time.Second
 	DefaultGossipInterval    = 200 * time.Millisecond
-	DefaultTCPTimeout        = 10 * time.Second
+	DefaultTcpTimeout        = 10 * time.Second
 	DefaultProbeTimeout      = 500 * time.Millisecond
 	DefaultProbeInterval     = 1 * time.Second
 	DefaultReconnectInterval = 10 * time.Second
@@ -254,8 +254,7 @@ func Create(
 
 func (p *Peer) Join(
 	reconnectInterval time.Duration,
-	reconnectTimeout time.Duration,
-) error {
+	reconnectTimeout time.Duration) error {
 	n, err := p.mlist.Join(p.resolvedPeers)
 	if err != nil {
 		level.Warn(p.logger).Log("msg", "failed to join cluster", "err", err)
@@ -785,7 +784,7 @@ func resolvePeers(ctx context.Context, peers []string, myAddress string, res *ne
 	return resolvedPeers, nil
 }
 
-func removeMyAddr(ips []net.IPAddr, targetPort, myAddr string) []net.IPAddr {
+func removeMyAddr(ips []net.IPAddr, targetPort string, myAddr string) []net.IPAddr {
 	var result []net.IPAddr
 
 	for _, ip := range ips {
diff --git a/vendor/github.com/prometheus/alertmanager/cluster/connection_pool.go b/vendor/github.com/prometheus/alertmanager/cluster/connection_pool.go
index bd6695aa87..0301432339 100644
--- a/vendor/github.com/prometheus/alertmanager/cluster/connection_pool.go
+++ b/vendor/github.com/prometheus/alertmanager/cluster/connection_pool.go
@@ -33,7 +33,7 @@ type connectionPool struct {
 
 func newConnectionPool(tlsClientCfg *tls.Config) (*connectionPool, error) {
 	cache, err := lru.NewWithEvict(
-		capacity, func(_, value interface{}) {
+		capacity, func(_ interface{}, value interface{}) {
 			conn, ok := value.(*tlsConn)
 			if ok {
 				_ = conn.Close()
diff --git a/vendor/github.com/prometheus/alertmanager/cluster/delegate.go b/vendor/github.com/prometheus/alertmanager/cluster/delegate.go
index 9957f69b91..50addcde5d 100644
--- a/vendor/github.com/prometheus/alertmanager/cluster/delegate.go
+++ b/vendor/github.com/prometheus/alertmanager/cluster/delegate.go
@@ -20,9 +20,8 @@ import (
 	"github.com/go-kit/log/level"
 	"github.com/gogo/protobuf/proto"
 	"github.com/hashicorp/memberlist"
-	"github.com/prometheus/client_golang/prometheus"
-
 	"github.com/prometheus/alertmanager/cluster/clusterpb"
+	"github.com/prometheus/client_golang/prometheus"
 )
 
 const (
diff --git a/vendor/github.com/prometheus/alertmanager/cluster/tls_config.go b/vendor/github.com/prometheus/alertmanager/cluster/tls_config.go
index 83e603c629..4604a484ce 100644
--- a/vendor/github.com/prometheus/alertmanager/cluster/tls_config.go
+++ b/vendor/github.com/prometheus/alertmanager/cluster/tls_config.go
@@ -14,7 +14,7 @@
 package cluster
 
 import (
-	"os"
+	"io/ioutil"
 	"path/filepath"
 
 	"github.com/prometheus/common/config"
@@ -31,7 +31,7 @@ func GetTLSTransportConfig(configPath string) (*TLSTransportConfig, error) {
 	if configPath == "" {
 		return nil, nil
 	}
-	bytes, err := os.ReadFile(configPath)
+	bytes, err := ioutil.ReadFile(configPath)
 	if err != nil {
 		return nil, err
 	}
diff --git a/vendor/github.com/prometheus/alertmanager/cluster/tls_connection.go b/vendor/github.com/prometheus/alertmanager/cluster/tls_connection.go
index 21ffc95970..f5a3326fac 100644
--- a/vendor/github.com/prometheus/alertmanager/cluster/tls_connection.go
+++ b/vendor/github.com/prometheus/alertmanager/cluster/tls_connection.go
@@ -66,6 +66,7 @@ func (conn *tlsConn) Write(b []byte) (int, error) {
 	conn.mtx.Lock()
 	defer conn.mtx.Unlock()
 	n, err := conn.connection.Write(b)
+
 	if err != nil {
 		conn.live = false
 	}
diff --git a/vendor/github.com/prometheus/alertmanager/cluster/tls_transport.go b/vendor/github.com/prometheus/alertmanager/cluster/tls_transport.go
index 16fbe2519e..ca8d04c272 100644
--- a/vendor/github.com/prometheus/alertmanager/cluster/tls_transport.go
+++ b/vendor/github.com/prometheus/alertmanager/cluster/tls_transport.go
@@ -194,7 +194,7 @@ func (t *TLSTransport) Shutdown() error {
 // from the pool, and writes to it. It also returns a timestamp of when
 // the packet was written.
 func (t *TLSTransport) WriteTo(b []byte, addr string) (time.Time, error) {
-	conn, err := t.connPool.borrowConnection(addr, DefaultTCPTimeout)
+	conn, err := t.connPool.borrowConnection(addr, DefaultTcpTimeout)
 	if err != nil {
 		t.writeErrs.WithLabelValues("packet").Inc()
 		return time.Now(), errors.Wrap(err, "failed to dial")
diff --git a/vendor/github.com/prometheus/alertmanager/config/config.go b/vendor/github.com/prometheus/alertmanager/config/config.go
index efc1a9f3c6..448f18532c 100644
--- a/vendor/github.com/prometheus/alertmanager/config/config.go
+++ b/vendor/github.com/prometheus/alertmanager/config/config.go
@@ -16,9 +16,9 @@ package config
 import (
 	"encoding/json"
 	"fmt"
+	"io/ioutil"
 	"net"
 	"net/url"
-	"os"
 	"path/filepath"
 	"regexp"
 	"sort"
@@ -192,7 +192,7 @@ func Load(s string) (*Config, error) {
 
 // LoadFile parses the given YAML file into a Config.
 func LoadFile(filename string) (*Config, error) {
-	content, err := os.ReadFile(filename)
+	content, err := ioutil.ReadFile(filename)
 	if err != nil {
 		return nil, err
 	}
@@ -580,7 +580,7 @@ func checkTimeInterval(r *Route, timeIntervals map[string]struct{}) error {
 
 // DefaultGlobalConfig returns GlobalConfig with default values.
 func DefaultGlobalConfig() GlobalConfig {
-	defaultHTTPConfig := commoncfg.DefaultHTTPClientConfig
+	var defaultHTTPConfig = commoncfg.DefaultHTTPClientConfig
 	return GlobalConfig{
 		ResolveTimeout: model.Duration(5 * time.Minute),
 		HTTPConfig:     &defaultHTTPConfig,
diff --git a/vendor/github.com/prometheus/alertmanager/config/coordinator.go b/vendor/github.com/prometheus/alertmanager/config/coordinator.go
index 5ee44f81d8..499e939ecf 100644
--- a/vendor/github.com/prometheus/alertmanager/config/coordinator.go
+++ b/vendor/github.com/prometheus/alertmanager/config/coordinator.go
@@ -150,7 +150,7 @@ func md5HashAsMetricValue(data []byte) float64 {
 	sum := md5.Sum(data)
 	// We only want 48 bits as a float64 only has a 53 bit mantissa.
 	smallSum := sum[0:6]
-	bytes := make([]byte, 8)
+	var bytes = make([]byte, 8)
 	copy(bytes, smallSum)
 	return float64(binary.LittleEndian.Uint64(bytes))
 }
diff --git a/vendor/github.com/prometheus/alertmanager/config/notifiers.go b/vendor/github.com/prometheus/alertmanager/config/notifiers.go
index 95df28db43..a2cadf9e67 100644
--- a/vendor/github.com/prometheus/alertmanager/config/notifiers.go
+++ b/vendor/github.com/prometheus/alertmanager/config/notifiers.go
@@ -20,10 +20,9 @@ import (
 	"time"
 
 	"github.com/pkg/errors"
+
 	commoncfg "github.com/prometheus/common/config"
 	"github.com/prometheus/common/sigv4"
-	"golang.org/x/text/cases"
-	"golang.org/x/text/language"
 )
 
 var (
@@ -145,10 +144,8 @@ var (
 		},
 		DisableNotifications: false,
 		Message:              `{{ template "telegram.default.message" . }}`,
-		ParseMode:            "HTML",
+		ParseMode:            "MarkdownV2",
 	}
-
-	normalizeTitle = cases.Title(language.AmericanEnglish)
 )
 
 // NotifierConfig contains base options common across all notifier configurations.
@@ -193,7 +190,7 @@ func (c *EmailConfig) UnmarshalYAML(unmarshal func(interface{}) error) error {
 	// Header names are case-insensitive, check for collisions.
 	normalizedHeaders := map[string]string{}
 	for h, v := range c.Headers {
-		normalized := normalizeTitle.String(h)
+		normalized := strings.Title(h)
 		if _, ok := normalizedHeaders[normalized]; ok {
 			return fmt.Errorf("duplicate header %q in email config", normalized)
 		}
@@ -455,7 +452,7 @@ func (c *WechatConfig) UnmarshalYAML(unmarshal func(interface{}) error) error {
 	}
 
 	if !wechatTypeMatcher.MatchString(c.MessageType) {
-		return errors.Errorf("weChat message type %q does not match valid options %s", c.MessageType, wechatValidTypesRe)
+		return errors.Errorf("WeChat message type %q does not match valid options %s", c.MessageType, wechatValidTypesRe)
 	}
 
 	return nil
@@ -495,18 +492,18 @@ func (c *OpsGenieConfig) UnmarshalYAML(unmarshal func(interface{}) error) error
 		return err
 	}
 
-	if c.APIKey != "" && len(c.APIKeyFile) > 0 {
+	if c.APIURL != nil && len(c.APIKeyFile) > 0 {
 		return fmt.Errorf("at most one of api_key & api_key_file must be configured")
 	}
 
 	for _, r := range c.Responders {
 		if r.ID == "" && r.Username == "" && r.Name == "" {
-			return errors.Errorf("opsGenieConfig responder %v has to have at least one of id, username or name specified", r)
+			return errors.Errorf("OpsGenieConfig responder %v has to have at least one of id, username or name specified", r)
 		}
 
 		r.Type = strings.ToLower(r.Type)
 		if !opsgenieTypeMatcher.MatchString(r.Type) {
-			return errors.Errorf("opsGenieConfig responder %v type does not match valid options %s", r, opsgenieValidTypesRe)
+			return errors.Errorf("OpsGenieConfig responder %v type does not match valid options %s", r, opsgenieValidTypesRe)
 		}
 	}
 
@@ -555,7 +552,7 @@ func (c *VictorOpsConfig) UnmarshalYAML(unmarshal func(interface{}) error) error
 
 	for _, v := range reservedFields {
 		if _, ok := c.CustomFields[v]; ok {
-			return fmt.Errorf("victorOps config contains custom field %s which cannot be used as it conflicts with the fixed/static fields", v)
+			return fmt.Errorf("VictorOps config contains custom field %s which cannot be used as it conflicts with the fixed/static fields", v)
 		}
 	}
 
@@ -665,6 +662,9 @@ func (c *TelegramConfig) UnmarshalYAML(unmarshal func(interface{}) error) error
 	if c.ChatID == 0 {
 		return fmt.Errorf("missing chat_id on telegram_config")
 	}
+	if c.APIUrl == nil {
+		return fmt.Errorf("missing api_url on telegram_config")
+	}
 	if c.ParseMode != "" &&
 		c.ParseMode != "Markdown" &&
 		c.ParseMode != "MarkdownV2" &&
diff --git a/vendor/github.com/prometheus/alertmanager/dispatch/dispatch.go b/vendor/github.com/prometheus/alertmanager/dispatch/dispatch.go
index 853d849688..65d7feacb3 100644
--- a/vendor/github.com/prometheus/alertmanager/dispatch/dispatch.go
+++ b/vendor/github.com/prometheus/alertmanager/dispatch/dispatch.go
@@ -80,6 +80,7 @@ type Dispatcher struct {
 	metrics *DispatcherMetrics
 	limits  Limits
 
+	marker  types.Marker
 	timeout func(time.Duration) time.Duration
 
 	mtx                sync.RWMutex
@@ -120,6 +121,7 @@ func NewDispatcher(
 		alerts:  ap,
 		stage:   s,
 		route:   r,
+		marker:  mk,
 		timeout: to,
 		logger:  log.With(l, "component", "dispatcher"),
 		metrics: m,
diff --git a/vendor/github.com/prometheus/alertmanager/dispatch/route.go b/vendor/github.com/prometheus/alertmanager/dispatch/route.go
index 4b3673c531..643aa6dae4 100644
--- a/vendor/github.com/prometheus/alertmanager/dispatch/route.go
+++ b/vendor/github.com/prometheus/alertmanager/dispatch/route.go
@@ -183,6 +183,9 @@ func (r *Route) Key() string {
 // Walk traverses the route tree in depth-first order.
 func (r *Route) Walk(visit func(*Route)) {
 	visit(r)
+	if r.Routes == nil {
+		return
+	}
 	for i := range r.Routes {
 		r.Routes[i].Walk(visit)
 	}
diff --git a/vendor/github.com/prometheus/alertmanager/nflog/nflog.go b/vendor/github.com/prometheus/alertmanager/nflog/nflog.go
index a9ddd78f5d..be2b47db3b 100644
--- a/vendor/github.com/prometheus/alertmanager/nflog/nflog.go
+++ b/vendor/github.com/prometheus/alertmanager/nflog/nflog.go
@@ -30,10 +30,9 @@ import (
 	"github.com/go-kit/log"
 	"github.com/go-kit/log/level"
 	"github.com/matttproud/golang_protobuf_extensions/pbutil"
-	"github.com/prometheus/client_golang/prometheus"
-
 	"github.com/prometheus/alertmanager/cluster"
 	pb "github.com/prometheus/alertmanager/nflog/nflogpb"
+	"github.com/prometheus/client_golang/prometheus"
 )
 
 // ErrNotFound is returned for empty query results.
diff --git a/vendor/github.com/prometheus/alertmanager/notify/notify.go b/vendor/github.com/prometheus/alertmanager/notify/notify.go
index d6c741fe47..bbdc6e7b01 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/notify.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/notify.go
@@ -330,9 +330,9 @@ func (pb *PipelineBuilder) New(
 
 	ms := NewGossipSettleStage(peer)
 	is := NewMuteStage(inhibitor)
-	tas := NewTimeActiveStage(times)
-	tms := NewTimeMuteStage(times)
 	ss := NewMuteStage(silencer)
+	tms := NewTimeMuteStage(times)
+	tas := NewTimeActiveStage(times)
 
 	for name := range receivers {
 		st := createReceiverStage(name, receivers[name], wait, notificationLog, pb.metrics)
diff --git a/vendor/github.com/prometheus/alertmanager/notify/opsgenie/opsgenie.go b/vendor/github.com/prometheus/alertmanager/notify/opsgenie/opsgenie.go
index 10c84493c8..d2b4c3bfe6 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/opsgenie/opsgenie.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/opsgenie/opsgenie.go
@@ -18,8 +18,8 @@ import (
 	"context"
 	"encoding/json"
 	"fmt"
+	"io/ioutil"
 	"net/http"
-	"os"
 	"strings"
 
 	"github.com/go-kit/log"
@@ -114,7 +114,7 @@ func (n *Notifier) Notify(ctx context.Context, as ...*types.Alert) (bool, error)
 }
 
 // Like Split but filter out empty strings.
-func safeSplit(s, sep string) []string {
+func safeSplit(s string, sep string) []string {
 	a := strings.Split(strings.TrimSpace(s), sep)
 	b := a[:0]
 	for _, x := range a {
@@ -160,7 +160,7 @@ func (n *Notifier) createRequests(ctx context.Context, as ...*types.Alert) ([]*h
 		q := resolvedEndpointURL.Query()
 		q.Set("identifierType", "alias")
 		resolvedEndpointURL.RawQuery = q.Encode()
-		msg := &opsGenieCloseMessage{Source: tmpl(n.conf.Source)}
+		var msg = &opsGenieCloseMessage{Source: tmpl(n.conf.Source)}
 		var buf bytes.Buffer
 		if err := json.NewEncoder(&buf).Encode(msg); err != nil {
 			return nil, false, err
@@ -209,7 +209,7 @@ func (n *Notifier) createRequests(ctx context.Context, as ...*types.Alert) ([]*h
 			responders = append(responders, responder)
 		}
 
-		msg := &opsGenieCreateMessage{
+		var msg = &opsGenieCreateMessage{
 			Alias:       alias,
 			Message:     message,
 			Description: tmpl(n.conf.Description),
@@ -233,11 +233,11 @@ func (n *Notifier) createRequests(ctx context.Context, as ...*types.Alert) ([]*h
 		requests = append(requests, req.WithContext(ctx))
 
 		if n.conf.UpdateAlerts {
-			updateMessageEndpointURL := n.conf.APIURL.Copy()
-			updateMessageEndpointURL.Path += fmt.Sprintf("v2/alerts/%s/message", alias)
-			q := updateMessageEndpointURL.Query()
+			updateMessageEndpointUrl := n.conf.APIURL.Copy()
+			updateMessageEndpointUrl.Path += fmt.Sprintf("v2/alerts/%s/message", alias)
+			q := updateMessageEndpointUrl.Query()
 			q.Set("identifierType", "alias")
-			updateMessageEndpointURL.RawQuery = q.Encode()
+			updateMessageEndpointUrl.RawQuery = q.Encode()
 			updateMsgMsg := &opsGenieUpdateMessageMessage{
 				Message: msg.Message,
 			}
@@ -245,7 +245,7 @@ func (n *Notifier) createRequests(ctx context.Context, as ...*types.Alert) ([]*h
 			if err := json.NewEncoder(&updateMessageBuf).Encode(updateMsgMsg); err != nil {
 				return nil, false, err
 			}
-			req, err := http.NewRequest("PUT", updateMessageEndpointURL.String(), &updateMessageBuf)
+			req, err := http.NewRequest("PUT", updateMessageEndpointUrl.String(), &updateMessageBuf)
 			if err != nil {
 				return nil, true, err
 			}
@@ -276,7 +276,7 @@ func (n *Notifier) createRequests(ctx context.Context, as ...*types.Alert) ([]*h
 	if n.conf.APIKey != "" {
 		apiKey = tmpl(string(n.conf.APIKey))
 	} else {
-		content, err := os.ReadFile(n.conf.APIKeyFile)
+		content, err := ioutil.ReadFile(n.conf.APIKeyFile)
 		if err != nil {
 			return nil, false, errors.Wrap(err, "read key_file error")
 		}
diff --git a/vendor/github.com/prometheus/alertmanager/notify/slack/slack.go b/vendor/github.com/prometheus/alertmanager/notify/slack/slack.go
index b8bdb1fba0..5e8d515b09 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/slack/slack.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/slack/slack.go
@@ -18,12 +18,13 @@ import (
 	"context"
 	"encoding/json"
 	"fmt"
+	"github.com/go-kit/log/level"
+	"io/ioutil"
 	"net/http"
-	"os"
 
-	"github.com/go-kit/log"
-	"github.com/go-kit/log/level"
 	"github.com/pkg/errors"
+
+	"github.com/go-kit/log"
 	commoncfg "github.com/prometheus/common/config"
 
 	"github.com/prometheus/alertmanager/config"
@@ -120,9 +121,9 @@ func (n *Notifier) Notify(ctx context.Context, as ...*types.Alert) (bool, error)
 		MrkdwnIn:   markdownIn,
 	}
 
-	numFields := len(n.conf.Fields)
+	var numFields = len(n.conf.Fields)
 	if numFields > 0 {
-		fields := make([]config.SlackField, numFields)
+		var fields = make([]config.SlackField, numFields)
 		for index, field := range n.conf.Fields {
 			// Check if short was defined for the field otherwise fallback to the global setting
 			var short bool
@@ -142,9 +143,9 @@ func (n *Notifier) Notify(ctx context.Context, as ...*types.Alert) (bool, error)
 		att.Fields = fields
 	}
 
-	numActions := len(n.conf.Actions)
+	var numActions = len(n.conf.Actions)
 	if numActions > 0 {
-		actions := make([]config.SlackAction, numActions)
+		var actions = make([]config.SlackAction, numActions)
 		for index, action := range n.conf.Actions {
 			slackAction := config.SlackAction{
 				Type:  tmplText(action.Type),
@@ -190,7 +191,7 @@ func (n *Notifier) Notify(ctx context.Context, as ...*types.Alert) (bool, error)
 	if n.conf.APIURL != nil {
 		u = n.conf.APIURL.String()
 	} else {
-		content, err := os.ReadFile(n.conf.APIURLFile)
+		content, err := ioutil.ReadFile(n.conf.APIURLFile)
 		if err != nil {
 			return false, err
 		}
diff --git a/vendor/github.com/prometheus/alertmanager/notify/sns/sns.go b/vendor/github.com/prometheus/alertmanager/notify/sns/sns.go
index 1dfd42b4a5..104c4a4566 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/sns/sns.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/sns/sns.go
@@ -71,8 +71,9 @@ func (n *Notifier) Notify(ctx context.Context, alert ...*types.Alert) (bool, err
 	if err != nil {
 		if e, ok := err.(awserr.RequestFailure); ok {
 			return n.retrier.Check(e.StatusCode(), strings.NewReader(e.Message()))
+		} else {
+			return true, err
 		}
-		return true, err
 	}
 
 	publishInput, err := n.createPublishInput(ctx, tmpl)
@@ -84,8 +85,9 @@ func (n *Notifier) Notify(ctx context.Context, alert ...*types.Alert) (bool, err
 	if err != nil {
 		if e, ok := err.(awserr.RequestFailure); ok {
 			return n.retrier.Check(e.StatusCode(), strings.NewReader(e.Message()))
+		} else {
+			return true, err
 		}
-		return true, err
 	}
 
 	level.Debug(n.logger).Log("msg", "SNS message successfully published", "message_id", publishOutput.MessageId, "sequence number", publishOutput.SequenceNumber)
@@ -94,7 +96,7 @@ func (n *Notifier) Notify(ctx context.Context, alert ...*types.Alert) (bool, err
 }
 
 func (n *Notifier) createSNSClient(tmpl func(string) string) (*sns.SNS, error) {
-	var creds *credentials.Credentials
+	var creds *credentials.Credentials = nil
 	// If there are provided sigV4 credentials we want to use those to create a session.
 	if n.conf.Sigv4.AccessKey != "" && n.conf.Sigv4.SecretKey != "" {
 		creds = credentials.NewStaticCredentials(n.conf.Sigv4.AccessKey, string(n.conf.Sigv4.SecretKey), "")
diff --git a/vendor/github.com/prometheus/alertmanager/notify/telegram/telegram.go b/vendor/github.com/prometheus/alertmanager/notify/telegram/telegram.go
index 43bf2a36bc..0977cdc672 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/telegram/telegram.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/telegram/telegram.go
@@ -18,14 +18,15 @@ import (
 	"net/http"
 
 	"github.com/go-kit/log"
-	"github.com/go-kit/log/level"
-	commoncfg "github.com/prometheus/common/config"
 	"gopkg.in/telebot.v3"
 
+	"github.com/prometheus/alertmanager/template"
+
+	"github.com/go-kit/log/level"
 	"github.com/prometheus/alertmanager/config"
 	"github.com/prometheus/alertmanager/notify"
-	"github.com/prometheus/alertmanager/template"
 	"github.com/prometheus/alertmanager/types"
+	commoncfg "github.com/prometheus/common/config"
 )
 
 // Notifier implements a Notifier for telegram notifications.
@@ -83,15 +84,16 @@ func (n *Notifier) Notify(ctx context.Context, alert ...*types.Alert) (bool, err
 	return false, nil
 }
 
-func createTelegramClient(token config.Secret, apiURL, parseMode string, httpClient *http.Client) (*telebot.Bot, error) {
+func createTelegramClient(token config.Secret, apiUrl, parseMode string, httpClient *http.Client) (*telebot.Bot, error) {
 	secret := string(token)
 	bot, err := telebot.NewBot(telebot.Settings{
 		Token:     secret,
-		URL:       apiURL,
+		URL:       apiUrl,
 		ParseMode: parseMode,
 		Client:    httpClient,
 		Offline:   true,
 	})
+
 	if err != nil {
 		return nil, err
 	}
diff --git a/vendor/github.com/prometheus/alertmanager/notify/util.go b/vendor/github.com/prometheus/alertmanager/notify/util.go
index d3d8b5b12a..3d0a4a2419 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/util.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/util.go
@@ -18,16 +18,17 @@ import (
 	"crypto/sha256"
 	"fmt"
 	"io"
+	"io/ioutil"
 	"net/http"
 	"net/url"
 
 	"github.com/go-kit/log"
 	"github.com/go-kit/log/level"
 	"github.com/pkg/errors"
-	"github.com/prometheus/common/version"
 
 	"github.com/prometheus/alertmanager/template"
 	"github.com/prometheus/alertmanager/types"
+	"github.com/prometheus/common/version"
 )
 
 // UserAgentHeader is the default User-Agent for notification requests
@@ -58,11 +59,11 @@ func PostText(ctx context.Context, client *http.Client, url string, body io.Read
 	return post(ctx, client, url, "text/plain", body)
 }
 
-func post(ctx context.Context, client *http.Client, url, bodyType string, body io.Reader) (*http.Response, error) {
+func post(ctx context.Context, client *http.Client, url string, bodyType string, body io.Reader) (*http.Response, error) {
 	return request(ctx, client, http.MethodPost, url, bodyType, body)
 }
 
-func request(ctx context.Context, client *http.Client, method, url, bodyType string, body io.Reader) (*http.Response, error) {
+func request(ctx context.Context, client *http.Client, method string, url string, bodyType string, body io.Reader) (*http.Response, error) {
 	req, err := http.NewRequest(method, url, body)
 	if err != nil {
 		return nil, err
@@ -77,7 +78,7 @@ func request(ctx context.Context, client *http.Client, method, url, bodyType str
 // Drain consumes and closes the response's body to make sure that the
 // HTTP client can reuse existing connections.
 func Drain(r *http.Response) {
-	io.Copy(io.Discard, r.Body)
+	io.Copy(ioutil.Discard, r.Body)
 	r.Body.Close()
 }
 
@@ -160,7 +161,7 @@ func readAll(r io.Reader) string {
 	if r == nil {
 		return ""
 	}
-	bs, err := io.ReadAll(r)
+	bs, err := ioutil.ReadAll(r)
 	if err != nil {
 		return ""
 	}
diff --git a/vendor/github.com/prometheus/alertmanager/notify/victorops/victorops.go b/vendor/github.com/prometheus/alertmanager/notify/victorops/victorops.go
index 3878c1103b..3fdbf41dc1 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/victorops/victorops.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/victorops/victorops.go
@@ -64,6 +64,7 @@ const (
 
 // Notify implements the Notifier interface.
 func (n *Notifier) Notify(ctx context.Context, as ...*types.Alert) (bool, error) {
+
 	var err error
 	var (
 		data   = notify.GetTemplateData(ctx, n.tmpl, as, n.logger)
diff --git a/vendor/github.com/prometheus/alertmanager/notify/wechat/wechat.go b/vendor/github.com/prometheus/alertmanager/notify/wechat/wechat.go
index a926b2e8fb..762d467ad7 100644
--- a/vendor/github.com/prometheus/alertmanager/notify/wechat/wechat.go
+++ b/vendor/github.com/prometheus/alertmanager/notify/wechat/wechat.go
@@ -18,7 +18,7 @@ import (
 	"context"
 	"encoding/json"
 	"fmt"
-	"io"
+	"io/ioutil"
 	"net/http"
 	"net/url"
 	"time"
@@ -171,7 +171,7 @@ func (n *Notifier) Notify(ctx context.Context, as ...*types.Alert) (bool, error)
 		return true, fmt.Errorf("unexpected status code %v", resp.StatusCode)
 	}
 
-	body, err := io.ReadAll(resp.Body)
+	body, err := ioutil.ReadAll(resp.Body)
 	if err != nil {
 		return true, err
 	}
diff --git a/vendor/github.com/prometheus/alertmanager/provider/mem/mem.go b/vendor/github.com/prometheus/alertmanager/provider/mem/mem.go
index 0e39ba1d5f..9a67cceb9a 100644
--- a/vendor/github.com/prometheus/alertmanager/provider/mem/mem.go
+++ b/vendor/github.com/prometheus/alertmanager/provider/mem/mem.go
@@ -20,7 +20,6 @@ import (
 
 	"github.com/go-kit/log"
 	"github.com/go-kit/log/level"
-	"github.com/prometheus/client_golang/prometheus"
 	"github.com/prometheus/common/model"
 
 	"github.com/prometheus/alertmanager/provider"
@@ -34,10 +33,8 @@ const alertChannelLength = 200
 type Alerts struct {
 	cancel context.CancelFunc
 
-	alerts *store.Alerts
-	marker types.Marker
-
 	mtx       sync.Mutex
+	alerts    *store.Alerts
 	listeners map[int]listeningAlerts
 	next      int
 
@@ -65,34 +62,14 @@ type listeningAlerts struct {
 	done   chan struct{}
 }
 
-func (a *Alerts) registerMetrics(r prometheus.Registerer) {
-	newMemAlertByStatus := func(s types.AlertState) prometheus.GaugeFunc {
-		return prometheus.NewGaugeFunc(
-			prometheus.GaugeOpts{
-				Name:        "alertmanager_alerts",
-				Help:        "How many alerts by state.",
-				ConstLabels: prometheus.Labels{"state": string(s)},
-			},
-			func() float64 {
-				return float64(a.count(s))
-			},
-		)
-	}
-
-	r.MustRegister(newMemAlertByStatus(types.AlertStateActive))
-	r.MustRegister(newMemAlertByStatus(types.AlertStateSuppressed))
-	r.MustRegister(newMemAlertByStatus(types.AlertStateUnprocessed))
-}
-
 // NewAlerts returns a new alert provider.
-func NewAlerts(ctx context.Context, m types.Marker, intervalGC time.Duration, alertCallback AlertStoreCallback, l log.Logger, r prometheus.Registerer) (*Alerts, error) {
+func NewAlerts(ctx context.Context, m types.Marker, intervalGC time.Duration, alertCallback AlertStoreCallback, l log.Logger) (*Alerts, error) {
 	if alertCallback == nil {
 		alertCallback = noopCallback{}
 	}
 
 	ctx, cancel := context.WithCancel(ctx)
 	a := &Alerts{
-		marker:    m,
 		alerts:    store.NewAlerts(),
 		cancel:    cancel,
 		listeners: map[int]listeningAlerts{},
@@ -121,11 +98,6 @@ func NewAlerts(ctx context.Context, m types.Marker, intervalGC time.Duration, al
 		}
 		a.mtx.Unlock()
 	})
-
-	if r != nil {
-		a.registerMetrics(r)
-	}
-
 	go a.alerts.Run(ctx, intervalGC)
 
 	return a, nil
@@ -240,25 +212,6 @@ func (a *Alerts) Put(alerts ...*types.Alert) error {
 	return nil
 }
 
-// count returns the number of non-resolved alerts we currently have stored filtered by the provided state.
-func (a *Alerts) count(state types.AlertState) int {
-	var count int
-	for _, alert := range a.alerts.List() {
-		if alert.Resolved() {
-			continue
-		}
-
-		status := a.marker.Status(alert.Fingerprint())
-		if status.State != state {
-			continue
-		}
-
-		count++
-	}
-
-	return count
-}
-
 type noopCallback struct{}
 
 func (n noopCallback) PreStore(_ *types.Alert, _ bool) error { return nil }
diff --git a/vendor/github.com/prometheus/alertmanager/provider/provider.go b/vendor/github.com/prometheus/alertmanager/provider/provider.go
index 5fcce20360..91b5a74166 100644
--- a/vendor/github.com/prometheus/alertmanager/provider/provider.go
+++ b/vendor/github.com/prometheus/alertmanager/provider/provider.go
@@ -21,8 +21,10 @@ import (
 	"github.com/prometheus/alertmanager/types"
 )
 
-// ErrNotFound is returned if a provider cannot find a requested item.
-var ErrNotFound = fmt.Errorf("item not found")
+var (
+	// ErrNotFound is returned if a provider cannot find a requested item.
+	ErrNotFound = fmt.Errorf("item not found")
+)
 
 // Iterator provides the functions common to all iterators. To be useful, a
 // specific iterator interface (e.g. AlertIterator) has to be implemented that
diff --git a/vendor/github.com/prometheus/alertmanager/silence/silence.go b/vendor/github.com/prometheus/alertmanager/silence/silence.go
index d8837d28af..9beaab1d27 100644
--- a/vendor/github.com/prometheus/alertmanager/silence/silence.go
+++ b/vendor/github.com/prometheus/alertmanager/silence/silence.go
@@ -27,19 +27,17 @@ import (
 	"sync"
 	"time"
 
-	"github.com/benbjohnson/clock"
 	"github.com/go-kit/log"
 	"github.com/go-kit/log/level"
 	uuid "github.com/gofrs/uuid"
 	"github.com/matttproud/golang_protobuf_extensions/pbutil"
 	"github.com/pkg/errors"
-	"github.com/prometheus/client_golang/prometheus"
-	"github.com/prometheus/common/model"
-
 	"github.com/prometheus/alertmanager/cluster"
 	"github.com/prometheus/alertmanager/pkg/labels"
 	pb "github.com/prometheus/alertmanager/silence/silencepb"
 	"github.com/prometheus/alertmanager/types"
+	"github.com/prometheus/client_golang/prometheus"
+	"github.com/prometheus/common/model"
 )
 
 // ErrNotFound is returned if a silence was not found.
@@ -48,6 +46,10 @@ var ErrNotFound = fmt.Errorf("silence not found")
 // ErrInvalidState is returned if the state isn't valid.
 var ErrInvalidState = fmt.Errorf("invalid state")
 
+func utcNow() time.Time {
+	return time.Now().UTC()
+}
+
 type matcherCache map[*pb.Silence]labels.Matchers
 
 // Get retrieves the matchers for a given silence. If it is a missed cache
@@ -151,7 +153,7 @@ func (s *Silencer) Mutes(lset model.LabelSet) bool {
 	}
 	if len(allSils) == 0 {
 		// Easy case, neither active nor pending silences anymore.
-		s.marker.SetActiveOrSilenced(fp, newVersion, nil, nil)
+		s.marker.SetSilenced(fp, newVersion, nil, nil)
 		return false
 	}
 	// It is still possible that nothing has changed, but finding out is not
@@ -159,7 +161,7 @@ func (s *Silencer) Mutes(lset model.LabelSet) bool {
 	// result. So let's do it in any case. Note that we cannot reuse the
 	// current ID slices for concurrency reasons.
 	activeIDs, pendingIDs = nil, nil
-	now := s.silences.nowUTC()
+	now := s.silences.now()
 	for _, sil := range allSils {
 		switch getState(sil, now) {
 		case types.SilenceStatePending:
@@ -180,17 +182,16 @@ func (s *Silencer) Mutes(lset model.LabelSet) bool {
 	sort.Strings(activeIDs)
 	sort.Strings(pendingIDs)
 
-	s.marker.SetActiveOrSilenced(fp, newVersion, activeIDs, pendingIDs)
+	s.marker.SetSilenced(fp, newVersion, activeIDs, pendingIDs)
 
 	return len(activeIDs) > 0
 }
 
 // Silences holds a silence state that can be modified, queried, and snapshot.
 type Silences struct {
-	clock clock.Clock
-
 	logger    log.Logger
 	metrics   *metrics
+	now       func() time.Time
 	retention time.Duration
 
 	mtx       sync.RWMutex
@@ -330,10 +331,10 @@ func New(o Options) (*Silences, error) {
 		}
 	}
 	s := &Silences{
-		clock:     clock.New(),
 		mc:        matcherCache{},
 		logger:    log.NewNopLogger(),
 		retention: o.Retention,
+		now:       utcNow,
 		broadcast: func([]byte) {},
 		st:        state{},
 	}
@@ -350,16 +351,12 @@ func New(o Options) (*Silences, error) {
 	return s, nil
 }
 
-func (s *Silences) nowUTC() time.Time {
-	return s.clock.Now().UTC()
-}
-
 // Maintenance garbage collects the silence state at the given interval. If the snapshot
 // file is set, a snapshot is written to it afterwards.
 // Terminates on receiving from stopc.
 // If not nil, the last argument is an override for what to do as part of the maintenance - for advanced usage.
 func (s *Silences) Maintenance(interval time.Duration, snapf string, stopc <-chan struct{}, override MaintenanceFunc) {
-	t := s.clock.Ticker(interval)
+	t := time.NewTicker(interval)
 	defer t.Stop()
 
 	var doMaintenance MaintenanceFunc
@@ -387,10 +384,10 @@ func (s *Silences) Maintenance(interval time.Duration, snapf string, stopc <-cha
 	}
 
 	runMaintenance := func(do MaintenanceFunc) error {
-		start := s.nowUTC()
+		start := s.now()
 		level.Debug(s.logger).Log("msg", "Running maintenance")
 		size, err := do()
-		level.Debug(s.logger).Log("msg", "Maintenance done", "duration", s.clock.Since(start), "size", size)
+		level.Debug(s.logger).Log("msg", "Maintenance done", "duration", s.now().Sub(start), "size", size)
 		s.metrics.snapshotSize.Set(float64(size))
 		return err
 	}
@@ -421,7 +418,7 @@ func (s *Silences) GC() (int, error) {
 	start := time.Now()
 	defer func() { s.metrics.gcDuration.Observe(time.Since(start).Seconds()) }()
 
-	now := s.nowUTC()
+	now := s.now()
 	var n int
 
 	s.mtx.Lock()
@@ -549,7 +546,7 @@ func (s *Silences) Set(sil *pb.Silence) (string, error) {
 	s.mtx.Lock()
 	defer s.mtx.Unlock()
 
-	now := s.nowUTC()
+	now := s.now()
 	prev, ok := s.getSilence(sil.Id)
 
 	if sil.Id != "" && !ok {
@@ -559,7 +556,7 @@ func (s *Silences) Set(sil *pb.Silence) (string, error) {
 		if canUpdate(prev, sil, now) {
 			return sil.Id, s.setSilence(sil, now)
 		}
-		if getState(prev, s.nowUTC()) != types.SilenceStateExpired {
+		if getState(prev, s.now()) != types.SilenceStateExpired {
 			// We cannot update the silence, expire the old one.
 			if err := s.expire(prev.Id); err != nil {
 				return "", errors.Wrap(err, "expire previous silence")
@@ -623,7 +620,7 @@ func (s *Silences) expire(id string) error {
 		return ErrNotFound
 	}
 	sil = cloneSilence(sil)
-	now := s.nowUTC()
+	now := s.now()
 
 	switch getState(sil, now) {
 	case types.SilenceStateExpired:
@@ -729,7 +726,7 @@ func (s *Silences) Query(params ...QueryParam) ([]*pb.Silence, int, error) {
 			return nil, s.Version(), err
 		}
 	}
-	sils, version, err := s.query(q, s.nowUTC())
+	sils, version, err := s.query(q, s.now())
 	if err != nil {
 		s.metrics.queryErrorsTotal.Inc()
 	}
@@ -852,7 +849,7 @@ func (s *Silences) Merge(b []byte) error {
 	s.mtx.Lock()
 	defer s.mtx.Unlock()
 
-	now := s.nowUTC()
+	now := s.now()
 
 	for _, e := range st {
 		if merged := s.st.merge(e, now); merged {
diff --git a/vendor/github.com/prometheus/alertmanager/store/store.go b/vendor/github.com/prometheus/alertmanager/store/store.go
index 83f1495a0f..488cb45161 100644
--- a/vendor/github.com/prometheus/alertmanager/store/store.go
+++ b/vendor/github.com/prometheus/alertmanager/store/store.go
@@ -19,13 +19,14 @@ import (
 	"sync"
 	"time"
 
-	"github.com/prometheus/common/model"
-
 	"github.com/prometheus/alertmanager/types"
+	"github.com/prometheus/common/model"
 )
 
-// ErrNotFound is returned if a Store cannot find the Alert.
-var ErrNotFound = errors.New("alert not found")
+var (
+	// ErrNotFound is returned if a Store cannot find the Alert.
+	ErrNotFound = errors.New("alert not found")
+)
 
 // Alerts provides lock-coordinated to an in-memory map of alerts, keyed by
 // their fingerprint. Resolved alerts are removed from the map based on
diff --git a/vendor/github.com/prometheus/alertmanager/template/template.go b/vendor/github.com/prometheus/alertmanager/template/template.go
index 3882187f3a..2c1b62db3f 100644
--- a/vendor/github.com/prometheus/alertmanager/template/template.go
+++ b/vendor/github.com/prometheus/alertmanager/template/template.go
@@ -16,7 +16,7 @@ package template
 import (
 	"bytes"
 	tmplhtml "html/template"
-	"io"
+	"io/ioutil"
 	"net/url"
 	"path"
 	"path/filepath"
@@ -27,8 +27,6 @@ import (
 	"time"
 
 	"github.com/prometheus/common/model"
-	"golang.org/x/text/cases"
-	"golang.org/x/text/language"
 
 	"github.com/prometheus/alertmanager/asset"
 	"github.com/prometheus/alertmanager/types"
@@ -61,7 +59,7 @@ func FromGlobs(paths ...string) (*Template, error) {
 			return nil, err
 		}
 		defer f.Close()
-		b, err := io.ReadAll(f)
+		b, err := ioutil.ReadAll(f)
 		if err != nil {
 			return nil, err
 		}
@@ -134,7 +132,7 @@ type FuncMap map[string]interface{}
 var DefaultFuncs = FuncMap{
 	"toUpper": strings.ToUpper,
 	"toLower": strings.ToLower,
-	"title":   cases.Title(language.AmericanEnglish).String,
+	"title":   strings.Title,
 	// join is equal to strings.Join but inverts the argument order
 	// for easier pipelining in templates.
 	"join": func(sep string, s []string) string {
diff --git a/vendor/github.com/prometheus/alertmanager/timeinterval/timeinterval.go b/vendor/github.com/prometheus/alertmanager/timeinterval/timeinterval.go
index 7d1586ac26..24c4a4ea03 100644
--- a/vendor/github.com/prometheus/alertmanager/timeinterval/timeinterval.go
+++ b/vendor/github.com/prometheus/alertmanager/timeinterval/timeinterval.go
@@ -125,7 +125,6 @@ var daysOfWeek = map[string]int{
 	"friday":    5,
 	"saturday":  6,
 }
-
 var daysOfWeekInv = map[int]string{
 	0: "sunday",
 	1: "monday",
@@ -317,7 +316,7 @@ func (r WeekdayRange) MarshalYAML() (interface{}, error) {
 }
 
 // MarshalText implements the econding.TextMarshaler interface for WeekdayRange.
-// It converts the range into a colon-separated string, or a single weekday if possible.
+// It converts the range into a colon-seperated string, or a single weekday if possible.
 // e.g. "monday:friday" or "saturday".
 func (r WeekdayRange) MarshalText() ([]byte, error) {
 	beginStr, ok := daysOfWeekInv[r.Begin]
@@ -374,7 +373,7 @@ func (ir InclusiveRange) MarshalText() ([]byte, error) {
 	return []byte(out), nil
 }
 
-// MarshalYAML implements the yaml.Marshaler interface for InclusiveRange.
+//MarshalYAML implements the yaml.Marshaler interface for InclusiveRange.
 func (ir InclusiveRange) MarshalYAML() (interface{}, error) {
 	bytes, err := ir.MarshalText()
 	return string(bytes), err
@@ -383,10 +382,8 @@ func (ir InclusiveRange) MarshalYAML() (interface{}, error) {
 // TimeLayout specifies the layout to be used in time.Parse() calls for time intervals.
 const TimeLayout = "15:04"
 
-var (
-	validTime   = "^((([01][0-9])|(2[0-3])):[0-5][0-9])$|(^24:00$)"
-	validTimeRE = regexp.MustCompile(validTime)
-)
+var validTime string = "^((([01][0-9])|(2[0-3])):[0-5][0-9])$|(^24:00$)"
+var validTimeRE *regexp.Regexp = regexp.MustCompile(validTime)
 
 // Given a time, determines the number of days in the month that time occurs in.
 func daysInMonth(t time.Time) int {
diff --git a/vendor/github.com/prometheus/alertmanager/types/types.go b/vendor/github.com/prometheus/alertmanager/types/types.go
index f3101f8234..a412453d3a 100644
--- a/vendor/github.com/prometheus/alertmanager/types/types.go
+++ b/vendor/github.com/prometheus/alertmanager/types/types.go
@@ -18,10 +18,9 @@ import (
 	"sync"
 	"time"
 
+	"github.com/prometheus/alertmanager/pkg/labels"
 	"github.com/prometheus/client_golang/prometheus"
 	"github.com/prometheus/common/model"
-
-	"github.com/prometheus/alertmanager/pkg/labels"
 )
 
 // AlertState is used as part of AlertStatus.
@@ -53,18 +52,18 @@ type AlertStatus struct {
 // Marker helps to mark alerts as silenced and/or inhibited.
 // All methods are goroutine-safe.
 type Marker interface {
-	// SetActiveOrSilenced replaces the previous SilencedBy by the provided IDs of
+	// SetSilenced replaces the previous SilencedBy by the provided IDs of
 	// active and pending silences, including the version number of the
 	// silences state. The set of provided IDs is supposed to represent the
 	// complete set of relevant silences. If no active silence IDs are provided and
 	// InhibitedBy is already empty, it sets the provided alert to AlertStateActive.
 	// Otherwise, it sets the provided alert to AlertStateSuppressed.
-	SetActiveOrSilenced(alert model.Fingerprint, version int, activeSilenceIDs, pendingSilenceIDs []string)
+	SetSilenced(alert model.Fingerprint, version int, activeSilenceIDs []string, pendingSilenceIDs []string)
 	// SetInhibited replaces the previous InhibitedBy by the provided IDs of
-	// alerts. In contrast to SetActiveOrSilenced, the set of provided IDs is not
+	// alerts. In contrast to SetSilenced, the set of provided IDs is not
 	// expected to represent the complete set of inhibiting alerts. (In
 	// practice, this method is only called with one or zero IDs. However,
-	// this expectation might change in the future. If no IDs are provided
+	// this expectation might change in the future.) If no IDs are provided
 	// and InhibitedBy is already empty, it sets the provided alert to
 	// AlertStateActive. Otherwise, it sets the provided alert to
 	// AlertStateSuppressed.
@@ -86,7 +85,7 @@ type Marker interface {
 	// result is based on.
 	Unprocessed(model.Fingerprint) bool
 	Active(model.Fingerprint) bool
-	Silenced(model.Fingerprint) (activeIDs, pendingIDs []string, version int, silenced bool)
+	Silenced(model.Fingerprint) (activeIDs []string, pendingIDs []string, version int, silenced bool)
 	Inhibited(model.Fingerprint) ([]string, bool)
 }
 
@@ -108,11 +107,11 @@ type memMarker struct {
 }
 
 func (m *memMarker) registerMetrics(r prometheus.Registerer) {
-	newMarkedAlertMetricByState := func(st AlertState) prometheus.GaugeFunc {
+	newAlertMetricByState := func(st AlertState) prometheus.GaugeFunc {
 		return prometheus.NewGaugeFunc(
 			prometheus.GaugeOpts{
-				Name:        "alertmanager_marked_alerts",
-				Help:        "How many alerts by state are currently marked in the Alertmanager regardless of their expiry.",
+				Name:        "alertmanager_alerts",
+				Help:        "How many alerts by state.",
 				ConstLabels: prometheus.Labels{"state": string(st)},
 			},
 			func() float64 {
@@ -121,13 +120,11 @@ func (m *memMarker) registerMetrics(r prometheus.Registerer) {
 		)
 	}
 
-	alertsActive := newMarkedAlertMetricByState(AlertStateActive)
-	alertsSuppressed := newMarkedAlertMetricByState(AlertStateSuppressed)
-	alertStateUnprocessed := newMarkedAlertMetricByState(AlertStateUnprocessed)
+	alertsActive := newAlertMetricByState(AlertStateActive)
+	alertsSuppressed := newAlertMetricByState(AlertStateSuppressed)
 
 	r.MustRegister(alertsActive)
 	r.MustRegister(alertsSuppressed)
-	r.MustRegister(alertStateUnprocessed)
 }
 
 // Count implements Marker.
@@ -150,8 +147,8 @@ func (m *memMarker) Count(states ...AlertState) int {
 	return count
 }
 
-// SetActiveOrSilenced implements Marker.
-func (m *memMarker) SetActiveOrSilenced(alert model.Fingerprint, version int, activeIDs, pendingIDs []string) {
+// SetSilenced implements Marker.
+func (m *memMarker) SetSilenced(alert model.Fingerprint, version int, activeIDs []string, pendingIDs []string) {
 	m.mtx.Lock()
 	defer m.mtx.Unlock()
 
@@ -241,7 +238,7 @@ func (m *memMarker) Inhibited(alert model.Fingerprint) ([]string, bool) {
 // Silenced returns whether the alert for the given Fingerprint is in the
 // Silenced state, any associated silence IDs, and the silences state version
 // the result is based on.
-func (m *memMarker) Silenced(alert model.Fingerprint) (activeIDs, pendingIDs []string, version int, silenced bool) {
+func (m *memMarker) Silenced(alert model.Fingerprint) (activeIDs []string, pendingIDs []string, version int, silenced bool) {
 	s := m.Status(alert)
 	return s.SilencedBy, s.pendingSilences, s.silencesVersion,
 		s.State == AlertStateSuppressed && len(s.SilencedBy) > 0
diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go
deleted file mode 100644
index 752cdf0316..0000000000
--- a/vendor/golang.org/x/text/cases/cases.go
+++ /dev/null
@@ -1,162 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:generate go run gen.go gen_trieval.go
-
-// Package cases provides general and language-specific case mappers.
-package cases // import "golang.org/x/text/cases"
-
-import (
-	"golang.org/x/text/language"
-	"golang.org/x/text/transform"
-)
-
-// References:
-// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18.
-// - https://www.unicode.org/reports/tr29/
-// - https://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt
-// - https://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt
-// - https://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt
-// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt
-// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt
-// - http://userguide.icu-project.org/transforms/casemappings
-
-// TODO:
-// - Case folding
-// - Wide and Narrow?
-// - Segmenter option for title casing.
-// - ASCII fast paths
-// - Encode Soft-Dotted property within trie somehow.
-
-// A Caser transforms given input to a certain case. It implements
-// transform.Transformer.
-//
-// A Caser may be stateful and should therefore not be shared between
-// goroutines.
-type Caser struct {
-	t transform.SpanningTransformer
-}
-
-// Bytes returns a new byte slice with the result of converting b to the case
-// form implemented by c.
-func (c Caser) Bytes(b []byte) []byte {
-	b, _, _ = transform.Bytes(c.t, b)
-	return b
-}
-
-// String returns a string with the result of transforming s to the case form
-// implemented by c.
-func (c Caser) String(s string) string {
-	s, _, _ = transform.String(c.t, s)
-	return s
-}
-
-// Reset resets the Caser to be reused for new input after a previous call to
-// Transform.
-func (c Caser) Reset() { c.t.Reset() }
-
-// Transform implements the transform.Transformer interface and transforms the
-// given input to the case form implemented by c.
-func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	return c.t.Transform(dst, src, atEOF)
-}
-
-// Span implements the transform.SpanningTransformer interface.
-func (c Caser) Span(src []byte, atEOF bool) (n int, err error) {
-	return c.t.Span(src, atEOF)
-}
-
-// Upper returns a Caser for language-specific uppercasing.
-func Upper(t language.Tag, opts ...Option) Caser {
-	return Caser{makeUpper(t, getOpts(opts...))}
-}
-
-// Lower returns a Caser for language-specific lowercasing.
-func Lower(t language.Tag, opts ...Option) Caser {
-	return Caser{makeLower(t, getOpts(opts...))}
-}
-
-// Title returns a Caser for language-specific title casing. It uses an
-// approximation of the default Unicode Word Break algorithm.
-func Title(t language.Tag, opts ...Option) Caser {
-	return Caser{makeTitle(t, getOpts(opts...))}
-}
-
-// Fold returns a Caser that implements Unicode case folding. The returned Caser
-// is stateless and safe to use concurrently by multiple goroutines.
-//
-// Case folding does not normalize the input and may not preserve a normal form.
-// Use the collate or search package for more convenient and linguistically
-// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons
-// where security aspects are a concern.
-func Fold(opts ...Option) Caser {
-	return Caser{makeFold(getOpts(opts...))}
-}
-
-// An Option is used to modify the behavior of a Caser.
-type Option func(o options) options
-
-// TODO: consider these options to take a boolean as well, like FinalSigma.
-// The advantage of using this approach is that other providers of a lower-case
-// algorithm could set different defaults by prefixing a user-provided slice
-// of options with their own. This is handy, for instance, for the precis
-// package which would override the default to not handle the Greek final sigma.
-
-var (
-	// NoLower disables the lowercasing of non-leading letters for a title
-	// caser.
-	NoLower Option = noLower
-
-	// Compact omits mappings in case folding for characters that would grow the
-	// input. (Unimplemented.)
-	Compact Option = compact
-)
-
-// TODO: option to preserve a normal form, if applicable?
-
-type options struct {
-	noLower bool
-	simple  bool
-
-	// TODO: segmenter, max ignorable, alternative versions, etc.
-
-	ignoreFinalSigma bool
-}
-
-func getOpts(o ...Option) (res options) {
-	for _, f := range o {
-		res = f(res)
-	}
-	return
-}
-
-func noLower(o options) options {
-	o.noLower = true
-	return o
-}
-
-func compact(o options) options {
-	o.simple = true
-	return o
-}
-
-// HandleFinalSigma specifies whether the special handling of Greek final sigma
-// should be enabled. Unicode prescribes handling the Greek final sigma for all
-// locales, but standards like IDNA and PRECIS override this default.
-func HandleFinalSigma(enable bool) Option {
-	if enable {
-		return handleFinalSigma
-	}
-	return ignoreFinalSigma
-}
-
-func ignoreFinalSigma(o options) options {
-	o.ignoreFinalSigma = true
-	return o
-}
-
-func handleFinalSigma(o options) options {
-	o.ignoreFinalSigma = false
-	return o
-}
diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go
deleted file mode 100644
index e9aa9e1936..0000000000
--- a/vendor/golang.org/x/text/cases/context.go
+++ /dev/null
@@ -1,376 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package cases
-
-import "golang.org/x/text/transform"
-
-// A context is used for iterating over source bytes, fetching case info and
-// writing to a destination buffer.
-//
-// Casing operations may need more than one rune of context to decide how a rune
-// should be cased. Casing implementations should call checkpoint on context
-// whenever it is known to be safe to return the runes processed so far.
-//
-// It is recommended for implementations to not allow for more than 30 case
-// ignorables as lookahead (analogous to the limit in norm) and to use state if
-// unbounded lookahead is needed for cased runes.
-type context struct {
-	dst, src []byte
-	atEOF    bool
-
-	pDst int // pDst points past the last written rune in dst.
-	pSrc int // pSrc points to the start of the currently scanned rune.
-
-	// checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc.
-	nDst, nSrc int
-	err        error
-
-	sz   int  // size of current rune
-	info info // case information of currently scanned rune
-
-	// State preserved across calls to Transform.
-	isMidWord bool // false if next cased letter needs to be title-cased.
-}
-
-func (c *context) Reset() {
-	c.isMidWord = false
-}
-
-// ret returns the return values for the Transform method. It checks whether
-// there were insufficient bytes in src to complete and introduces an error
-// accordingly, if necessary.
-func (c *context) ret() (nDst, nSrc int, err error) {
-	if c.err != nil || c.nSrc == len(c.src) {
-		return c.nDst, c.nSrc, c.err
-	}
-	// This point is only reached by mappers if there was no short destination
-	// buffer. This means that the source buffer was exhausted and that c.sz was
-	// set to 0 by next.
-	if c.atEOF && c.pSrc == len(c.src) {
-		return c.pDst, c.pSrc, nil
-	}
-	return c.nDst, c.nSrc, transform.ErrShortSrc
-}
-
-// retSpan returns the return values for the Span method. It checks whether
-// there were insufficient bytes in src to complete and introduces an error
-// accordingly, if necessary.
-func (c *context) retSpan() (n int, err error) {
-	_, nSrc, err := c.ret()
-	return nSrc, err
-}
-
-// checkpoint sets the return value buffer points for Transform to the current
-// positions.
-func (c *context) checkpoint() {
-	if c.err == nil {
-		c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz
-	}
-}
-
-// unreadRune causes the last rune read by next to be reread on the next
-// invocation of next. Only one unreadRune may be called after a call to next.
-func (c *context) unreadRune() {
-	c.sz = 0
-}
-
-func (c *context) next() bool {
-	c.pSrc += c.sz
-	if c.pSrc == len(c.src) || c.err != nil {
-		c.info, c.sz = 0, 0
-		return false
-	}
-	v, sz := trie.lookup(c.src[c.pSrc:])
-	c.info, c.sz = info(v), sz
-	if c.sz == 0 {
-		if c.atEOF {
-			// A zero size means we have an incomplete rune. If we are atEOF,
-			// this means it is an illegal rune, which we will consume one
-			// byte at a time.
-			c.sz = 1
-		} else {
-			c.err = transform.ErrShortSrc
-			return false
-		}
-	}
-	return true
-}
-
-// writeBytes adds bytes to dst.
-func (c *context) writeBytes(b []byte) bool {
-	if len(c.dst)-c.pDst < len(b) {
-		c.err = transform.ErrShortDst
-		return false
-	}
-	// This loop is faster than using copy.
-	for _, ch := range b {
-		c.dst[c.pDst] = ch
-		c.pDst++
-	}
-	return true
-}
-
-// writeString writes the given string to dst.
-func (c *context) writeString(s string) bool {
-	if len(c.dst)-c.pDst < len(s) {
-		c.err = transform.ErrShortDst
-		return false
-	}
-	// This loop is faster than using copy.
-	for i := 0; i < len(s); i++ {
-		c.dst[c.pDst] = s[i]
-		c.pDst++
-	}
-	return true
-}
-
-// copy writes the current rune to dst.
-func (c *context) copy() bool {
-	return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz])
-}
-
-// copyXOR copies the current rune to dst and modifies it by applying the XOR
-// pattern of the case info. It is the responsibility of the caller to ensure
-// that this is a rune with a XOR pattern defined.
-func (c *context) copyXOR() bool {
-	if !c.copy() {
-		return false
-	}
-	if c.info&xorIndexBit == 0 {
-		// Fast path for 6-bit XOR pattern, which covers most cases.
-		c.dst[c.pDst-1] ^= byte(c.info >> xorShift)
-	} else {
-		// Interpret XOR bits as an index.
-		// TODO: test performance for unrolling this loop. Verify that we have
-		// at least two bytes and at most three.
-		idx := c.info >> xorShift
-		for p := c.pDst - 1; ; p-- {
-			c.dst[p] ^= xorData[idx]
-			idx--
-			if xorData[idx] == 0 {
-				break
-			}
-		}
-	}
-	return true
-}
-
-// hasPrefix returns true if src[pSrc:] starts with the given string.
-func (c *context) hasPrefix(s string) bool {
-	b := c.src[c.pSrc:]
-	if len(b) < len(s) {
-		return false
-	}
-	for i, c := range b[:len(s)] {
-		if c != s[i] {
-			return false
-		}
-	}
-	return true
-}
-
-// caseType returns an info with only the case bits, normalized to either
-// cLower, cUpper, cTitle or cUncased.
-func (c *context) caseType() info {
-	cm := c.info & 0x7
-	if cm < 4 {
-		return cm
-	}
-	if cm >= cXORCase {
-		// xor the last bit of the rune with the case type bits.
-		b := c.src[c.pSrc+c.sz-1]
-		return info(b&1) ^ cm&0x3
-	}
-	if cm == cIgnorableCased {
-		return cLower
-	}
-	return cUncased
-}
-
-// lower writes the lowercase version of the current rune to dst.
-func lower(c *context) bool {
-	ct := c.caseType()
-	if c.info&hasMappingMask == 0 || ct == cLower {
-		return c.copy()
-	}
-	if c.info&exceptionBit == 0 {
-		return c.copyXOR()
-	}
-	e := exceptions[c.info>>exceptionShift:]
-	offset := 2 + e[0]&lengthMask // size of header + fold string
-	if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange {
-		return c.writeString(e[offset : offset+nLower])
-	}
-	return c.copy()
-}
-
-func isLower(c *context) bool {
-	ct := c.caseType()
-	if c.info&hasMappingMask == 0 || ct == cLower {
-		return true
-	}
-	if c.info&exceptionBit == 0 {
-		c.err = transform.ErrEndOfSpan
-		return false
-	}
-	e := exceptions[c.info>>exceptionShift:]
-	if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange {
-		c.err = transform.ErrEndOfSpan
-		return false
-	}
-	return true
-}
-
-// upper writes the uppercase version of the current rune to dst.
-func upper(c *context) bool {
-	ct := c.caseType()
-	if c.info&hasMappingMask == 0 || ct == cUpper {
-		return c.copy()
-	}
-	if c.info&exceptionBit == 0 {
-		return c.copyXOR()
-	}
-	e := exceptions[c.info>>exceptionShift:]
-	offset := 2 + e[0]&lengthMask // size of header + fold string
-	// Get length of first special case mapping.
-	n := (e[1] >> lengthBits) & lengthMask
-	if ct == cTitle {
-		// The first special case mapping is for lower. Set n to the second.
-		if n == noChange {
-			n = 0
-		}
-		n, e = e[1]&lengthMask, e[n:]
-	}
-	if n != noChange {
-		return c.writeString(e[offset : offset+n])
-	}
-	return c.copy()
-}
-
-// isUpper writes the isUppercase version of the current rune to dst.
-func isUpper(c *context) bool {
-	ct := c.caseType()
-	if c.info&hasMappingMask == 0 || ct == cUpper {
-		return true
-	}
-	if c.info&exceptionBit == 0 {
-		c.err = transform.ErrEndOfSpan
-		return false
-	}
-	e := exceptions[c.info>>exceptionShift:]
-	// Get length of first special case mapping.
-	n := (e[1] >> lengthBits) & lengthMask
-	if ct == cTitle {
-		n = e[1] & lengthMask
-	}
-	if n != noChange {
-		c.err = transform.ErrEndOfSpan
-		return false
-	}
-	return true
-}
-
-// title writes the title case version of the current rune to dst.
-func title(c *context) bool {
-	ct := c.caseType()
-	if c.info&hasMappingMask == 0 || ct == cTitle {
-		return c.copy()
-	}
-	if c.info&exceptionBit == 0 {
-		if ct == cLower {
-			return c.copyXOR()
-		}
-		return c.copy()
-	}
-	// Get the exception data.
-	e := exceptions[c.info>>exceptionShift:]
-	offset := 2 + e[0]&lengthMask // size of header + fold string
-
-	nFirst := (e[1] >> lengthBits) & lengthMask
-	if nTitle := e[1] & lengthMask; nTitle != noChange {
-		if nFirst != noChange {
-			e = e[nFirst:]
-		}
-		return c.writeString(e[offset : offset+nTitle])
-	}
-	if ct == cLower && nFirst != noChange {
-		// Use the uppercase version instead.
-		return c.writeString(e[offset : offset+nFirst])
-	}
-	// Already in correct case.
-	return c.copy()
-}
-
-// isTitle reports whether the current rune is in title case.
-func isTitle(c *context) bool {
-	ct := c.caseType()
-	if c.info&hasMappingMask == 0 || ct == cTitle {
-		return true
-	}
-	if c.info&exceptionBit == 0 {
-		if ct == cLower {
-			c.err = transform.ErrEndOfSpan
-			return false
-		}
-		return true
-	}
-	// Get the exception data.
-	e := exceptions[c.info>>exceptionShift:]
-	if nTitle := e[1] & lengthMask; nTitle != noChange {
-		c.err = transform.ErrEndOfSpan
-		return false
-	}
-	nFirst := (e[1] >> lengthBits) & lengthMask
-	if ct == cLower && nFirst != noChange {
-		c.err = transform.ErrEndOfSpan
-		return false
-	}
-	return true
-}
-
-// foldFull writes the foldFull version of the current rune to dst.
-func foldFull(c *context) bool {
-	if c.info&hasMappingMask == 0 {
-		return c.copy()
-	}
-	ct := c.caseType()
-	if c.info&exceptionBit == 0 {
-		if ct != cLower || c.info&inverseFoldBit != 0 {
-			return c.copyXOR()
-		}
-		return c.copy()
-	}
-	e := exceptions[c.info>>exceptionShift:]
-	n := e[0] & lengthMask
-	if n == 0 {
-		if ct == cLower {
-			return c.copy()
-		}
-		n = (e[1] >> lengthBits) & lengthMask
-	}
-	return c.writeString(e[2 : 2+n])
-}
-
-// isFoldFull reports whether the current run is mapped to foldFull
-func isFoldFull(c *context) bool {
-	if c.info&hasMappingMask == 0 {
-		return true
-	}
-	ct := c.caseType()
-	if c.info&exceptionBit == 0 {
-		if ct != cLower || c.info&inverseFoldBit != 0 {
-			c.err = transform.ErrEndOfSpan
-			return false
-		}
-		return true
-	}
-	e := exceptions[c.info>>exceptionShift:]
-	n := e[0] & lengthMask
-	if n == 0 && ct == cLower {
-		return true
-	}
-	c.err = transform.ErrEndOfSpan
-	return false
-}
diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go
deleted file mode 100644
index 85cc434fac..0000000000
--- a/vendor/golang.org/x/text/cases/fold.go
+++ /dev/null
@@ -1,34 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package cases
-
-import "golang.org/x/text/transform"
-
-type caseFolder struct{ transform.NopResetter }
-
-// caseFolder implements the Transformer interface for doing case folding.
-func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	c := context{dst: dst, src: src, atEOF: atEOF}
-	for c.next() {
-		foldFull(&c)
-		c.checkpoint()
-	}
-	return c.ret()
-}
-
-func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) {
-	c := context{src: src, atEOF: atEOF}
-	for c.next() && isFoldFull(&c) {
-		c.checkpoint()
-	}
-	return c.retSpan()
-}
-
-func makeFold(o options) transform.SpanningTransformer {
-	// TODO: Special case folding, through option Language, Special/Turkic, or
-	// both.
-	// TODO: Implement Compact options.
-	return &caseFolder{}
-}
diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go
deleted file mode 100644
index 2dc84b39ef..0000000000
--- a/vendor/golang.org/x/text/cases/icu.go
+++ /dev/null
@@ -1,62 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build icu
-// +build icu
-
-package cases
-
-// Ideally these functions would be defined in a test file, but go test doesn't
-// allow CGO in tests. The build tag should ensure either way that these
-// functions will not end up in the package.
-
-// TODO: Ensure that the correct ICU version is set.
-
-/*
-#cgo LDFLAGS: -licui18n.57 -licuuc.57
-#include <stdlib.h>
-#include <unicode/ustring.h>
-#include <unicode/utypes.h>
-#include <unicode/localpointer.h>
-#include <unicode/ucasemap.h>
-*/
-import "C"
-
-import "unsafe"
-
-func doICU(tag, caser, input string) string {
-	err := C.UErrorCode(0)
-	loc := C.CString(tag)
-	cm := C.ucasemap_open(loc, C.uint32_t(0), &err)
-
-	buf := make([]byte, len(input)*4)
-	dst := (*C.char)(unsafe.Pointer(&buf[0]))
-	src := C.CString(input)
-
-	cn := C.int32_t(0)
-
-	switch caser {
-	case "fold":
-		cn = C.ucasemap_utf8FoldCase(cm,
-			dst, C.int32_t(len(buf)),
-			src, C.int32_t(len(input)),
-			&err)
-	case "lower":
-		cn = C.ucasemap_utf8ToLower(cm,
-			dst, C.int32_t(len(buf)),
-			src, C.int32_t(len(input)),
-			&err)
-	case "upper":
-		cn = C.ucasemap_utf8ToUpper(cm,
-			dst, C.int32_t(len(buf)),
-			src, C.int32_t(len(input)),
-			&err)
-	case "title":
-		cn = C.ucasemap_utf8ToTitle(cm,
-			dst, C.int32_t(len(buf)),
-			src, C.int32_t(len(input)),
-			&err)
-	}
-	return string(buf[:cn])
-}
diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go
deleted file mode 100644
index 87a7c3e955..0000000000
--- a/vendor/golang.org/x/text/cases/info.go
+++ /dev/null
@@ -1,82 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package cases
-
-func (c info) cccVal() info {
-	if c&exceptionBit != 0 {
-		return info(exceptions[c>>exceptionShift]) & cccMask
-	}
-	return c & cccMask
-}
-
-func (c info) cccType() info {
-	ccc := c.cccVal()
-	if ccc <= cccZero {
-		return cccZero
-	}
-	return ccc
-}
-
-// TODO: Implement full Unicode breaking algorithm:
-// 1) Implement breaking in separate package.
-// 2) Use the breaker here.
-// 3) Compare table size and performance of using the more generic breaker.
-//
-// Note that we can extend the current algorithm to be much more accurate. This
-// only makes sense, though, if the performance and/or space penalty of using
-// the generic breaker is big. Extra data will only be needed for non-cased
-// runes, which means there are sufficient bits left in the caseType.
-// ICU prohibits breaking in such cases as well.
-
-// For the purpose of title casing we use an approximation of the Unicode Word
-// Breaking algorithm defined in Annex #29:
-// https://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table.
-//
-// For our approximation, we group the Word Break types into the following
-// categories, with associated rules:
-//
-// 1) Letter:
-//    ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ.
-//    Rule: Never break between consecutive runes of this category.
-//
-// 2) Mid:
-//    MidLetter, MidNumLet, Single_Quote.
-//    (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn,
-//    Me, Cf, Lm or Sk).
-//    Rule: Don't break between Letter and Mid, but break between two Mids.
-//
-// 3) Break:
-//    Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and
-//    Other.
-//    These categories should always result in a break between two cased letters.
-//    Rule: Always break.
-//
-// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in
-// preventing a break between two cased letters. For now we will ignore this
-// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and
-// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].)
-//
-// Note 2: the rule for Mid is very approximate, but works in most cases. To
-// improve, we could store the categories in the trie value and use a FA to
-// manage breaks. See TODO comment above.
-//
-// Note 3: according to the spec, it is possible for the Extend category to
-// introduce breaks between other categories grouped in Letter. However, this
-// is undesirable for our purposes. ICU prevents breaks in such cases as well.
-
-// isBreak returns whether this rune should introduce a break.
-func (c info) isBreak() bool {
-	return c.cccVal() == cccBreak
-}
-
-// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter,
-// Numeric, ExtendNumLet, or Extend.
-func (c info) isLetter() bool {
-	ccc := c.cccVal()
-	if ccc == cccZero {
-		return !c.isCaseIgnorable()
-	}
-	return ccc != cccBreak
-}
diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go
deleted file mode 100644
index 0f7c6a14bb..0000000000
--- a/vendor/golang.org/x/text/cases/map.go
+++ /dev/null
@@ -1,816 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package cases
-
-// This file contains the definitions of case mappings for all supported
-// languages. The rules for the language-specific tailorings were taken and
-// modified from the CLDR transform definitions in common/transforms.
-
-import (
-	"strings"
-	"unicode"
-	"unicode/utf8"
-
-	"golang.org/x/text/internal"
-	"golang.org/x/text/language"
-	"golang.org/x/text/transform"
-	"golang.org/x/text/unicode/norm"
-)
-
-// A mapFunc takes a context set to the current rune and writes the mapped
-// version to the same context. It may advance the context to the next rune. It
-// returns whether a checkpoint is possible: whether the pDst bytes written to
-// dst so far won't need changing as we see more source bytes.
-type mapFunc func(*context) bool
-
-// A spanFunc takes a context set to the current rune and returns whether this
-// rune would be altered when written to the output. It may advance the context
-// to the next rune. It returns whether a checkpoint is possible.
-type spanFunc func(*context) bool
-
-// maxIgnorable defines the maximum number of ignorables to consider for
-// lookahead operations.
-const maxIgnorable = 30
-
-// supported lists the language tags for which we have tailorings.
-const supported = "und af az el lt nl tr"
-
-func init() {
-	tags := []language.Tag{}
-	for _, s := range strings.Split(supported, " ") {
-		tags = append(tags, language.MustParse(s))
-	}
-	matcher = internal.NewInheritanceMatcher(tags)
-	Supported = language.NewCoverage(tags)
-}
-
-var (
-	matcher *internal.InheritanceMatcher
-
-	Supported language.Coverage
-
-	// We keep the following lists separate, instead of having a single per-
-	// language struct, to give the compiler a chance to remove unused code.
-
-	// Some uppercase mappers are stateless, so we can precompute the
-	// Transformers and save a bit on runtime allocations.
-	upperFunc = []struct {
-		upper mapFunc
-		span  spanFunc
-	}{
-		{nil, nil},                  // und
-		{nil, nil},                  // af
-		{aztrUpper(upper), isUpper}, // az
-		{elUpper, noSpan},           // el
-		{ltUpper(upper), noSpan},    // lt
-		{nil, nil},                  // nl
-		{aztrUpper(upper), isUpper}, // tr
-	}
-
-	undUpper            transform.SpanningTransformer = &undUpperCaser{}
-	undLower            transform.SpanningTransformer = &undLowerCaser{}
-	undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{}
-
-	lowerFunc = []mapFunc{
-		nil,       // und
-		nil,       // af
-		aztrLower, // az
-		nil,       // el
-		ltLower,   // lt
-		nil,       // nl
-		aztrLower, // tr
-	}
-
-	titleInfos = []struct {
-		title     mapFunc
-		lower     mapFunc
-		titleSpan spanFunc
-		rewrite   func(*context)
-	}{
-		{title, lower, isTitle, nil},                // und
-		{title, lower, isTitle, afnlRewrite},        // af
-		{aztrUpper(title), aztrLower, isTitle, nil}, // az
-		{title, lower, isTitle, nil},                // el
-		{ltUpper(title), ltLower, noSpan, nil},      // lt
-		{nlTitle, lower, nlTitleSpan, afnlRewrite},  // nl
-		{aztrUpper(title), aztrLower, isTitle, nil}, // tr
-	}
-)
-
-func makeUpper(t language.Tag, o options) transform.SpanningTransformer {
-	_, i, _ := matcher.Match(t)
-	f := upperFunc[i].upper
-	if f == nil {
-		return undUpper
-	}
-	return &simpleCaser{f: f, span: upperFunc[i].span}
-}
-
-func makeLower(t language.Tag, o options) transform.SpanningTransformer {
-	_, i, _ := matcher.Match(t)
-	f := lowerFunc[i]
-	if f == nil {
-		if o.ignoreFinalSigma {
-			return undLowerIgnoreSigma
-		}
-		return undLower
-	}
-	if o.ignoreFinalSigma {
-		return &simpleCaser{f: f, span: isLower}
-	}
-	return &lowerCaser{
-		first:   f,
-		midWord: finalSigma(f),
-	}
-}
-
-func makeTitle(t language.Tag, o options) transform.SpanningTransformer {
-	_, i, _ := matcher.Match(t)
-	x := &titleInfos[i]
-	lower := x.lower
-	if o.noLower {
-		lower = (*context).copy
-	} else if !o.ignoreFinalSigma {
-		lower = finalSigma(lower)
-	}
-	return &titleCaser{
-		title:     x.title,
-		lower:     lower,
-		titleSpan: x.titleSpan,
-		rewrite:   x.rewrite,
-	}
-}
-
-func noSpan(c *context) bool {
-	c.err = transform.ErrEndOfSpan
-	return false
-}
-
-// TODO: consider a similar special case for the fast majority lower case. This
-// is a bit more involved so will require some more precise benchmarking to
-// justify it.
-
-type undUpperCaser struct{ transform.NopResetter }
-
-// undUpperCaser implements the Transformer interface for doing an upper case
-// mapping for the root locale (und). It eliminates the need for an allocation
-// as it prevents escaping by not using function pointers.
-func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	c := context{dst: dst, src: src, atEOF: atEOF}
-	for c.next() {
-		upper(&c)
-		c.checkpoint()
-	}
-	return c.ret()
-}
-
-func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) {
-	c := context{src: src, atEOF: atEOF}
-	for c.next() && isUpper(&c) {
-		c.checkpoint()
-	}
-	return c.retSpan()
-}
-
-// undLowerIgnoreSigmaCaser implements the Transformer interface for doing
-// a lower case mapping for the root locale (und) ignoring final sigma
-// handling. This casing algorithm is used in some performance-critical packages
-// like secure/precis and x/net/http/idna, which warrants its special-casing.
-type undLowerIgnoreSigmaCaser struct{ transform.NopResetter }
-
-func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	c := context{dst: dst, src: src, atEOF: atEOF}
-	for c.next() && lower(&c) {
-		c.checkpoint()
-	}
-	return c.ret()
-
-}
-
-// Span implements a generic lower-casing. This is possible as isLower works
-// for all lowercasing variants. All lowercase variants only vary in how they
-// transform a non-lowercase letter. They will never change an already lowercase
-// letter. In addition, there is no state.
-func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) {
-	c := context{src: src, atEOF: atEOF}
-	for c.next() && isLower(&c) {
-		c.checkpoint()
-	}
-	return c.retSpan()
-}
-
-type simpleCaser struct {
-	context
-	f    mapFunc
-	span spanFunc
-}
-
-// simpleCaser implements the Transformer interface for doing a case operation
-// on a rune-by-rune basis.
-func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	c := context{dst: dst, src: src, atEOF: atEOF}
-	for c.next() && t.f(&c) {
-		c.checkpoint()
-	}
-	return c.ret()
-}
-
-func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) {
-	c := context{src: src, atEOF: atEOF}
-	for c.next() && t.span(&c) {
-		c.checkpoint()
-	}
-	return c.retSpan()
-}
-
-// undLowerCaser implements the Transformer interface for doing a lower case
-// mapping for the root locale (und) ignoring final sigma handling. This casing
-// algorithm is used in some performance-critical packages like secure/precis
-// and x/net/http/idna, which warrants its special-casing.
-type undLowerCaser struct{ transform.NopResetter }
-
-func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	c := context{dst: dst, src: src, atEOF: atEOF}
-
-	for isInterWord := true; c.next(); {
-		if isInterWord {
-			if c.info.isCased() {
-				if !lower(&c) {
-					break
-				}
-				isInterWord = false
-			} else if !c.copy() {
-				break
-			}
-		} else {
-			if c.info.isNotCasedAndNotCaseIgnorable() {
-				if !c.copy() {
-					break
-				}
-				isInterWord = true
-			} else if !c.hasPrefix("Σ") {
-				if !lower(&c) {
-					break
-				}
-			} else if !finalSigmaBody(&c) {
-				break
-			}
-		}
-		c.checkpoint()
-	}
-	return c.ret()
-}
-
-func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) {
-	c := context{src: src, atEOF: atEOF}
-	for c.next() && isLower(&c) {
-		c.checkpoint()
-	}
-	return c.retSpan()
-}
-
-// lowerCaser implements the Transformer interface. The default Unicode lower
-// casing requires different treatment for the first and subsequent characters
-// of a word, most notably to handle the Greek final Sigma.
-type lowerCaser struct {
-	undLowerIgnoreSigmaCaser
-
-	context
-
-	first, midWord mapFunc
-}
-
-func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	t.context = context{dst: dst, src: src, atEOF: atEOF}
-	c := &t.context
-
-	for isInterWord := true; c.next(); {
-		if isInterWord {
-			if c.info.isCased() {
-				if !t.first(c) {
-					break
-				}
-				isInterWord = false
-			} else if !c.copy() {
-				break
-			}
-		} else {
-			if c.info.isNotCasedAndNotCaseIgnorable() {
-				if !c.copy() {
-					break
-				}
-				isInterWord = true
-			} else if !t.midWord(c) {
-				break
-			}
-		}
-		c.checkpoint()
-	}
-	return c.ret()
-}
-
-// titleCaser implements the Transformer interface. Title casing algorithms
-// distinguish between the first letter of a word and subsequent letters of the
-// same word. It uses state to avoid requiring a potentially infinite lookahead.
-type titleCaser struct {
-	context
-
-	// rune mappings used by the actual casing algorithms.
-	title     mapFunc
-	lower     mapFunc
-	titleSpan spanFunc
-
-	rewrite func(*context)
-}
-
-// Transform implements the standard Unicode title case algorithm as defined in
-// Chapter 3 of The Unicode Standard:
-// toTitlecase(X): Find the word boundaries in X according to Unicode Standard
-// Annex #29, "Unicode Text Segmentation." For each word boundary, find the
-// first cased character F following the word boundary. If F exists, map F to
-// Titlecase_Mapping(F); then map all characters C between F and the following
-// word boundary to Lowercase_Mapping(C).
-func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) {
-	t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord}
-	c := &t.context
-
-	if !c.next() {
-		return c.ret()
-	}
-
-	for {
-		p := c.info
-		if t.rewrite != nil {
-			t.rewrite(c)
-		}
-
-		wasMid := p.isMid()
-		// Break out of this loop on failure to ensure we do not modify the
-		// state incorrectly.
-		if p.isCased() {
-			if !c.isMidWord {
-				if !t.title(c) {
-					break
-				}
-				c.isMidWord = true
-			} else if !t.lower(c) {
-				break
-			}
-		} else if !c.copy() {
-			break
-		} else if p.isBreak() {
-			c.isMidWord = false
-		}
-
-		// As we save the state of the transformer, it is safe to call
-		// checkpoint after any successful write.
-		if !(c.isMidWord && wasMid) {
-			c.checkpoint()
-		}
-
-		if !c.next() {
-			break
-		}
-		if wasMid && c.info.isMid() {
-			c.isMidWord = false
-		}
-	}
-	return c.ret()
-}
-
-func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) {
-	t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord}
-	c := &t.context
-
-	if !c.next() {
-		return c.retSpan()
-	}
-
-	for {
-		p := c.info
-		if t.rewrite != nil {
-			t.rewrite(c)
-		}
-
-		wasMid := p.isMid()
-		// Break out of this loop on failure to ensure we do not modify the
-		// state incorrectly.
-		if p.isCased() {
-			if !c.isMidWord {
-				if !t.titleSpan(c) {
-					break
-				}
-				c.isMidWord = true
-			} else if !isLower(c) {
-				break
-			}
-		} else if p.isBreak() {
-			c.isMidWord = false
-		}
-		// As we save the state of the transformer, it is safe to call
-		// checkpoint after any successful write.
-		if !(c.isMidWord && wasMid) {
-			c.checkpoint()
-		}
-
-		if !c.next() {
-			break
-		}
-		if wasMid && c.info.isMid() {
-			c.isMidWord = false
-		}
-	}
-	return c.retSpan()
-}
-
-// finalSigma adds Greek final Sigma handing to another casing function. It
-// determines whether a lowercased sigma should be σ or ς, by looking ahead for
-// case-ignorables and a cased letters.
-func finalSigma(f mapFunc) mapFunc {
-	return func(c *context) bool {
-		if !c.hasPrefix("Σ") {
-			return f(c)
-		}
-		return finalSigmaBody(c)
-	}
-}
-
-func finalSigmaBody(c *context) bool {
-	// Current rune must be ∑.
-
-	// ::NFD();
-	// # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA
-	// Σ } [:case-ignorable:]* [:cased:] → σ;
-	// [:cased:] [:case-ignorable:]* { Σ → ς;
-	// ::Any-Lower;
-	// ::NFC();
-
-	p := c.pDst
-	c.writeString("ς")
-
-	// TODO: we should do this here, but right now this will never have an
-	// effect as this is called when the prefix is Sigma, whereas Dutch and
-	// Afrikaans only test for an apostrophe.
-	//
-	// if t.rewrite != nil {
-	// 	t.rewrite(c)
-	// }
-
-	// We need to do one more iteration after maxIgnorable, as a cased
-	// letter is not an ignorable and may modify the result.
-	wasMid := false
-	for i := 0; i < maxIgnorable+1; i++ {
-		if !c.next() {
-			return false
-		}
-		if !c.info.isCaseIgnorable() {
-			// All Midword runes are also case ignorable, so we are
-			// guaranteed to have a letter or word break here. As we are
-			// unreading the run, there is no need to unset c.isMidWord;
-			// the title caser will handle this.
-			if c.info.isCased() {
-				// p+1 is guaranteed to be in bounds: if writing ς was
-				// successful, p+1 will contain the second byte of ς. If not,
-				// this function will have returned after c.next returned false.
-				c.dst[p+1]++ // ς → σ
-			}
-			c.unreadRune()
-			return true
-		}
-		// A case ignorable may also introduce a word break, so we may need
-		// to continue searching even after detecting a break.
-		isMid := c.info.isMid()
-		if (wasMid && isMid) || c.info.isBreak() {
-			c.isMidWord = false
-		}
-		wasMid = isMid
-		c.copy()
-	}
-	return true
-}
-
-// finalSigmaSpan would be the same as isLower.
-
-// elUpper implements Greek upper casing, which entails removing a predefined
-// set of non-blocked modifiers. Note that these accents should not be removed
-// for title casing!
-// Example: "Οδός" -> "ΟΔΟΣ".
-func elUpper(c *context) bool {
-	// From CLDR:
-	// [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ;
-	// [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ;
-
-	r, _ := utf8.DecodeRune(c.src[c.pSrc:])
-	oldPDst := c.pDst
-	if !upper(c) {
-		return false
-	}
-	if !unicode.Is(unicode.Greek, r) {
-		return true
-	}
-	i := 0
-	// Take the properties of the uppercased rune that is already written to the
-	// destination. This saves us the trouble of having to uppercase the
-	// decomposed rune again.
-	if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil {
-		// Restore the destination position and process the decomposed rune.
-		r, sz := utf8.DecodeRune(b)
-		if r <= 0xFF { // See A.6.1
-			return true
-		}
-		c.pDst = oldPDst
-		// Insert the first rune and ignore the modifiers. See A.6.2.
-		c.writeBytes(b[:sz])
-		i = len(b[sz:]) / 2 // Greek modifiers are always of length 2.
-	}
-
-	for ; i < maxIgnorable && c.next(); i++ {
-		switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r {
-		// Above and Iota Subscript
-		case 0x0300, // U+0300 COMBINING GRAVE ACCENT
-			0x0301, // U+0301 COMBINING ACUTE ACCENT
-			0x0304, // U+0304 COMBINING MACRON
-			0x0306, // U+0306 COMBINING BREVE
-			0x0308, // U+0308 COMBINING DIAERESIS
-			0x0313, // U+0313 COMBINING COMMA ABOVE
-			0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE
-			0x0342, // U+0342 COMBINING GREEK PERISPOMENI
-			0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI
-			// No-op. Gobble the modifier.
-
-		default:
-			switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() {
-			case cccZero:
-				c.unreadRune()
-				return true
-
-			// We don't need to test for IotaSubscript as the only rune that
-			// qualifies (U+0345) was already excluded in the switch statement
-			// above. See A.4.
-
-			case cccAbove:
-				return c.copy()
-			default:
-				// Some other modifier. We're still allowed to gobble Greek
-				// modifiers after this.
-				c.copy()
-			}
-		}
-	}
-	return i == maxIgnorable
-}
-
-// TODO: implement elUpperSpan (low-priority: complex and infrequent).
-
-func ltLower(c *context) bool {
-	// From CLDR:
-	// # Introduce an explicit dot above when lowercasing capital I's and J's
-	// # whenever there are more accents above.
-	// # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek)
-	// # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I
-	// # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J
-	// # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK
-	// # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE
-	// # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE
-	// # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE
-	// ::NFD();
-	// I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307;
-	// J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307;
-	// I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307;
-	// I \u0300 (Ì) → i \u0307 \u0300;
-	// I \u0301 (Í) → i \u0307 \u0301;
-	// I \u0303 (Ĩ) → i \u0307 \u0303;
-	// ::Any-Lower();
-	// ::NFC();
-
-	i := 0
-	if r := c.src[c.pSrc]; r < utf8.RuneSelf {
-		lower(c)
-		if r != 'I' && r != 'J' {
-			return true
-		}
-	} else {
-		p := norm.NFD.Properties(c.src[c.pSrc:])
-		if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') {
-			// UTF-8 optimization: the decomposition will only have an above
-			// modifier if the last rune of the decomposition is in [U+300-U+311].
-			// In all other cases, a decomposition starting with I is always
-			// an I followed by modifiers that are not cased themselves. See A.2.
-			if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4.
-				if !c.writeBytes(d[:1]) {
-					return false
-				}
-				c.dst[c.pDst-1] += 'a' - 'A' // lower
-
-				// Assumption: modifier never changes on lowercase. See A.1.
-				// Assumption: all modifiers added have CCC = Above. See A.2.3.
-				return c.writeString("\u0307") && c.writeBytes(d[1:])
-			}
-			// In all other cases the additional modifiers will have a CCC
-			// that is less than 230 (Above). We will insert the U+0307, if
-			// needed, after these modifiers so that a string in FCD form
-			// will remain so. See A.2.2.
-			lower(c)
-			i = 1
-		} else {
-			return lower(c)
-		}
-	}
-
-	for ; i < maxIgnorable && c.next(); i++ {
-		switch c.info.cccType() {
-		case cccZero:
-			c.unreadRune()
-			return true
-		case cccAbove:
-			return c.writeString("\u0307") && c.copy() // See A.1.
-		default:
-			c.copy() // See A.1.
-		}
-	}
-	return i == maxIgnorable
-}
-
-// ltLowerSpan would be the same as isLower.
-
-func ltUpper(f mapFunc) mapFunc {
-	return func(c *context) bool {
-		// Unicode:
-		// 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE
-		//
-		// From CLDR:
-		// # Remove \u0307 following soft-dotteds (i, j, and the like), with possible
-		// # intervening non-230 marks.
-		// ::NFD();
-		// [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ;
-		// ::Any-Upper();
-		// ::NFC();
-
-		// TODO: See A.5. A soft-dotted rune never has an exception. This would
-		// allow us to overload the exception bit and encode this property in
-		// info. Need to measure performance impact of this.
-		r, _ := utf8.DecodeRune(c.src[c.pSrc:])
-		oldPDst := c.pDst
-		if !f(c) {
-			return false
-		}
-		if !unicode.Is(unicode.Soft_Dotted, r) {
-			return true
-		}
-
-		// We don't need to do an NFD normalization, as a soft-dotted rune never
-		// contains U+0307. See A.3.
-
-		i := 0
-		for ; i < maxIgnorable && c.next(); i++ {
-			switch c.info.cccType() {
-			case cccZero:
-				c.unreadRune()
-				return true
-			case cccAbove:
-				if c.hasPrefix("\u0307") {
-					// We don't do a full NFC, but rather combine runes for
-					// some of the common cases. (Returning NFC or
-					// preserving normal form is neither a requirement nor
-					// a possibility anyway).
-					if !c.next() {
-						return false
-					}
-					if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc {
-						s := ""
-						switch c.src[c.pSrc+1] {
-						case 0x80: // U+0300 COMBINING GRAVE ACCENT
-							s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE
-						case 0x81: // U+0301 COMBINING ACUTE ACCENT
-							s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE
-						case 0x83: // U+0303 COMBINING TILDE
-							s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE
-						case 0x88: // U+0308 COMBINING DIAERESIS
-							s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS
-						default:
-						}
-						if s != "" {
-							c.pDst = oldPDst
-							return c.writeString(s)
-						}
-					}
-				}
-				return c.copy()
-			default:
-				c.copy()
-			}
-		}
-		return i == maxIgnorable
-	}
-}
-
-// TODO: implement ltUpperSpan (low priority: complex and infrequent).
-
-func aztrUpper(f mapFunc) mapFunc {
-	return func(c *context) bool {
-		// i→İ;
-		if c.src[c.pSrc] == 'i' {
-			return c.writeString("İ")
-		}
-		return f(c)
-	}
-}
-
-func aztrLower(c *context) (done bool) {
-	// From CLDR:
-	// # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri
-	// # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE
-	// İ→i;
-	// # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i.
-	// # This matches the behavior of the canonically equivalent I-dot_above
-	// # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE
-	// # When lowercasing, unless an I is before a dot_above, it turns into a dotless i.
-	// # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I
-	// I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ;
-	// I→ı ;
-	// ::Any-Lower();
-	if c.hasPrefix("\u0130") { // İ
-		return c.writeString("i")
-	}
-	if c.src[c.pSrc] != 'I' {
-		return lower(c)
-	}
-
-	// We ignore the lower-case I for now, but insert it later when we know
-	// which form we need.
-	start := c.pSrc + c.sz
-
-	i := 0
-Loop:
-	// We check for up to n ignorables before \u0307. As \u0307 is an
-	// ignorable as well, n is maxIgnorable-1.
-	for ; i < maxIgnorable && c.next(); i++ {
-		switch c.info.cccType() {
-		case cccAbove:
-			if c.hasPrefix("\u0307") {
-				return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307
-			}
-			done = true
-			break Loop
-		case cccZero:
-			c.unreadRune()
-			done = true
-			break Loop
-		default:
-			// We'll write this rune after we know which starter to use.
-		}
-	}
-	if i == maxIgnorable {
-		done = true
-	}
-	return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done
-}
-
-// aztrLowerSpan would be the same as isLower.
-
-func nlTitle(c *context) bool {
-	// From CLDR:
-	// # Special titlecasing for Dutch initial "ij".
-	// ::Any-Title();
-	// # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29)
-	// [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ;
-	if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' {
-		return title(c)
-	}
-
-	if !c.writeString("I") || !c.next() {
-		return false
-	}
-	if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' {
-		return c.writeString("J")
-	}
-	c.unreadRune()
-	return true
-}
-
-func nlTitleSpan(c *context) bool {
-	// From CLDR:
-	// # Special titlecasing for Dutch initial "ij".
-	// ::Any-Title();
-	// # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29)
-	// [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ;
-	if c.src[c.pSrc] != 'I' {
-		return isTitle(c)
-	}
-	if !c.next() || c.src[c.pSrc] == 'j' {
-		return false
-	}
-	if c.src[c.pSrc] != 'J' {
-		c.unreadRune()
-	}
-	return true
-}
-
-// Not part of CLDR, but see https://unicode.org/cldr/trac/ticket/7078.
-func afnlRewrite(c *context) {
-	if c.hasPrefix("'") || c.hasPrefix("’") {
-		c.isMidWord = true
-	}
-}
diff --git a/vendor/golang.org/x/text/cases/tables10.0.0.go b/vendor/golang.org/x/text/cases/tables10.0.0.go
deleted file mode 100644
index ca9923105e..0000000000
--- a/vendor/golang.org/x/text/cases/tables10.0.0.go
+++ /dev/null
@@ -1,2256 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-//go:build go1.10 && !go1.13
-// +build go1.10,!go1.13
-
-package cases
-
-// UnicodeVersion is the Unicode version from which the tables in this package are derived.
-const UnicodeVersion = "10.0.0"
-
-var xorData string = "" + // Size: 185 bytes
-	"\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" +
-	"\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" +
-	"\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" +
-	"\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" +
-	"\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" +
-	"\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" +
-	"\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" +
-	"\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" +
-	"\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22"
-
-var exceptions string = "" + // Size: 2068 bytes
-	"\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" +
-	"\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" +
-	"\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" +
-	"\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" +
-	"\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" +
-	"\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" +
-	"Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" +
-	"\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" +
-	"Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" +
-	"\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" +
-	"ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" +
-	"ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" +
-	"\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" +
-	"\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" +
-	"\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" +
-	"Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" +
-	"\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" +
-	"\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" +
-	"\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" +
-	"ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" +
-	"\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" +
-	"ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" +
-	"̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" +
-	"ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" +
-	"\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" +
-	"\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" +
-	"\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" +
-	"Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" +
-	"stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" +
-	"ԽՄխ"
-
-// lookup returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookup(s []byte) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupUnsafe(s []byte) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// lookupString returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookupString(s string) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupStringUnsafe(s string) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// caseTrie. Total size: 11892 bytes (11.61 KiB). Checksum: c6f15484b7653775.
-type caseTrie struct{}
-
-func newCaseTrie(i int) *caseTrie {
-	return &caseTrie{}
-}
-
-// lookupValue determines the type of block n and looks up the value for b.
-func (t *caseTrie) lookupValue(n uint32, b byte) uint16 {
-	switch {
-	case n < 18:
-		return uint16(caseValues[n<<6+uint32(b)])
-	default:
-		n -= 18
-		return uint16(sparse.lookup(n, b))
-	}
-}
-
-// caseValues: 20 blocks, 1280 entries, 2560 bytes
-// The third block is the zero block.
-var caseValues = [1280]uint16{
-	// Block 0x0, offset 0x0
-	0x27: 0x0054,
-	0x2e: 0x0054,
-	0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010,
-	0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054,
-	// Block 0x1, offset 0x40
-	0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013,
-	0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013,
-	0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013,
-	0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013,
-	0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013,
-	0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012,
-	0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012,
-	0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012,
-	0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012,
-	0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012,
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112,
-	0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713,
-	0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313,
-	0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653,
-	0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53,
-	0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112,
-	0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853,
-	0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13,
-	0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313,
-	0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010,
-	0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452,
-	// Block 0x4, offset 0x100
-	0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359,
-	0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619,
-	0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313,
-	0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13,
-	0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452,
-	0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112,
-	0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112,
-	0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112,
-	0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112,
-	0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112,
-	0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112,
-	// Block 0x5, offset 0x140
-	0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53,
-	0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112,
-	0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a,
-	0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152,
-	0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012,
-	0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052,
-	0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652,
-	0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52,
-	0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252,
-	0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012,
-	0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012,
-	// Block 0x6, offset 0x180
-	0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012,
-	0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52,
-	0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012,
-	0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012,
-	0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a,
-	0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012,
-	0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012,
-	0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012,
-	0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015,
-	0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014,
-	0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d,
-	0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024,
-	0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024,
-	0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024,
-	0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034,
-	0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024,
-	0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024,
-	0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024,
-	0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004,
-	0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52,
-	0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353,
-	// Block 0x8, offset 0x200
-	0x204: 0x0004, 0x205: 0x0004,
-	0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513,
-	0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013,
-	0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013,
-	0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013,
-	0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53,
-	0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53,
-	0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512,
-	0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012,
-	0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012,
-	0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012,
-	// Block 0x9, offset 0x240
-	0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52,
-	0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52,
-	0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a,
-	0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812,
-	0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112,
-	0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112,
-	0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112,
-	0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112,
-	0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a,
-	0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112,
-	0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053,
-	// Block 0xa, offset 0x280
-	0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812,
-	0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813,
-	0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812,
-	0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812,
-	0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813,
-	0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812,
-	0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813,
-	0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813,
-	0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152,
-	0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52,
-	0x2bc: 0x4d52, 0x2bd: 0x4d52,
-	// Block 0xb, offset 0x2c0
-	0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea,
-	0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289,
-	0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a,
-	0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca,
-	0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369,
-	0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a,
-	0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9,
-	0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449,
-	0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a,
-	0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53,
-	0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004,
-	// Block 0xc, offset 0x300
-	0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a,
-	0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153,
-	0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812,
-	0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a,
-	0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004,
-	0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa,
-	0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813,
-	0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004,
-	0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a,
-	0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53,
-	0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004,
-	// Block 0xd, offset 0x340
-	0x342: 0x0013,
-	0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013,
-	0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013,
-	0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013,
-	0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013,
-	0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013,
-	0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012,
-	0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010,
-	0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012,
-	0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013,
-	// Block 0xe, offset 0x380
-	0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13,
-	0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13,
-	0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052,
-	0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352,
-	0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12,
-	0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12,
-	0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612,
-	// Block 0xf, offset 0x3c0
-	0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552,
-	0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552,
-	0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952,
-	0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952,
-	0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952,
-	0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853,
-	0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313,
-	0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b,
-	0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313,
-	0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012,
-	0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b,
-	// Block 0x10, offset 0x400
-	0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112,
-	0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0014, 0x40a: 0x0014, 0x40b: 0x0713,
-	0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112,
-	0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112,
-	0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112,
-	0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112,
-	0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112,
-	0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b,
-	0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112,
-	0x436: 0x0113, 0x437: 0x0112,
-	// Block 0x11, offset 0x440
-	0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea,
-	0x446: 0x7c6a,
-	0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a,
-	0x45d: 0x0010,
-	0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010,
-	0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010,
-	0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010,
-	0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010,
-	0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010,
-	0x47c: 0x0010, 0x47e: 0x0010,
-	// Block 0x12, offset 0x480
-	0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213,
-	0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613,
-	0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213,
-	0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13,
-	0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213,
-	0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212,
-	0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12,
-	0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212,
-	0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612,
-	0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212,
-	0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212,
-	// Block 0x13, offset 0x4c0
-	0x4c2: 0x0010,
-	0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010,
-	0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010,
-	0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010,
-	0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010,
-	0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010,
-	0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010,
-	0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010,
-	0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010,
-	0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010,
-	0x4fc: 0x0010, 0x4fe: 0x0010,
-}
-
-// caseIndex: 25 blocks, 1600 entries, 3200 bytes
-// Block 0 is the zero block.
-var caseIndex = [1600]uint16{
-	// Block 0x0, offset 0x0
-	// Block 0x1, offset 0x40
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02,
-	0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07,
-	0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20,
-	0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28,
-	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
-	0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09,
-	0xf0: 0x14, 0xf3: 0x16,
-	// Block 0x4, offset 0x100
-	0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30,
-	0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38,
-	0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40,
-	0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48,
-	// Block 0x5, offset 0x140
-	0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23,
-	0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53,
-	0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23,
-	0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b,
-	0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62,
-	0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69,
-	0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71,
-	0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a,
-	// Block 0x6, offset 0x180
-	0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a,
-	0x192: 0x7b, 0x193: 0x0c,
-	0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81,
-	0x1b8: 0x82,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87,
-	// Block 0x8, offset 0x200
-	0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23,
-	0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23,
-	0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23,
-	0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91,
-	0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98,
-	0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0,
-	0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23,
-	0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23,
-	// Block 0x9, offset 0x240
-	0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23,
-	0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23,
-	0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23,
-	0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23,
-	0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23,
-	0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23,
-	0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23,
-	0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23,
-	// Block 0xa, offset 0x280
-	0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23,
-	0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23,
-	0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23,
-	0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2,
-	// Block 0xb, offset 0x2c0
-	0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5,
-	0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9,
-	0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0,
-	// Block 0xc, offset 0x300
-	0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5,
-	0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb,
-	0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1,
-	0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3,
-	0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9,
-	0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf,
-	0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2,
-	// Block 0xd, offset 0x340
-	0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda,
-	0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf,
-	0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5,
-	0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea,
-	0x362: 0xeb, 0x363: 0xec,
-	0x368: 0xed, 0x369: 0xee, 0x36a: 0xef, 0x36b: 0xf0,
-	0x370: 0xf1, 0x371: 0xf2, 0x372: 0xf3, 0x374: 0xf4, 0x375: 0xf5,
-	// Block 0xe, offset 0x380
-	0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23,
-	0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf6,
-	0x390: 0x23, 0x391: 0xf7, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf8,
-	// Block 0xf, offset 0x3c0
-	0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23,
-	0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23,
-	0x3d0: 0xf7,
-	// Block 0x10, offset 0x400
-	0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23,
-	0x418: 0x23, 0x419: 0xf9,
-	// Block 0x11, offset 0x440
-	0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23,
-	0x468: 0xf0, 0x469: 0xfa, 0x46b: 0xfb, 0x46c: 0xfc, 0x46d: 0xfd, 0x46e: 0xfe,
-	0x47c: 0x23, 0x47d: 0xff, 0x47e: 0x100, 0x47f: 0x101,
-	// Block 0x12, offset 0x480
-	0x4b0: 0x23, 0x4b1: 0x102, 0x4b2: 0x103,
-	// Block 0x13, offset 0x4c0
-	0x4c5: 0x104, 0x4c6: 0x105,
-	0x4c9: 0x106,
-	0x4d0: 0x107, 0x4d1: 0x108, 0x4d2: 0x109, 0x4d3: 0x10a, 0x4d4: 0x10b, 0x4d5: 0x10c, 0x4d6: 0x10d, 0x4d7: 0x10e,
-	0x4d8: 0x10f, 0x4d9: 0x110, 0x4da: 0x111, 0x4db: 0x112, 0x4dc: 0x113, 0x4dd: 0x114, 0x4de: 0x115, 0x4df: 0x116,
-	0x4e8: 0x117, 0x4e9: 0x118, 0x4ea: 0x119,
-	// Block 0x14, offset 0x500
-	0x500: 0x11a,
-	0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x11b, 0x524: 0x10, 0x525: 0x11c,
-	0x538: 0x11d, 0x539: 0x11, 0x53a: 0x11e,
-	// Block 0x15, offset 0x540
-	0x544: 0x11f, 0x545: 0x120, 0x546: 0x121,
-	0x54f: 0x122,
-	// Block 0x16, offset 0x580
-	0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f,
-	0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13,
-	// Block 0x17, offset 0x5c0
-	0x5c0: 0x123, 0x5c1: 0x124, 0x5c4: 0x124, 0x5c5: 0x124, 0x5c6: 0x124, 0x5c7: 0x125,
-	// Block 0x18, offset 0x600
-	0x620: 0x15,
-}
-
-// sparseOffsets: 277 entries, 554 bytes
-var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x54, 0x64, 0x6b, 0x70, 0x7e, 0x7f, 0x8d, 0x9c, 0xa6, 0xa9, 0xaf, 0xb7, 0xba, 0xbc, 0xca, 0xd0, 0xde, 0xe9, 0xf5, 0x100, 0x10c, 0x116, 0x122, 0x12d, 0x139, 0x145, 0x14d, 0x155, 0x15f, 0x16a, 0x176, 0x17d, 0x188, 0x18d, 0x195, 0x198, 0x19d, 0x1a1, 0x1a5, 0x1ac, 0x1b5, 0x1bd, 0x1be, 0x1c7, 0x1ce, 0x1d6, 0x1dc, 0x1e2, 0x1e7, 0x1eb, 0x1ee, 0x1f0, 0x1f3, 0x1f8, 0x1f9, 0x1fb, 0x1fd, 0x1ff, 0x206, 0x20b, 0x20f, 0x218, 0x21b, 0x21e, 0x224, 0x225, 0x230, 0x231, 0x232, 0x237, 0x244, 0x24c, 0x254, 0x25d, 0x266, 0x26f, 0x274, 0x277, 0x280, 0x28d, 0x28f, 0x296, 0x298, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x326, 0x32d, 0x331, 0x33a, 0x33b, 0x343, 0x347, 0x34c, 0x354, 0x35a, 0x360, 0x36a, 0x36f, 0x378, 0x37e, 0x385, 0x389, 0x391, 0x393, 0x395, 0x398, 0x39a, 0x39c, 0x39d, 0x39e, 0x3a0, 0x3a2, 0x3a8, 0x3ad, 0x3af, 0x3b5, 0x3b8, 0x3ba, 0x3c0, 0x3c5, 0x3c7, 0x3c8, 0x3c9, 0x3ca, 0x3cc, 0x3ce, 0x3d0, 0x3d3, 0x3d5, 0x3d8, 0x3e0, 0x3e3, 0x3e7, 0x3ef, 0x3f1, 0x3f2, 0x3f3, 0x3f5, 0x3fb, 0x3fd, 0x3fe, 0x400, 0x402, 0x404, 0x411, 0x412, 0x413, 0x417, 0x419, 0x41a, 0x41b, 0x41c, 0x41d, 0x421, 0x425, 0x42b, 0x42d, 0x434, 0x437, 0x43b, 0x441, 0x44a, 0x450, 0x456, 0x460, 0x46a, 0x46c, 0x473, 0x479, 0x47f, 0x485, 0x488, 0x48e, 0x491, 0x499, 0x49a, 0x4a1, 0x4a2, 0x4a5, 0x4af, 0x4b5, 0x4bb, 0x4bc, 0x4c2, 0x4c5, 0x4cd, 0x4d4, 0x4db, 0x4dc, 0x4dd, 0x4de, 0x4df, 0x4e1, 0x4e3, 0x4e5, 0x4e9, 0x4ea, 0x4ec, 0x4ed, 0x4ee, 0x4f0, 0x4f5, 0x4fa, 0x4fe, 0x4ff, 0x502, 0x506, 0x511, 0x515, 0x51d, 0x522, 0x526, 0x529, 0x52d, 0x530, 0x533, 0x538, 0x53c, 0x540, 0x544, 0x548, 0x54a, 0x54c, 0x54f, 0x554, 0x556, 0x55b, 0x564, 0x569, 0x56a, 0x56d, 0x56e, 0x56f, 0x571, 0x572, 0x573}
-
-// sparseValues: 1395 entries, 5580 bytes
-var sparseValues = [1395]valueRange{
-	// Block 0x0, offset 0x0
-	{value: 0x0004, lo: 0xa8, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xaa},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0004, lo: 0xaf, hi: 0xaf},
-	{value: 0x0004, lo: 0xb4, hi: 0xb4},
-	{value: 0x001a, lo: 0xb5, hi: 0xb5},
-	{value: 0x0054, lo: 0xb7, hi: 0xb7},
-	{value: 0x0004, lo: 0xb8, hi: 0xb8},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	// Block 0x1, offset 0x9
-	{value: 0x2013, lo: 0x80, hi: 0x96},
-	{value: 0x2013, lo: 0x98, hi: 0x9e},
-	{value: 0x009a, lo: 0x9f, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xb6},
-	{value: 0x2012, lo: 0xb8, hi: 0xbe},
-	{value: 0x0252, lo: 0xbf, hi: 0xbf},
-	// Block 0x2, offset 0xf
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x011b, lo: 0xb0, hi: 0xb0},
-	{value: 0x019a, lo: 0xb1, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb7},
-	{value: 0x0012, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x0553, lo: 0xbf, hi: 0xbf},
-	// Block 0x3, offset 0x18
-	{value: 0x0552, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x01da, lo: 0x89, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xb7},
-	{value: 0x0253, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x028a, lo: 0xbf, hi: 0xbf},
-	// Block 0x4, offset 0x24
-	{value: 0x0117, lo: 0x80, hi: 0x9f},
-	{value: 0x2f53, lo: 0xa0, hi: 0xa0},
-	{value: 0x0012, lo: 0xa1, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xb3},
-	{value: 0x0012, lo: 0xb4, hi: 0xb9},
-	{value: 0x090b, lo: 0xba, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x2953, lo: 0xbd, hi: 0xbd},
-	{value: 0x098b, lo: 0xbe, hi: 0xbe},
-	{value: 0x0a0a, lo: 0xbf, hi: 0xbf},
-	// Block 0x5, offset 0x2e
-	{value: 0x0015, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x97},
-	{value: 0x0004, lo: 0x98, hi: 0x9d},
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0015, lo: 0xa0, hi: 0xa4},
-	{value: 0x0004, lo: 0xa5, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xbf},
-	// Block 0x6, offset 0x35
-	{value: 0x0024, lo: 0x80, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbf},
-	// Block 0x7, offset 0x38
-	{value: 0x6553, lo: 0x80, hi: 0x8f},
-	{value: 0x2013, lo: 0x90, hi: 0x9f},
-	{value: 0x5f53, lo: 0xa0, hi: 0xaf},
-	{value: 0x2012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8, offset 0x3c
-	{value: 0x5f52, lo: 0x80, hi: 0x8f},
-	{value: 0x6552, lo: 0x90, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x9, offset 0x3f
-	{value: 0x0117, lo: 0x80, hi: 0x81},
-	{value: 0x0024, lo: 0x83, hi: 0x87},
-	{value: 0x0014, lo: 0x88, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xbf},
-	// Block 0xa, offset 0x43
-	{value: 0x0f13, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x0316, lo: 0x89, hi: 0x8a},
-	{value: 0x0716, lo: 0x8b, hi: 0x8c},
-	{value: 0x0316, lo: 0x8d, hi: 0x8e},
-	{value: 0x0f12, lo: 0x8f, hi: 0x8f},
-	{value: 0x0117, lo: 0x90, hi: 0xbf},
-	// Block 0xb, offset 0x4d
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x6553, lo: 0xb1, hi: 0xbf},
-	// Block 0xc, offset 0x4f
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6853, lo: 0x90, hi: 0x96},
-	{value: 0x0014, lo: 0x99, hi: 0x99},
-	{value: 0x6552, lo: 0xa1, hi: 0xaf},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0xd, offset 0x54
-	{value: 0x6852, lo: 0x80, hi: 0x86},
-	{value: 0x198a, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x91, hi: 0x91},
-	{value: 0x0024, lo: 0x92, hi: 0x95},
-	{value: 0x0034, lo: 0x96, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x99},
-	{value: 0x0034, lo: 0x9a, hi: 0x9b},
-	{value: 0x0024, lo: 0x9c, hi: 0xa1},
-	{value: 0x0034, lo: 0xa2, hi: 0xa7},
-	{value: 0x0024, lo: 0xa8, hi: 0xa9},
-	{value: 0x0034, lo: 0xaa, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xaf},
-	{value: 0x0034, lo: 0xb0, hi: 0xbd},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xe, offset 0x64
-	{value: 0x0034, lo: 0x81, hi: 0x82},
-	{value: 0x0024, lo: 0x84, hi: 0x84},
-	{value: 0x0034, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xb3},
-	{value: 0x0054, lo: 0xb4, hi: 0xb4},
-	// Block 0xf, offset 0x6b
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0024, lo: 0x90, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0014, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x10, offset 0x70
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9c},
-	{value: 0x0024, lo: 0x9d, hi: 0x9e},
-	{value: 0x0034, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0034, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x11, offset 0x7e
-	{value: 0x0010, lo: 0x80, hi: 0xbf},
-	// Block 0x12, offset 0x7f
-	{value: 0x0010, lo: 0x80, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0024, lo: 0x9f, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xaa, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x13, offset 0x8d
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0034, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0034, lo: 0xb1, hi: 0xb1},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbd},
-	{value: 0x0034, lo: 0xbe, hi: 0xbe},
-	{value: 0x0024, lo: 0xbf, hi: 0xbf},
-	// Block 0x14, offset 0x9c
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0024, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x88},
-	{value: 0x0024, lo: 0x89, hi: 0x8a},
-	{value: 0x0010, lo: 0x8d, hi: 0xbf},
-	// Block 0x15, offset 0xa6
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x16, offset 0xa9
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xb1},
-	{value: 0x0034, lo: 0xb2, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	// Block 0x17, offset 0xaf
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x99},
-	{value: 0x0014, lo: 0x9a, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0xa3},
-	{value: 0x0014, lo: 0xa4, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xad},
-	// Block 0x18, offset 0xb7
-	{value: 0x0010, lo: 0x80, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0xa0, hi: 0xaa},
-	// Block 0x19, offset 0xba
-	{value: 0x0010, lo: 0xa0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbd},
-	// Block 0x1a, offset 0xbc
-	{value: 0x0024, lo: 0x94, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0024, lo: 0xaa, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbf},
-	// Block 0x1b, offset 0xca
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1c, offset 0xd0
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0x1d, offset 0xde
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb6, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1e, offset 0xe9
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xb1},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	// Block 0x1f, offset 0xf5
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x20, offset 0x100
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x99, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x21, offset 0x10c
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x22, offset 0x116
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x85},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xbf},
-	// Block 0x23, offset 0x122
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x24, offset 0x12d
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x25, offset 0x139
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0010, lo: 0xa8, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x26, offset 0x145
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x27, offset 0x14d
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb9},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbf},
-	// Block 0x28, offset 0x155
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x88},
-	{value: 0x0014, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x29, offset 0x15f
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x2a, offset 0x16a
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb2},
-	// Block 0x2b, offset 0x176
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x2c, offset 0x17d
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x94, hi: 0x97},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xba, hi: 0xbf},
-	// Block 0x2d, offset 0x188
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x96},
-	{value: 0x0010, lo: 0x9a, hi: 0xb1},
-	{value: 0x0010, lo: 0xb3, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x2e, offset 0x18d
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x94},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9f},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	// Block 0x2f, offset 0x195
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xba},
-	// Block 0x30, offset 0x198
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x31, offset 0x19d
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xb9},
-	{value: 0x0014, lo: 0xbb, hi: 0xbc},
-	// Block 0x32, offset 0x1a1
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x33, offset 0x1a5
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0034, lo: 0x98, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0034, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x34, offset 0x1ac
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xac},
-	{value: 0x0034, lo: 0xb1, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xba, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x35, offset 0x1b5
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0024, lo: 0x82, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x86, hi: 0x87},
-	{value: 0x0010, lo: 0x88, hi: 0x8c},
-	{value: 0x0014, lo: 0x8d, hi: 0x97},
-	{value: 0x0014, lo: 0x99, hi: 0xbc},
-	// Block 0x36, offset 0x1bd
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	// Block 0x37, offset 0x1be
-	{value: 0x0010, lo: 0xab, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbe},
-	// Block 0x38, offset 0x1c7
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x96, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x99},
-	{value: 0x0014, lo: 0x9e, hi: 0xa0},
-	{value: 0x0010, lo: 0xa2, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xad},
-	{value: 0x0014, lo: 0xb1, hi: 0xb4},
-	// Block 0x39, offset 0x1ce
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x6c53, lo: 0xa0, hi: 0xbf},
-	// Block 0x3a, offset 0x1d6
-	{value: 0x7053, lo: 0x80, hi: 0x85},
-	{value: 0x7053, lo: 0x87, hi: 0x87},
-	{value: 0x7053, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xba},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x3b, offset 0x1dc
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x9a, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x3c, offset 0x1e2
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x3d, offset 0x1e7
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x82, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3e, offset 0x1eb
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3f, offset 0x1ee
-	{value: 0x0010, lo: 0x80, hi: 0x9a},
-	{value: 0x0024, lo: 0x9d, hi: 0x9f},
-	// Block 0x40, offset 0x1f0
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x7453, lo: 0xa0, hi: 0xaf},
-	{value: 0x7853, lo: 0xb0, hi: 0xbf},
-	// Block 0x41, offset 0x1f3
-	{value: 0x7c53, lo: 0x80, hi: 0x8f},
-	{value: 0x8053, lo: 0x90, hi: 0x9f},
-	{value: 0x7c53, lo: 0xa0, hi: 0xaf},
-	{value: 0x0813, lo: 0xb0, hi: 0xb5},
-	{value: 0x0892, lo: 0xb8, hi: 0xbd},
-	// Block 0x42, offset 0x1f8
-	{value: 0x0010, lo: 0x81, hi: 0xbf},
-	// Block 0x43, offset 0x1f9
-	{value: 0x0010, lo: 0x80, hi: 0xac},
-	{value: 0x0010, lo: 0xaf, hi: 0xbf},
-	// Block 0x44, offset 0x1fb
-	{value: 0x0010, lo: 0x81, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x45, offset 0x1fd
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb8},
-	// Block 0x46, offset 0x1ff
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0034, lo: 0x94, hi: 0x94},
-	{value: 0x0010, lo: 0xa0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	// Block 0x47, offset 0x206
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xac},
-	{value: 0x0010, lo: 0xae, hi: 0xb0},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	// Block 0x48, offset 0x20b
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x49, offset 0x20f
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x89, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0014, lo: 0x93, hi: 0x93},
-	{value: 0x0004, lo: 0x97, hi: 0x97},
-	{value: 0x0024, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0x4a, offset 0x218
-	{value: 0x0014, lo: 0x8b, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x4b, offset 0x21b
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb7},
-	// Block 0x4c, offset 0x21e
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x4d, offset 0x224
-	{value: 0x0010, lo: 0x80, hi: 0xb5},
-	// Block 0x4e, offset 0x225
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbb},
-	// Block 0x4f, offset 0x230
-	{value: 0x0010, lo: 0x86, hi: 0x8f},
-	// Block 0x50, offset 0x231
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x51, offset 0x232
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	// Block 0x52, offset 0x237
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x9e},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xac},
-	{value: 0x0010, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xbc},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x53, offset 0x244
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xa7, hi: 0xa7},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	{value: 0x0034, lo: 0xb5, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbc},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0x54, offset 0x24c
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x55, offset 0x254
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0030, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8b},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xab, hi: 0xab},
-	{value: 0x0034, lo: 0xac, hi: 0xac},
-	{value: 0x0024, lo: 0xad, hi: 0xb3},
-	// Block 0x56, offset 0x25d
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0030, lo: 0xaa, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbf},
-	// Block 0x57, offset 0x266
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0030, lo: 0xb2, hi: 0xb3},
-	// Block 0x58, offset 0x26f
-	{value: 0x0010, lo: 0x80, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0x59, offset 0x274
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8d, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x5a, offset 0x277
-	{value: 0x1a6a, lo: 0x80, hi: 0x80},
-	{value: 0x1aea, lo: 0x81, hi: 0x81},
-	{value: 0x1b6a, lo: 0x82, hi: 0x82},
-	{value: 0x1bea, lo: 0x83, hi: 0x83},
-	{value: 0x1c6a, lo: 0x84, hi: 0x84},
-	{value: 0x1cea, lo: 0x85, hi: 0x85},
-	{value: 0x1d6a, lo: 0x86, hi: 0x86},
-	{value: 0x1dea, lo: 0x87, hi: 0x87},
-	{value: 0x1e6a, lo: 0x88, hi: 0x88},
-	// Block 0x5b, offset 0x280
-	{value: 0x0024, lo: 0x90, hi: 0x92},
-	{value: 0x0034, lo: 0x94, hi: 0x99},
-	{value: 0x0024, lo: 0x9a, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9f},
-	{value: 0x0024, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0034, lo: 0xa2, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xb3},
-	{value: 0x0024, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb7},
-	{value: 0x0024, lo: 0xb8, hi: 0xb9},
-	// Block 0x5c, offset 0x28d
-	{value: 0x0012, lo: 0x80, hi: 0xab},
-	{value: 0x0015, lo: 0xac, hi: 0xbf},
-	// Block 0x5d, offset 0x28f
-	{value: 0x0015, lo: 0x80, hi: 0xaa},
-	{value: 0x0012, lo: 0xab, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb8},
-	{value: 0x8452, lo: 0xb9, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbc},
-	{value: 0x8852, lo: 0xbd, hi: 0xbd},
-	{value: 0x0012, lo: 0xbe, hi: 0xbf},
-	// Block 0x5e, offset 0x296
-	{value: 0x0012, lo: 0x80, hi: 0x9a},
-	{value: 0x0015, lo: 0x9b, hi: 0xbf},
-	// Block 0x5f, offset 0x298
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0024, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb9},
-	{value: 0x0024, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbd},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x60, offset 0x2a4
-	{value: 0x0117, lo: 0x80, hi: 0xbf},
-	// Block 0x61, offset 0x2a5
-	{value: 0x0117, lo: 0x80, hi: 0x95},
-	{value: 0x1f1a, lo: 0x96, hi: 0x96},
-	{value: 0x1fca, lo: 0x97, hi: 0x97},
-	{value: 0x207a, lo: 0x98, hi: 0x98},
-	{value: 0x212a, lo: 0x99, hi: 0x99},
-	{value: 0x21da, lo: 0x9a, hi: 0x9a},
-	{value: 0x228a, lo: 0x9b, hi: 0x9b},
-	{value: 0x0012, lo: 0x9c, hi: 0x9d},
-	{value: 0x233b, lo: 0x9e, hi: 0x9e},
-	{value: 0x0012, lo: 0x9f, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x62, offset 0x2b0
-	{value: 0x0812, lo: 0x80, hi: 0x87},
-	{value: 0x0813, lo: 0x88, hi: 0x8f},
-	{value: 0x0812, lo: 0x90, hi: 0x95},
-	{value: 0x0813, lo: 0x98, hi: 0x9d},
-	{value: 0x0812, lo: 0xa0, hi: 0xa7},
-	{value: 0x0813, lo: 0xa8, hi: 0xaf},
-	{value: 0x0812, lo: 0xb0, hi: 0xb7},
-	{value: 0x0813, lo: 0xb8, hi: 0xbf},
-	// Block 0x63, offset 0x2b8
-	{value: 0x0004, lo: 0x8b, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8f},
-	{value: 0x0054, lo: 0x98, hi: 0x99},
-	{value: 0x0054, lo: 0xa4, hi: 0xa4},
-	{value: 0x0054, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xaa, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xaf},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x64, offset 0x2c0
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x94, hi: 0x94},
-	{value: 0x0014, lo: 0xa0, hi: 0xa4},
-	{value: 0x0014, lo: 0xa6, hi: 0xaf},
-	{value: 0x0015, lo: 0xb1, hi: 0xb1},
-	{value: 0x0015, lo: 0xbf, hi: 0xbf},
-	// Block 0x65, offset 0x2c6
-	{value: 0x0015, lo: 0x90, hi: 0x9c},
-	// Block 0x66, offset 0x2c7
-	{value: 0x0024, lo: 0x90, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0xa0},
-	{value: 0x0024, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa4},
-	{value: 0x0034, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa7},
-	{value: 0x0034, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xa9},
-	{value: 0x0034, lo: 0xaa, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	// Block 0x67, offset 0x2d5
-	{value: 0x0016, lo: 0x85, hi: 0x86},
-	{value: 0x0012, lo: 0x87, hi: 0x89},
-	{value: 0x9d52, lo: 0x8e, hi: 0x8e},
-	{value: 0x1013, lo: 0xa0, hi: 0xaf},
-	{value: 0x1012, lo: 0xb0, hi: 0xbf},
-	// Block 0x68, offset 0x2da
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x88},
-	// Block 0x69, offset 0x2dd
-	{value: 0xa053, lo: 0xb6, hi: 0xb7},
-	{value: 0xa353, lo: 0xb8, hi: 0xb9},
-	{value: 0xa653, lo: 0xba, hi: 0xbb},
-	{value: 0xa353, lo: 0xbc, hi: 0xbd},
-	{value: 0xa053, lo: 0xbe, hi: 0xbf},
-	// Block 0x6a, offset 0x2e2
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6553, lo: 0x90, hi: 0x9f},
-	{value: 0xa953, lo: 0xa0, hi: 0xae},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0x6b, offset 0x2e6
-	{value: 0x0117, lo: 0x80, hi: 0xa3},
-	{value: 0x0012, lo: 0xa4, hi: 0xa4},
-	{value: 0x0716, lo: 0xab, hi: 0xac},
-	{value: 0x0316, lo: 0xad, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb3},
-	// Block 0x6c, offset 0x2ec
-	{value: 0x6c52, lo: 0x80, hi: 0x9f},
-	{value: 0x7052, lo: 0xa0, hi: 0xa5},
-	{value: 0x7052, lo: 0xa7, hi: 0xa7},
-	{value: 0x7052, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x6d, offset 0x2f1
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x6e, offset 0x2f4
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0010, lo: 0xb0, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x6f, offset 0x2f9
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9e},
-	{value: 0x0024, lo: 0xa0, hi: 0xbf},
-	// Block 0x70, offset 0x2fe
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	// Block 0x71, offset 0x2ff
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0xaa, hi: 0xad},
-	{value: 0x0030, lo: 0xae, hi: 0xaf},
-	{value: 0x0004, lo: 0xb1, hi: 0xb5},
-	{value: 0x0014, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	// Block 0x72, offset 0x305
-	{value: 0x0034, lo: 0x99, hi: 0x9a},
-	{value: 0x0004, lo: 0x9b, hi: 0x9e},
-	// Block 0x73, offset 0x307
-	{value: 0x0004, lo: 0xbc, hi: 0xbe},
-	// Block 0x74, offset 0x308
-	{value: 0x0010, lo: 0x85, hi: 0xae},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x75, offset 0x30a
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0010, lo: 0xa0, hi: 0xba},
-	// Block 0x76, offset 0x30c
-	{value: 0x0010, lo: 0x80, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0xbf},
-	// Block 0x77, offset 0x30f
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	// Block 0x78, offset 0x310
-	{value: 0x0010, lo: 0x90, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x79, offset 0x312
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0xab},
-	// Block 0x7a, offset 0x315
-	{value: 0x0117, lo: 0x80, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb2},
-	{value: 0x0024, lo: 0xb4, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x7b, offset 0x31b
-	{value: 0x0117, lo: 0x80, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9d},
-	{value: 0x0024, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x7c, offset 0x31f
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb1},
-	// Block 0x7d, offset 0x321
-	{value: 0x0004, lo: 0x80, hi: 0x96},
-	{value: 0x0014, lo: 0x97, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xaf},
-	{value: 0x0012, lo: 0xb0, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xbf},
-	// Block 0x7e, offset 0x326
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x0015, lo: 0xb0, hi: 0xb0},
-	{value: 0x0012, lo: 0xb1, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x8453, lo: 0xbd, hi: 0xbd},
-	{value: 0x0117, lo: 0xbe, hi: 0xbf},
-	// Block 0x7f, offset 0x32d
-	{value: 0x0010, lo: 0xb7, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbf},
-	// Block 0x80, offset 0x331
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8b},
-	{value: 0x0010, lo: 0x8c, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	// Block 0x81, offset 0x33a
-	{value: 0x0010, lo: 0x80, hi: 0xb3},
-	// Block 0x82, offset 0x33b
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xa0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb7},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x83, offset 0x343
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x84, offset 0x347
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0x92},
-	{value: 0x0030, lo: 0x93, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0x85, offset 0x34c
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb9},
-	{value: 0x0010, lo: 0xba, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x86, offset 0x354
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0004, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x87, offset 0x35a
-	{value: 0x0010, lo: 0x80, hi: 0xa8},
-	{value: 0x0014, lo: 0xa9, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0x88, offset 0x360
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x89, offset 0x36a
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0024, lo: 0xbe, hi: 0xbf},
-	// Block 0x8a, offset 0x36f
-	{value: 0x0024, lo: 0x81, hi: 0x81},
-	{value: 0x0004, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	// Block 0x8b, offset 0x378
-	{value: 0x0010, lo: 0x81, hi: 0x86},
-	{value: 0x0010, lo: 0x89, hi: 0x8e},
-	{value: 0x0010, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8c, offset 0x37e
-	{value: 0x0012, lo: 0x80, hi: 0x92},
-	{value: 0xac52, lo: 0x93, hi: 0x93},
-	{value: 0x0012, lo: 0x94, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9f},
-	{value: 0x0012, lo: 0xa0, hi: 0xa5},
-	{value: 0x74d2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8d, offset 0x385
-	{value: 0x78d2, lo: 0x80, hi: 0x8f},
-	{value: 0x7cd2, lo: 0x90, hi: 0x9f},
-	{value: 0x80d2, lo: 0xa0, hi: 0xaf},
-	{value: 0x7cd2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8e, offset 0x389
-	{value: 0x0010, lo: 0x80, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x8f, offset 0x391
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x90, offset 0x393
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x8b, hi: 0xbb},
-	// Block 0x91, offset 0x395
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0xbf},
-	// Block 0x92, offset 0x398
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0004, lo: 0xb2, hi: 0xbf},
-	// Block 0x93, offset 0x39a
-	{value: 0x0004, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x93, hi: 0xbf},
-	// Block 0x94, offset 0x39c
-	{value: 0x0010, lo: 0x80, hi: 0xbd},
-	// Block 0x95, offset 0x39d
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0x96, offset 0x39e
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0xbf},
-	// Block 0x97, offset 0x3a0
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0xb0, hi: 0xbb},
-	// Block 0x98, offset 0x3a2
-	{value: 0x0014, lo: 0x80, hi: 0x8f},
-	{value: 0x0054, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0xa0, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xad},
-	{value: 0x0024, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	// Block 0x99, offset 0x3a8
-	{value: 0x0010, lo: 0x8d, hi: 0x8f},
-	{value: 0x0054, lo: 0x92, hi: 0x92},
-	{value: 0x0054, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0xb0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0x9a, offset 0x3ad
-	{value: 0x0010, lo: 0x80, hi: 0xbc},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x9b, offset 0x3af
-	{value: 0x0054, lo: 0x87, hi: 0x87},
-	{value: 0x0054, lo: 0x8e, hi: 0x8e},
-	{value: 0x0054, lo: 0x9a, hi: 0x9a},
-	{value: 0x5f53, lo: 0xa1, hi: 0xba},
-	{value: 0x0004, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9c, offset 0x3b5
-	{value: 0x0004, lo: 0x80, hi: 0x80},
-	{value: 0x5f52, lo: 0x81, hi: 0x9a},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	// Block 0x9d, offset 0x3b8
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbe},
-	// Block 0x9e, offset 0x3ba
-	{value: 0x0010, lo: 0x82, hi: 0x87},
-	{value: 0x0010, lo: 0x8a, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0x97},
-	{value: 0x0010, lo: 0x9a, hi: 0x9c},
-	{value: 0x0004, lo: 0xa3, hi: 0xa3},
-	{value: 0x0014, lo: 0xb9, hi: 0xbb},
-	// Block 0x9f, offset 0x3c0
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0010, lo: 0x8d, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xba},
-	{value: 0x0010, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xa0, offset 0x3c5
-	{value: 0x0010, lo: 0x80, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x9d},
-	// Block 0xa1, offset 0x3c7
-	{value: 0x0010, lo: 0x80, hi: 0xba},
-	// Block 0xa2, offset 0x3c8
-	{value: 0x0010, lo: 0x80, hi: 0xb4},
-	// Block 0xa3, offset 0x3c9
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0xa4, offset 0x3ca
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa5, offset 0x3cc
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	// Block 0xa6, offset 0x3ce
-	{value: 0x0010, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xad, hi: 0xbf},
-	// Block 0xa7, offset 0x3d0
-	{value: 0x0010, lo: 0x80, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0xb5},
-	{value: 0x0024, lo: 0xb6, hi: 0xba},
-	// Block 0xa8, offset 0x3d3
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa9, offset 0x3d5
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x91, hi: 0x95},
-	// Block 0xaa, offset 0x3d8
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x97},
-	{value: 0xaf53, lo: 0x98, hi: 0x9f},
-	{value: 0xb253, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbf},
-	// Block 0xab, offset 0x3e0
-	{value: 0xaf52, lo: 0x80, hi: 0x87},
-	{value: 0xb252, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0xac, offset 0x3e3
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0xb253, lo: 0xb0, hi: 0xb7},
-	{value: 0xaf53, lo: 0xb8, hi: 0xbf},
-	// Block 0xad, offset 0x3e7
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x93},
-	{value: 0xb252, lo: 0x98, hi: 0x9f},
-	{value: 0xaf52, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbb},
-	// Block 0xae, offset 0x3ef
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xaf, offset 0x3f1
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	// Block 0xb0, offset 0x3f2
-	{value: 0x0010, lo: 0x80, hi: 0xb6},
-	// Block 0xb1, offset 0x3f3
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xa7},
-	// Block 0xb2, offset 0x3f5
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xb5},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xb3, offset 0x3fb
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb6},
-	// Block 0xb4, offset 0x3fd
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	// Block 0xb5, offset 0x3fe
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	// Block 0xb6, offset 0x400
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb9},
-	// Block 0xb7, offset 0x402
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0xb8, offset 0x404
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x8e, hi: 0x8e},
-	{value: 0x0024, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x99, hi: 0xb3},
-	{value: 0x0024, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xb9, offset 0x411
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0xba, offset 0x412
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	// Block 0xbb, offset 0x413
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	// Block 0xbc, offset 0x417
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	// Block 0xbd, offset 0x419
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	// Block 0xbe, offset 0x41a
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	// Block 0xbf, offset 0x41b
-	{value: 0x5653, lo: 0x80, hi: 0xb2},
-	// Block 0xc0, offset 0x41c
-	{value: 0x5652, lo: 0x80, hi: 0xb2},
-	// Block 0xc1, offset 0x41d
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xc2, offset 0x421
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xc3, offset 0x425
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb6},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	// Block 0xc4, offset 0x42b
-	{value: 0x0010, lo: 0x90, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xc5, offset 0x42d
-	{value: 0x0024, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0xc6, offset 0x434
-	{value: 0x0010, lo: 0x90, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	// Block 0xc7, offset 0x437
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xc8, offset 0x43b
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	// Block 0xc9, offset 0x441
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb4},
-	{value: 0x0030, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xb7},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0xca, offset 0x44a
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xcb, offset 0x450
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa2},
-	{value: 0x0014, lo: 0xa3, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xcc, offset 0x456
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xcd, offset 0x460
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0030, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9d, hi: 0xa3},
-	{value: 0x0024, lo: 0xa6, hi: 0xac},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	// Block 0xce, offset 0x46a
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xcf, offset 0x46c
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd0, offset 0x473
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xd1, offset 0x479
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd2, offset 0x47f
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd3, offset 0x485
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x98, hi: 0x9b},
-	{value: 0x0014, lo: 0x9c, hi: 0x9d},
-	// Block 0xd4, offset 0x488
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd5, offset 0x48e
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd6, offset 0x491
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0014, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb5},
-	{value: 0x0030, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0xd7, offset 0x499
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	// Block 0xd8, offset 0x49a
-	{value: 0x0014, lo: 0x9d, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xd9, offset 0x4a1
-	{value: 0x5f53, lo: 0xa0, hi: 0xbf},
-	// Block 0xda, offset 0x4a2
-	{value: 0x5f52, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xdb, offset 0x4a5
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x89, hi: 0x8a},
-	{value: 0x0010, lo: 0x8b, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbb, hi: 0xbe},
-	// Block 0xdc, offset 0x4af
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0014, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x98},
-	{value: 0x0014, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0x9c, hi: 0xbf},
-	// Block 0xdd, offset 0x4b5
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x86, hi: 0x89},
-	{value: 0x0014, lo: 0x8a, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x99},
-	// Block 0xde, offset 0x4bb
-	{value: 0x0010, lo: 0x80, hi: 0xb8},
-	// Block 0xdf, offset 0x4bc
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb6},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xe0, offset 0x4c2
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0xe1, offset 0x4c5
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0014, lo: 0x92, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xa9},
-	{value: 0x0014, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0xe2, offset 0x4cd
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb6},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xe3, offset 0x4d4
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xe4, offset 0x4db
-	{value: 0x0010, lo: 0x80, hi: 0x99},
-	// Block 0xe5, offset 0x4dc
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	// Block 0xe6, offset 0x4dd
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	// Block 0xe7, offset 0x4de
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	// Block 0xe8, offset 0x4df
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xe9, offset 0x4e1
-	{value: 0x0010, lo: 0x90, hi: 0xad},
-	{value: 0x0034, lo: 0xb0, hi: 0xb4},
-	// Block 0xea, offset 0x4e3
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb6},
-	// Block 0xeb, offset 0x4e5
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa3, hi: 0xb7},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xec, offset 0x4e9
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	// Block 0xed, offset 0x4ea
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0xbe},
-	// Block 0xee, offset 0x4ec
-	{value: 0x0014, lo: 0x8f, hi: 0x9f},
-	// Block 0xef, offset 0x4ed
-	{value: 0x0014, lo: 0xa0, hi: 0xa1},
-	// Block 0xf0, offset 0x4ee
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbc},
-	// Block 0xf1, offset 0x4f0
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0034, lo: 0x9e, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa3},
-	// Block 0xf2, offset 0x4f5
-	{value: 0x0030, lo: 0xa5, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xa9},
-	{value: 0x0030, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbf},
-	// Block 0xf3, offset 0x4fa
-	{value: 0x0034, lo: 0x80, hi: 0x82},
-	{value: 0x0024, lo: 0x85, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8b},
-	{value: 0x0024, lo: 0xaa, hi: 0xad},
-	// Block 0xf4, offset 0x4fe
-	{value: 0x0024, lo: 0x82, hi: 0x84},
-	// Block 0xf5, offset 0x4ff
-	{value: 0x0013, lo: 0x80, hi: 0x99},
-	{value: 0x0012, lo: 0x9a, hi: 0xb3},
-	{value: 0x0013, lo: 0xb4, hi: 0xbf},
-	// Block 0xf6, offset 0x502
-	{value: 0x0013, lo: 0x80, hi: 0x8d},
-	{value: 0x0012, lo: 0x8e, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0xa7},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0xf7, offset 0x506
-	{value: 0x0013, lo: 0x80, hi: 0x81},
-	{value: 0x0012, lo: 0x82, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0x9c},
-	{value: 0x0013, lo: 0x9e, hi: 0x9f},
-	{value: 0x0013, lo: 0xa2, hi: 0xa2},
-	{value: 0x0013, lo: 0xa5, hi: 0xa6},
-	{value: 0x0013, lo: 0xa9, hi: 0xac},
-	{value: 0x0013, lo: 0xae, hi: 0xb5},
-	{value: 0x0012, lo: 0xb6, hi: 0xb9},
-	{value: 0x0012, lo: 0xbb, hi: 0xbb},
-	{value: 0x0012, lo: 0xbd, hi: 0xbf},
-	// Block 0xf8, offset 0x511
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0012, lo: 0x85, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0xf9, offset 0x515
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0013, lo: 0x84, hi: 0x85},
-	{value: 0x0013, lo: 0x87, hi: 0x8a},
-	{value: 0x0013, lo: 0x8d, hi: 0x94},
-	{value: 0x0013, lo: 0x96, hi: 0x9c},
-	{value: 0x0012, lo: 0x9e, hi: 0xb7},
-	{value: 0x0013, lo: 0xb8, hi: 0xb9},
-	{value: 0x0013, lo: 0xbb, hi: 0xbe},
-	// Block 0xfa, offset 0x51d
-	{value: 0x0013, lo: 0x80, hi: 0x84},
-	{value: 0x0013, lo: 0x86, hi: 0x86},
-	{value: 0x0013, lo: 0x8a, hi: 0x90},
-	{value: 0x0012, lo: 0x92, hi: 0xab},
-	{value: 0x0013, lo: 0xac, hi: 0xbf},
-	// Block 0xfb, offset 0x522
-	{value: 0x0013, lo: 0x80, hi: 0x85},
-	{value: 0x0012, lo: 0x86, hi: 0x9f},
-	{value: 0x0013, lo: 0xa0, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbf},
-	// Block 0xfc, offset 0x526
-	{value: 0x0012, lo: 0x80, hi: 0x93},
-	{value: 0x0013, lo: 0x94, hi: 0xad},
-	{value: 0x0012, lo: 0xae, hi: 0xbf},
-	// Block 0xfd, offset 0x529
-	{value: 0x0012, lo: 0x80, hi: 0x87},
-	{value: 0x0013, lo: 0x88, hi: 0xa1},
-	{value: 0x0012, lo: 0xa2, hi: 0xbb},
-	{value: 0x0013, lo: 0xbc, hi: 0xbf},
-	// Block 0xfe, offset 0x52d
-	{value: 0x0013, lo: 0x80, hi: 0x95},
-	{value: 0x0012, lo: 0x96, hi: 0xaf},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0xff, offset 0x530
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0012, lo: 0x8a, hi: 0xa5},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0x100, offset 0x533
-	{value: 0x0013, lo: 0x80, hi: 0x80},
-	{value: 0x0012, lo: 0x82, hi: 0x9a},
-	{value: 0x0012, lo: 0x9c, hi: 0xa1},
-	{value: 0x0013, lo: 0xa2, hi: 0xba},
-	{value: 0x0012, lo: 0xbc, hi: 0xbf},
-	// Block 0x101, offset 0x538
-	{value: 0x0012, lo: 0x80, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0xb4},
-	{value: 0x0012, lo: 0xb6, hi: 0xbf},
-	// Block 0x102, offset 0x53c
-	{value: 0x0012, lo: 0x80, hi: 0x8e},
-	{value: 0x0012, lo: 0x90, hi: 0x95},
-	{value: 0x0013, lo: 0x96, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x103, offset 0x540
-	{value: 0x0012, lo: 0x80, hi: 0x88},
-	{value: 0x0012, lo: 0x8a, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0x104, offset 0x544
-	{value: 0x0012, lo: 0x80, hi: 0x82},
-	{value: 0x0012, lo: 0x84, hi: 0x89},
-	{value: 0x0017, lo: 0x8a, hi: 0x8b},
-	{value: 0x0010, lo: 0x8e, hi: 0xbf},
-	// Block 0x105, offset 0x548
-	{value: 0x0014, lo: 0x80, hi: 0xb6},
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x106, offset 0x54a
-	{value: 0x0014, lo: 0x80, hi: 0xac},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x107, offset 0x54c
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x9b, hi: 0x9f},
-	{value: 0x0014, lo: 0xa1, hi: 0xaf},
-	// Block 0x108, offset 0x54f
-	{value: 0x0024, lo: 0x80, hi: 0x86},
-	{value: 0x0024, lo: 0x88, hi: 0x98},
-	{value: 0x0024, lo: 0x9b, hi: 0xa1},
-	{value: 0x0024, lo: 0xa3, hi: 0xa4},
-	{value: 0x0024, lo: 0xa6, hi: 0xaa},
-	// Block 0x109, offset 0x554
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0034, lo: 0x90, hi: 0x96},
-	// Block 0x10a, offset 0x556
-	{value: 0xb552, lo: 0x80, hi: 0x81},
-	{value: 0xb852, lo: 0x82, hi: 0x83},
-	{value: 0x0024, lo: 0x84, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x10b, offset 0x55b
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x9f},
-	{value: 0x0010, lo: 0xa1, hi: 0xa2},
-	{value: 0x0010, lo: 0xa4, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb7},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	// Block 0x10c, offset 0x564
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x9b},
-	{value: 0x0010, lo: 0xa1, hi: 0xa3},
-	{value: 0x0010, lo: 0xa5, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xbb},
-	// Block 0x10d, offset 0x569
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x10e, offset 0x56a
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x10f, offset 0x56d
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	// Block 0x110, offset 0x56e
-	{value: 0x0004, lo: 0xbb, hi: 0xbf},
-	// Block 0x111, offset 0x56f
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0014, lo: 0xa0, hi: 0xbf},
-	// Block 0x112, offset 0x571
-	{value: 0x0014, lo: 0x80, hi: 0xbf},
-	// Block 0x113, offset 0x572
-	{value: 0x0014, lo: 0x80, hi: 0xaf},
-}
-
-// Total table size 14177 bytes (13KiB); checksum: F17D40E8
diff --git a/vendor/golang.org/x/text/cases/tables11.0.0.go b/vendor/golang.org/x/text/cases/tables11.0.0.go
deleted file mode 100644
index b1106b4171..0000000000
--- a/vendor/golang.org/x/text/cases/tables11.0.0.go
+++ /dev/null
@@ -1,2317 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-//go:build go1.13 && !go1.14
-// +build go1.13,!go1.14
-
-package cases
-
-// UnicodeVersion is the Unicode version from which the tables in this package are derived.
-const UnicodeVersion = "11.0.0"
-
-var xorData string = "" + // Size: 188 bytes
-	"\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" +
-	"\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" +
-	"\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" +
-	"\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" +
-	"\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" +
-	"\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" +
-	"\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a" +
-	"\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&" +
-	"\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00" +
-	"\x01\x22"
-
-var exceptions string = "" + // Size: 2436 bytes
-	"\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" +
-	"\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" +
-	"\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" +
-	"\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" +
-	"\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" +
-	"\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" +
-	"Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" +
-	"\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა\x10\x1bᲑბ" +
-	"\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ\x10\x1bᲘი" +
-	"\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ\x10\x1bᲟჟ" +
-	"\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ\x10\x1bᲦღ" +
-	"\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ\x10\x1bᲭჭ" +
-	"\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ\x10\x1bᲴჴ" +
-	"\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ\x10\x1bᲽჽ" +
-	"\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12сСС\x12\x12" +
-	"тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗ" +
-	"T̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14" +
-	"$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ" +
-	"\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈ" +
-	"Ι\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15" +
-	"\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ" +
-	"\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ" +
-	"\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠι" +
-	"ὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧι" +
-	"ὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ" +
-	"\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ" +
-	"\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ" +
-	"\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΙ" +
-	"̈́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓" +
-	"\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x16" +
-	"6ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽ" +
-	"ɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ" +
-	"\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ" +
-	"\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl" +
-	"\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄ" +
-	"ն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ"
-
-// lookup returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookup(s []byte) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupUnsafe(s []byte) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// lookupString returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookupString(s string) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupStringUnsafe(s string) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// caseTrie. Total size: 12250 bytes (11.96 KiB). Checksum: 53ff6cb7321675e1.
-type caseTrie struct{}
-
-func newCaseTrie(i int) *caseTrie {
-	return &caseTrie{}
-}
-
-// lookupValue determines the type of block n and looks up the value for b.
-func (t *caseTrie) lookupValue(n uint32, b byte) uint16 {
-	switch {
-	case n < 20:
-		return uint16(caseValues[n<<6+uint32(b)])
-	default:
-		n -= 20
-		return uint16(sparse.lookup(n, b))
-	}
-}
-
-// caseValues: 22 blocks, 1408 entries, 2816 bytes
-// The third block is the zero block.
-var caseValues = [1408]uint16{
-	// Block 0x0, offset 0x0
-	0x27: 0x0054,
-	0x2e: 0x0054,
-	0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010,
-	0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054,
-	// Block 0x1, offset 0x40
-	0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013,
-	0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013,
-	0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013,
-	0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013,
-	0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013,
-	0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012,
-	0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012,
-	0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012,
-	0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012,
-	0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012,
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112,
-	0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713,
-	0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313,
-	0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653,
-	0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53,
-	0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112,
-	0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853,
-	0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13,
-	0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313,
-	0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010,
-	0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452,
-	// Block 0x4, offset 0x100
-	0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359,
-	0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619,
-	0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313,
-	0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13,
-	0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452,
-	0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112,
-	0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112,
-	0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112,
-	0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112,
-	0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112,
-	0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112,
-	// Block 0x5, offset 0x140
-	0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53,
-	0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112,
-	0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a,
-	0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152,
-	0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012,
-	0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052,
-	0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652,
-	0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52,
-	0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252,
-	0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012,
-	0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012,
-	// Block 0x6, offset 0x180
-	0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012,
-	0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52,
-	0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012,
-	0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012,
-	0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a,
-	0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012,
-	0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012,
-	0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012,
-	0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015,
-	0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014,
-	0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d,
-	0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024,
-	0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024,
-	0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024,
-	0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034,
-	0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024,
-	0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024,
-	0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024,
-	0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004,
-	0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52,
-	0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353,
-	// Block 0x8, offset 0x200
-	0x204: 0x0004, 0x205: 0x0004,
-	0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513,
-	0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013,
-	0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013,
-	0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013,
-	0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53,
-	0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53,
-	0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512,
-	0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012,
-	0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012,
-	0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012,
-	// Block 0x9, offset 0x240
-	0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52,
-	0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52,
-	0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a,
-	0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812,
-	0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112,
-	0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112,
-	0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112,
-	0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112,
-	0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a,
-	0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112,
-	0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053,
-	// Block 0xa, offset 0x280
-	0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852,
-	0x286: 0x6852, 0x287: 0x198a, 0x288: 0x0012,
-	0x291: 0x0034,
-	0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024,
-	0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024,
-	0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034,
-	0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024,
-	0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024,
-	0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034,
-	0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034,
-	0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034,
-	// Block 0xb, offset 0x2c0
-	0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053,
-	0x2c7: 0x7053,
-	0x2cd: 0x7053, 0x2d0: 0x1a6a, 0x2d1: 0x1aea,
-	0x2d2: 0x1b6a, 0x2d3: 0x1bea, 0x2d4: 0x1c6a, 0x2d5: 0x1cea, 0x2d6: 0x1d6a, 0x2d7: 0x1dea,
-	0x2d8: 0x1e6a, 0x2d9: 0x1eea, 0x2da: 0x1f6a, 0x2db: 0x1fea, 0x2dc: 0x206a, 0x2dd: 0x20ea,
-	0x2de: 0x216a, 0x2df: 0x21ea, 0x2e0: 0x226a, 0x2e1: 0x22ea, 0x2e2: 0x236a, 0x2e3: 0x23ea,
-	0x2e4: 0x246a, 0x2e5: 0x24ea, 0x2e6: 0x256a, 0x2e7: 0x25ea, 0x2e8: 0x266a, 0x2e9: 0x26ea,
-	0x2ea: 0x276a, 0x2eb: 0x27ea, 0x2ec: 0x286a, 0x2ed: 0x28ea, 0x2ee: 0x296a, 0x2ef: 0x29ea,
-	0x2f0: 0x2a6a, 0x2f1: 0x2aea, 0x2f2: 0x2b6a, 0x2f3: 0x2bea, 0x2f4: 0x2c6a, 0x2f5: 0x2cea,
-	0x2f6: 0x2d6a, 0x2f7: 0x2dea, 0x2f8: 0x2e6a, 0x2f9: 0x2eea, 0x2fa: 0x2f6a,
-	0x2fc: 0x0014, 0x2fd: 0x2fea, 0x2fe: 0x306a, 0x2ff: 0x30ea,
-	// Block 0xc, offset 0x300
-	0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812,
-	0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813,
-	0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3a9a, 0x311: 0x0812,
-	0x312: 0x3b7a, 0x313: 0x0812, 0x314: 0x3cba, 0x315: 0x0812, 0x316: 0x3dfa, 0x317: 0x0812,
-	0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813,
-	0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812,
-	0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813,
-	0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813,
-	0x330: 0x8e52, 0x331: 0x8e52, 0x332: 0x9152, 0x333: 0x9152, 0x334: 0x9452, 0x335: 0x9452,
-	0x336: 0x9752, 0x337: 0x9752, 0x338: 0x9a52, 0x339: 0x9a52, 0x33a: 0x9d52, 0x33b: 0x9d52,
-	0x33c: 0x4d52, 0x33d: 0x4d52,
-	// Block 0xd, offset 0x340
-	0x340: 0x3f3a, 0x341: 0x402a, 0x342: 0x411a, 0x343: 0x420a, 0x344: 0x42fa, 0x345: 0x43ea,
-	0x346: 0x44da, 0x347: 0x45ca, 0x348: 0x46b9, 0x349: 0x47a9, 0x34a: 0x4899, 0x34b: 0x4989,
-	0x34c: 0x4a79, 0x34d: 0x4b69, 0x34e: 0x4c59, 0x34f: 0x4d49, 0x350: 0x4e3a, 0x351: 0x4f2a,
-	0x352: 0x501a, 0x353: 0x510a, 0x354: 0x51fa, 0x355: 0x52ea, 0x356: 0x53da, 0x357: 0x54ca,
-	0x358: 0x55b9, 0x359: 0x56a9, 0x35a: 0x5799, 0x35b: 0x5889, 0x35c: 0x5979, 0x35d: 0x5a69,
-	0x35e: 0x5b59, 0x35f: 0x5c49, 0x360: 0x5d3a, 0x361: 0x5e2a, 0x362: 0x5f1a, 0x363: 0x600a,
-	0x364: 0x60fa, 0x365: 0x61ea, 0x366: 0x62da, 0x367: 0x63ca, 0x368: 0x64b9, 0x369: 0x65a9,
-	0x36a: 0x6699, 0x36b: 0x6789, 0x36c: 0x6879, 0x36d: 0x6969, 0x36e: 0x6a59, 0x36f: 0x6b49,
-	0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6c3a, 0x373: 0x6d4a, 0x374: 0x6e1a,
-	0x376: 0x6efa, 0x377: 0x6fda, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x8e53, 0x37b: 0x8e53,
-	0x37c: 0x7119, 0x37d: 0x0004, 0x37e: 0x71ea, 0x37f: 0x0004,
-	// Block 0xe, offset 0x380
-	0x380: 0x0004, 0x381: 0x0004, 0x382: 0x726a, 0x383: 0x737a, 0x384: 0x744a,
-	0x386: 0x752a, 0x387: 0x760a, 0x388: 0x9153, 0x389: 0x9153, 0x38a: 0x9453, 0x38b: 0x9453,
-	0x38c: 0x7749, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812,
-	0x392: 0x781a, 0x393: 0x795a, 0x396: 0x7a9a, 0x397: 0x7b7a,
-	0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9753, 0x39b: 0x9753, 0x39d: 0x0004,
-	0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7cba, 0x3a3: 0x7dfa,
-	0x3a4: 0x7f3a, 0x3a5: 0x0912, 0x3a6: 0x801a, 0x3a7: 0x80fa, 0x3a8: 0x0813, 0x3a9: 0x0813,
-	0x3aa: 0x9d53, 0x3ab: 0x9d53, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004,
-	0x3b2: 0x823a, 0x3b3: 0x834a, 0x3b4: 0x841a,
-	0x3b6: 0x84fa, 0x3b7: 0x85da, 0x3b8: 0x9a53, 0x3b9: 0x9a53, 0x3ba: 0x4d53, 0x3bb: 0x4d53,
-	0x3bc: 0x8719, 0x3bd: 0x0004, 0x3be: 0x0004,
-	// Block 0xf, offset 0x3c0
-	0x3c2: 0x0013,
-	0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013,
-	0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013,
-	0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013,
-	0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013,
-	0x3e4: 0x0013, 0x3e6: 0x87eb, 0x3e8: 0x0013,
-	0x3ea: 0x884b, 0x3eb: 0x888b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012,
-	0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa053, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010,
-	0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012,
-	0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013,
-	// Block 0x10, offset 0x400
-	0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13,
-	0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13,
-	0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa352, 0x411: 0xa352,
-	0x412: 0xa652, 0x413: 0xa652, 0x414: 0xa952, 0x415: 0xa952, 0x416: 0xa652, 0x417: 0xa652,
-	0x418: 0xa352, 0x419: 0xa352, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12,
-	0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12,
-	0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612,
-	// Block 0x11, offset 0x440
-	0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552,
-	0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552,
-	0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xac52, 0x451: 0xac52,
-	0x452: 0xac52, 0x453: 0xac52, 0x454: 0xac52, 0x455: 0xac52, 0x456: 0xac52, 0x457: 0xac52,
-	0x458: 0xac52, 0x459: 0xac52, 0x45a: 0xac52, 0x45b: 0xac52, 0x45c: 0xac52, 0x45d: 0xac52,
-	0x45e: 0xac52, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x88eb, 0x463: 0x8b53,
-	0x464: 0x894b, 0x465: 0x89aa, 0x466: 0x8a0a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313,
-	0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8a6b, 0x46e: 0x8acb, 0x46f: 0x8b2b,
-	0x470: 0x8b8b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313,
-	0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012,
-	0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8beb, 0x47f: 0x8c4b,
-	// Block 0x12, offset 0x480
-	0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112,
-	0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713,
-	0x48c: 0x0712, 0x48d: 0x8cab, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112,
-	0x492: 0x0113, 0x493: 0x0112, 0x494: 0x0012, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112,
-	0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112,
-	0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112,
-	0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112,
-	0x4aa: 0x8d0b, 0x4ab: 0x8d6b, 0x4ac: 0x8dcb, 0x4ad: 0x8e2b, 0x4ae: 0x8e8b, 0x4af: 0x0012,
-	0x4b0: 0x8eeb, 0x4b1: 0x8f4b, 0x4b2: 0x8fab, 0x4b3: 0xaf53, 0x4b4: 0x0113, 0x4b5: 0x0112,
-	0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112,
-	// Block 0x13, offset 0x4c0
-	0x4c0: 0x900a, 0x4c1: 0x908a, 0x4c2: 0x910a, 0x4c3: 0x918a, 0x4c4: 0x923a, 0x4c5: 0x92ea,
-	0x4c6: 0x936a,
-	0x4d3: 0x93ea, 0x4d4: 0x94ca, 0x4d5: 0x95aa, 0x4d6: 0x968a, 0x4d7: 0x976a,
-	0x4dd: 0x0010,
-	0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010,
-	0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010,
-	0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010,
-	0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010,
-	0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010,
-	0x4fc: 0x0010, 0x4fe: 0x0010,
-	// Block 0x14, offset 0x500
-	0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213,
-	0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613,
-	0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213,
-	0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13,
-	0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213,
-	0x51e: 0xb853, 0x51f: 0xb853, 0x520: 0xbb53, 0x521: 0xbb53, 0x522: 0x2212, 0x523: 0x2212,
-	0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12,
-	0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212,
-	0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612,
-	0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212,
-	0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212,
-	// Block 0x15, offset 0x540
-	0x542: 0x0010,
-	0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010,
-	0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010,
-	0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010,
-	0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010,
-	0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010,
-	0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010,
-	0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010,
-	0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010,
-	0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010,
-	0x57c: 0x0010, 0x57e: 0x0010,
-}
-
-// caseIndex: 25 blocks, 1600 entries, 3200 bytes
-// Block 0 is the zero block.
-var caseIndex = [1600]uint16{
-	// Block 0x0, offset 0x0
-	// Block 0x1, offset 0x40
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02,
-	0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07,
-	0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21,
-	0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29,
-	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
-	0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09,
-	0xf0: 0x14, 0xf3: 0x16,
-	// Block 0x4, offset 0x100
-	0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31,
-	0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39,
-	0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41,
-	0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49,
-	// Block 0x5, offset 0x140
-	0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24,
-	0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53,
-	0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24,
-	0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b,
-	0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62,
-	0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69,
-	0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71,
-	0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c,
-	// Block 0x6, offset 0x180
-	0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a,
-	0x192: 0x7b, 0x193: 0x0e,
-	0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81,
-	0x1b8: 0x82,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87,
-	// Block 0x8, offset 0x200
-	0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24,
-	0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24,
-	0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24,
-	0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91,
-	0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98,
-	0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0,
-	0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24,
-	0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24,
-	// Block 0x9, offset 0x240
-	0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24,
-	0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24,
-	0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24,
-	0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24,
-	0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24,
-	0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24,
-	0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24,
-	0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24,
-	// Block 0xa, offset 0x280
-	0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24,
-	0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24,
-	0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24,
-	0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2,
-	// Block 0xb, offset 0x2c0
-	0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5,
-	0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9,
-	0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0,
-	// Block 0xc, offset 0x300
-	0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5,
-	0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb,
-	0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1,
-	0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3,
-	0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9,
-	0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf,
-	0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3,
-	0x33c: 0xd4, 0x33d: 0xd5,
-	// Block 0xd, offset 0x340
-	0x340: 0xd6, 0x341: 0xd7, 0x342: 0xd8, 0x343: 0xd9, 0x344: 0xda, 0x345: 0xdb, 0x346: 0xdc, 0x347: 0xdd,
-	0x348: 0xde, 0x34a: 0xdf, 0x34b: 0xe0, 0x34c: 0xe1, 0x34d: 0xe2,
-	0x350: 0xe3, 0x351: 0xe4, 0x352: 0xe5, 0x353: 0xe6, 0x356: 0xe7, 0x357: 0xe8,
-	0x358: 0xe9, 0x359: 0xea, 0x35a: 0xeb, 0x35b: 0xec, 0x35c: 0xed,
-	0x360: 0xee, 0x362: 0xef, 0x363: 0xf0,
-	0x368: 0xf1, 0x369: 0xf2, 0x36a: 0xf3, 0x36b: 0xf4,
-	0x370: 0xf5, 0x371: 0xf6, 0x372: 0xf7, 0x374: 0xf8, 0x375: 0xf9, 0x376: 0xfa,
-	0x37b: 0xfb,
-	// Block 0xe, offset 0x380
-	0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24,
-	0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xfc,
-	0x390: 0x24, 0x391: 0xfd, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0xfe,
-	// Block 0xf, offset 0x3c0
-	0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24,
-	0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24,
-	0x3d0: 0xfd,
-	// Block 0x10, offset 0x400
-	0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24,
-	0x418: 0x24, 0x419: 0xff,
-	// Block 0x11, offset 0x440
-	0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24,
-	0x468: 0xf4, 0x469: 0x100, 0x46b: 0x101, 0x46c: 0x102, 0x46d: 0x103, 0x46e: 0x104,
-	0x479: 0x105, 0x47c: 0x24, 0x47d: 0x106, 0x47e: 0x107, 0x47f: 0x108,
-	// Block 0x12, offset 0x480
-	0x4b0: 0x24, 0x4b1: 0x109, 0x4b2: 0x10a,
-	// Block 0x13, offset 0x4c0
-	0x4c5: 0x10b, 0x4c6: 0x10c,
-	0x4c9: 0x10d,
-	0x4d0: 0x10e, 0x4d1: 0x10f, 0x4d2: 0x110, 0x4d3: 0x111, 0x4d4: 0x112, 0x4d5: 0x113, 0x4d6: 0x114, 0x4d7: 0x115,
-	0x4d8: 0x116, 0x4d9: 0x117, 0x4da: 0x118, 0x4db: 0x119, 0x4dc: 0x11a, 0x4dd: 0x11b, 0x4de: 0x11c, 0x4df: 0x11d,
-	0x4e8: 0x11e, 0x4e9: 0x11f, 0x4ea: 0x120,
-	// Block 0x14, offset 0x500
-	0x500: 0x121,
-	0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x122, 0x524: 0x12, 0x525: 0x123,
-	0x538: 0x124, 0x539: 0x13, 0x53a: 0x125,
-	// Block 0x15, offset 0x540
-	0x544: 0x126, 0x545: 0x127, 0x546: 0x128,
-	0x54f: 0x129,
-	// Block 0x16, offset 0x580
-	0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f,
-	0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13,
-	// Block 0x17, offset 0x5c0
-	0x5c0: 0x12a, 0x5c1: 0x12b, 0x5c4: 0x12b, 0x5c5: 0x12b, 0x5c6: 0x12b, 0x5c7: 0x12c,
-	// Block 0x18, offset 0x600
-	0x620: 0x15,
-}
-
-// sparseOffsets: 282 entries, 564 bytes
-var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x280, 0x282, 0x289, 0x28b, 0x297, 0x298, 0x2a3, 0x2ab, 0x2b3, 0x2b9, 0x2ba, 0x2c8, 0x2cd, 0x2d0, 0x2d5, 0x2d9, 0x2df, 0x2e4, 0x2e7, 0x2ec, 0x2f1, 0x2f2, 0x2f8, 0x2fa, 0x2fb, 0x2fd, 0x2ff, 0x302, 0x303, 0x305, 0x308, 0x30e, 0x312, 0x314, 0x319, 0x320, 0x324, 0x32d, 0x32e, 0x337, 0x33b, 0x340, 0x348, 0x34e, 0x354, 0x35e, 0x363, 0x36c, 0x372, 0x379, 0x37d, 0x385, 0x387, 0x389, 0x38c, 0x38e, 0x390, 0x391, 0x392, 0x394, 0x396, 0x39c, 0x3a1, 0x3a3, 0x3a9, 0x3ac, 0x3ae, 0x3b4, 0x3b9, 0x3bb, 0x3bc, 0x3bd, 0x3be, 0x3c0, 0x3c2, 0x3c4, 0x3c7, 0x3c9, 0x3cc, 0x3d4, 0x3d7, 0x3db, 0x3e3, 0x3e5, 0x3e6, 0x3e7, 0x3e9, 0x3ef, 0x3f1, 0x3f2, 0x3f4, 0x3f6, 0x3f8, 0x405, 0x406, 0x407, 0x40b, 0x40d, 0x40e, 0x40f, 0x410, 0x411, 0x414, 0x417, 0x41d, 0x421, 0x425, 0x42b, 0x42e, 0x435, 0x439, 0x43d, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x477, 0x47d, 0x483, 0x489, 0x48c, 0x492, 0x495, 0x49d, 0x49e, 0x4a5, 0x4a9, 0x4aa, 0x4ad, 0x4b5, 0x4bb, 0x4c2, 0x4c3, 0x4c9, 0x4cc, 0x4d4, 0x4db, 0x4e5, 0x4ed, 0x4f0, 0x4f1, 0x4f2, 0x4f3, 0x4f4, 0x4f6, 0x4f8, 0x4fa, 0x4fe, 0x4ff, 0x501, 0x503, 0x504, 0x505, 0x507, 0x50c, 0x511, 0x515, 0x516, 0x519, 0x51d, 0x528, 0x52c, 0x534, 0x539, 0x53d, 0x540, 0x544, 0x547, 0x54a, 0x54f, 0x553, 0x557, 0x55b, 0x55f, 0x561, 0x563, 0x566, 0x56b, 0x56d, 0x572, 0x57b, 0x580, 0x581, 0x584, 0x585, 0x586, 0x588, 0x589, 0x58a}
-
-// sparseValues: 1418 entries, 5672 bytes
-var sparseValues = [1418]valueRange{
-	// Block 0x0, offset 0x0
-	{value: 0x0004, lo: 0xa8, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xaa},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0004, lo: 0xaf, hi: 0xaf},
-	{value: 0x0004, lo: 0xb4, hi: 0xb4},
-	{value: 0x001a, lo: 0xb5, hi: 0xb5},
-	{value: 0x0054, lo: 0xb7, hi: 0xb7},
-	{value: 0x0004, lo: 0xb8, hi: 0xb8},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	// Block 0x1, offset 0x9
-	{value: 0x2013, lo: 0x80, hi: 0x96},
-	{value: 0x2013, lo: 0x98, hi: 0x9e},
-	{value: 0x009a, lo: 0x9f, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xb6},
-	{value: 0x2012, lo: 0xb8, hi: 0xbe},
-	{value: 0x0252, lo: 0xbf, hi: 0xbf},
-	// Block 0x2, offset 0xf
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x011b, lo: 0xb0, hi: 0xb0},
-	{value: 0x019a, lo: 0xb1, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb7},
-	{value: 0x0012, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x0553, lo: 0xbf, hi: 0xbf},
-	// Block 0x3, offset 0x18
-	{value: 0x0552, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x01da, lo: 0x89, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xb7},
-	{value: 0x0253, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x028a, lo: 0xbf, hi: 0xbf},
-	// Block 0x4, offset 0x24
-	{value: 0x0117, lo: 0x80, hi: 0x9f},
-	{value: 0x2f53, lo: 0xa0, hi: 0xa0},
-	{value: 0x0012, lo: 0xa1, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xb3},
-	{value: 0x0012, lo: 0xb4, hi: 0xb9},
-	{value: 0x090b, lo: 0xba, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x2953, lo: 0xbd, hi: 0xbd},
-	{value: 0x098b, lo: 0xbe, hi: 0xbe},
-	{value: 0x0a0a, lo: 0xbf, hi: 0xbf},
-	// Block 0x5, offset 0x2e
-	{value: 0x0015, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x97},
-	{value: 0x0004, lo: 0x98, hi: 0x9d},
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0015, lo: 0xa0, hi: 0xa4},
-	{value: 0x0004, lo: 0xa5, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xbf},
-	// Block 0x6, offset 0x35
-	{value: 0x0024, lo: 0x80, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbf},
-	// Block 0x7, offset 0x38
-	{value: 0x6553, lo: 0x80, hi: 0x8f},
-	{value: 0x2013, lo: 0x90, hi: 0x9f},
-	{value: 0x5f53, lo: 0xa0, hi: 0xaf},
-	{value: 0x2012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8, offset 0x3c
-	{value: 0x5f52, lo: 0x80, hi: 0x8f},
-	{value: 0x6552, lo: 0x90, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x9, offset 0x3f
-	{value: 0x0117, lo: 0x80, hi: 0x81},
-	{value: 0x0024, lo: 0x83, hi: 0x87},
-	{value: 0x0014, lo: 0x88, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xbf},
-	// Block 0xa, offset 0x43
-	{value: 0x0f13, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x0316, lo: 0x89, hi: 0x8a},
-	{value: 0x0716, lo: 0x8b, hi: 0x8c},
-	{value: 0x0316, lo: 0x8d, hi: 0x8e},
-	{value: 0x0f12, lo: 0x8f, hi: 0x8f},
-	{value: 0x0117, lo: 0x90, hi: 0xbf},
-	// Block 0xb, offset 0x4d
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x6553, lo: 0xb1, hi: 0xbf},
-	// Block 0xc, offset 0x4f
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6853, lo: 0x90, hi: 0x96},
-	{value: 0x0014, lo: 0x99, hi: 0x99},
-	{value: 0x0010, lo: 0x9b, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0012, lo: 0xa0, hi: 0xa0},
-	{value: 0x6552, lo: 0xa1, hi: 0xaf},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0xd, offset 0x57
-	{value: 0x0034, lo: 0x81, hi: 0x82},
-	{value: 0x0024, lo: 0x84, hi: 0x84},
-	{value: 0x0034, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0xaa},
-	{value: 0x0010, lo: 0xaf, hi: 0xb3},
-	{value: 0x0054, lo: 0xb4, hi: 0xb4},
-	// Block 0xe, offset 0x5e
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0024, lo: 0x90, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0014, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xf, offset 0x63
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9c},
-	{value: 0x0024, lo: 0x9d, hi: 0x9e},
-	{value: 0x0034, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0034, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x10, offset 0x71
-	{value: 0x0010, lo: 0x80, hi: 0xbf},
-	// Block 0x11, offset 0x72
-	{value: 0x0010, lo: 0x80, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0024, lo: 0x9f, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xaa, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x12, offset 0x80
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0034, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0034, lo: 0xb1, hi: 0xb1},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbd},
-	{value: 0x0034, lo: 0xbe, hi: 0xbe},
-	{value: 0x0024, lo: 0xbf, hi: 0xbf},
-	// Block 0x13, offset 0x8f
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0024, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x88},
-	{value: 0x0024, lo: 0x89, hi: 0x8a},
-	{value: 0x0010, lo: 0x8d, hi: 0xbf},
-	// Block 0x14, offset 0x99
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x15, offset 0x9c
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xb1},
-	{value: 0x0034, lo: 0xb2, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0x16, offset 0xa3
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x99},
-	{value: 0x0014, lo: 0x9a, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0xa3},
-	{value: 0x0014, lo: 0xa4, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xad},
-	// Block 0x17, offset 0xab
-	{value: 0x0010, lo: 0x80, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0xa0, hi: 0xaa},
-	// Block 0x18, offset 0xae
-	{value: 0x0010, lo: 0xa0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbd},
-	// Block 0x19, offset 0xb0
-	{value: 0x0034, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0024, lo: 0xaa, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbf},
-	// Block 0x1a, offset 0xbf
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1b, offset 0xc5
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0x1c, offset 0xd3
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb6, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1d, offset 0xde
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xb1},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	// Block 0x1e, offset 0xeb
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x1f, offset 0xf6
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x99, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x20, offset 0x102
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x21, offset 0x10c
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x85},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xbf},
-	// Block 0x22, offset 0x118
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x23, offset 0x123
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x24, offset 0x12f
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0010, lo: 0xa8, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x25, offset 0x13b
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x26, offset 0x143
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb9},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbf},
-	// Block 0x27, offset 0x14c
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x88},
-	{value: 0x0014, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x28, offset 0x156
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x29, offset 0x161
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb2},
-	// Block 0x2a, offset 0x16d
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x2b, offset 0x174
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x94, hi: 0x97},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xba, hi: 0xbf},
-	// Block 0x2c, offset 0x17f
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x96},
-	{value: 0x0010, lo: 0x9a, hi: 0xb1},
-	{value: 0x0010, lo: 0xb3, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x2d, offset 0x184
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x94},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9f},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	// Block 0x2e, offset 0x18c
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xba},
-	// Block 0x2f, offset 0x18f
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x30, offset 0x194
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xb9},
-	{value: 0x0014, lo: 0xbb, hi: 0xbc},
-	// Block 0x31, offset 0x198
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x32, offset 0x19c
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0034, lo: 0x98, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0034, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x33, offset 0x1a3
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xac},
-	{value: 0x0034, lo: 0xb1, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xba, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x34, offset 0x1ac
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0024, lo: 0x82, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x86, hi: 0x87},
-	{value: 0x0010, lo: 0x88, hi: 0x8c},
-	{value: 0x0014, lo: 0x8d, hi: 0x97},
-	{value: 0x0014, lo: 0x99, hi: 0xbc},
-	// Block 0x35, offset 0x1b4
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	// Block 0x36, offset 0x1b5
-	{value: 0x0010, lo: 0xab, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbe},
-	// Block 0x37, offset 0x1be
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x96, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x99},
-	{value: 0x0014, lo: 0x9e, hi: 0xa0},
-	{value: 0x0010, lo: 0xa2, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xad},
-	{value: 0x0014, lo: 0xb1, hi: 0xb4},
-	// Block 0x38, offset 0x1c5
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x6c53, lo: 0xa0, hi: 0xbf},
-	// Block 0x39, offset 0x1cd
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x9a, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x3a, offset 0x1d3
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x3b, offset 0x1d8
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x82, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3c, offset 0x1dc
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3d, offset 0x1df
-	{value: 0x0010, lo: 0x80, hi: 0x9a},
-	{value: 0x0024, lo: 0x9d, hi: 0x9f},
-	// Block 0x3e, offset 0x1e1
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x7453, lo: 0xa0, hi: 0xaf},
-	{value: 0x7853, lo: 0xb0, hi: 0xbf},
-	// Block 0x3f, offset 0x1e4
-	{value: 0x7c53, lo: 0x80, hi: 0x8f},
-	{value: 0x8053, lo: 0x90, hi: 0x9f},
-	{value: 0x7c53, lo: 0xa0, hi: 0xaf},
-	{value: 0x0813, lo: 0xb0, hi: 0xb5},
-	{value: 0x0892, lo: 0xb8, hi: 0xbd},
-	// Block 0x40, offset 0x1e9
-	{value: 0x0010, lo: 0x81, hi: 0xbf},
-	// Block 0x41, offset 0x1ea
-	{value: 0x0010, lo: 0x80, hi: 0xac},
-	{value: 0x0010, lo: 0xaf, hi: 0xbf},
-	// Block 0x42, offset 0x1ec
-	{value: 0x0010, lo: 0x81, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x43, offset 0x1ee
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb8},
-	// Block 0x44, offset 0x1f0
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0034, lo: 0x94, hi: 0x94},
-	{value: 0x0010, lo: 0xa0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	// Block 0x45, offset 0x1f7
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xac},
-	{value: 0x0010, lo: 0xae, hi: 0xb0},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	// Block 0x46, offset 0x1fc
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x47, offset 0x200
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x89, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0014, lo: 0x93, hi: 0x93},
-	{value: 0x0004, lo: 0x97, hi: 0x97},
-	{value: 0x0024, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0x48, offset 0x209
-	{value: 0x0014, lo: 0x8b, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x49, offset 0x20c
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb8},
-	// Block 0x4a, offset 0x20f
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x4b, offset 0x215
-	{value: 0x0010, lo: 0x80, hi: 0xb5},
-	// Block 0x4c, offset 0x216
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbb},
-	// Block 0x4d, offset 0x221
-	{value: 0x0010, lo: 0x86, hi: 0x8f},
-	// Block 0x4e, offset 0x222
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x4f, offset 0x223
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	// Block 0x50, offset 0x228
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x9e},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xac},
-	{value: 0x0010, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xbc},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x51, offset 0x235
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xa7, hi: 0xa7},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	{value: 0x0034, lo: 0xb5, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbc},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0x52, offset 0x23d
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x53, offset 0x245
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0030, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8b},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xab, hi: 0xab},
-	{value: 0x0034, lo: 0xac, hi: 0xac},
-	{value: 0x0024, lo: 0xad, hi: 0xb3},
-	// Block 0x54, offset 0x24e
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0030, lo: 0xaa, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbf},
-	// Block 0x55, offset 0x257
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0030, lo: 0xb2, hi: 0xb3},
-	// Block 0x56, offset 0x260
-	{value: 0x0010, lo: 0x80, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0x57, offset 0x265
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8d, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x58, offset 0x268
-	{value: 0x316a, lo: 0x80, hi: 0x80},
-	{value: 0x31ea, lo: 0x81, hi: 0x81},
-	{value: 0x326a, lo: 0x82, hi: 0x82},
-	{value: 0x32ea, lo: 0x83, hi: 0x83},
-	{value: 0x336a, lo: 0x84, hi: 0x84},
-	{value: 0x33ea, lo: 0x85, hi: 0x85},
-	{value: 0x346a, lo: 0x86, hi: 0x86},
-	{value: 0x34ea, lo: 0x87, hi: 0x87},
-	{value: 0x356a, lo: 0x88, hi: 0x88},
-	{value: 0x8353, lo: 0x90, hi: 0xba},
-	{value: 0x8353, lo: 0xbd, hi: 0xbf},
-	// Block 0x59, offset 0x273
-	{value: 0x0024, lo: 0x90, hi: 0x92},
-	{value: 0x0034, lo: 0x94, hi: 0x99},
-	{value: 0x0024, lo: 0x9a, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9f},
-	{value: 0x0024, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0034, lo: 0xa2, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xb3},
-	{value: 0x0024, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb7},
-	{value: 0x0024, lo: 0xb8, hi: 0xb9},
-	// Block 0x5a, offset 0x280
-	{value: 0x0012, lo: 0x80, hi: 0xab},
-	{value: 0x0015, lo: 0xac, hi: 0xbf},
-	// Block 0x5b, offset 0x282
-	{value: 0x0015, lo: 0x80, hi: 0xaa},
-	{value: 0x0012, lo: 0xab, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb8},
-	{value: 0x8752, lo: 0xb9, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbc},
-	{value: 0x8b52, lo: 0xbd, hi: 0xbd},
-	{value: 0x0012, lo: 0xbe, hi: 0xbf},
-	// Block 0x5c, offset 0x289
-	{value: 0x0012, lo: 0x80, hi: 0x9a},
-	{value: 0x0015, lo: 0x9b, hi: 0xbf},
-	// Block 0x5d, offset 0x28b
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0024, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb9},
-	{value: 0x0024, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbd},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x5e, offset 0x297
-	{value: 0x0117, lo: 0x80, hi: 0xbf},
-	// Block 0x5f, offset 0x298
-	{value: 0x0117, lo: 0x80, hi: 0x95},
-	{value: 0x361a, lo: 0x96, hi: 0x96},
-	{value: 0x36ca, lo: 0x97, hi: 0x97},
-	{value: 0x377a, lo: 0x98, hi: 0x98},
-	{value: 0x382a, lo: 0x99, hi: 0x99},
-	{value: 0x38da, lo: 0x9a, hi: 0x9a},
-	{value: 0x398a, lo: 0x9b, hi: 0x9b},
-	{value: 0x0012, lo: 0x9c, hi: 0x9d},
-	{value: 0x3a3b, lo: 0x9e, hi: 0x9e},
-	{value: 0x0012, lo: 0x9f, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x60, offset 0x2a3
-	{value: 0x0812, lo: 0x80, hi: 0x87},
-	{value: 0x0813, lo: 0x88, hi: 0x8f},
-	{value: 0x0812, lo: 0x90, hi: 0x95},
-	{value: 0x0813, lo: 0x98, hi: 0x9d},
-	{value: 0x0812, lo: 0xa0, hi: 0xa7},
-	{value: 0x0813, lo: 0xa8, hi: 0xaf},
-	{value: 0x0812, lo: 0xb0, hi: 0xb7},
-	{value: 0x0813, lo: 0xb8, hi: 0xbf},
-	// Block 0x61, offset 0x2ab
-	{value: 0x0004, lo: 0x8b, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8f},
-	{value: 0x0054, lo: 0x98, hi: 0x99},
-	{value: 0x0054, lo: 0xa4, hi: 0xa4},
-	{value: 0x0054, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xaa, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xaf},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x62, offset 0x2b3
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x94, hi: 0x94},
-	{value: 0x0014, lo: 0xa0, hi: 0xa4},
-	{value: 0x0014, lo: 0xa6, hi: 0xaf},
-	{value: 0x0015, lo: 0xb1, hi: 0xb1},
-	{value: 0x0015, lo: 0xbf, hi: 0xbf},
-	// Block 0x63, offset 0x2b9
-	{value: 0x0015, lo: 0x90, hi: 0x9c},
-	// Block 0x64, offset 0x2ba
-	{value: 0x0024, lo: 0x90, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0xa0},
-	{value: 0x0024, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa4},
-	{value: 0x0034, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa7},
-	{value: 0x0034, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xa9},
-	{value: 0x0034, lo: 0xaa, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	// Block 0x65, offset 0x2c8
-	{value: 0x0016, lo: 0x85, hi: 0x86},
-	{value: 0x0012, lo: 0x87, hi: 0x89},
-	{value: 0xa052, lo: 0x8e, hi: 0x8e},
-	{value: 0x1013, lo: 0xa0, hi: 0xaf},
-	{value: 0x1012, lo: 0xb0, hi: 0xbf},
-	// Block 0x66, offset 0x2cd
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x88},
-	// Block 0x67, offset 0x2d0
-	{value: 0xa353, lo: 0xb6, hi: 0xb7},
-	{value: 0xa653, lo: 0xb8, hi: 0xb9},
-	{value: 0xa953, lo: 0xba, hi: 0xbb},
-	{value: 0xa653, lo: 0xbc, hi: 0xbd},
-	{value: 0xa353, lo: 0xbe, hi: 0xbf},
-	// Block 0x68, offset 0x2d5
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6553, lo: 0x90, hi: 0x9f},
-	{value: 0xac53, lo: 0xa0, hi: 0xae},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0x69, offset 0x2d9
-	{value: 0x0117, lo: 0x80, hi: 0xa3},
-	{value: 0x0012, lo: 0xa4, hi: 0xa4},
-	{value: 0x0716, lo: 0xab, hi: 0xac},
-	{value: 0x0316, lo: 0xad, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb3},
-	// Block 0x6a, offset 0x2df
-	{value: 0x6c52, lo: 0x80, hi: 0x9f},
-	{value: 0x7052, lo: 0xa0, hi: 0xa5},
-	{value: 0x7052, lo: 0xa7, hi: 0xa7},
-	{value: 0x7052, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x6b, offset 0x2e4
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x6c, offset 0x2e7
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0010, lo: 0xb0, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x6d, offset 0x2ec
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9e},
-	{value: 0x0024, lo: 0xa0, hi: 0xbf},
-	// Block 0x6e, offset 0x2f1
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	// Block 0x6f, offset 0x2f2
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0xaa, hi: 0xad},
-	{value: 0x0030, lo: 0xae, hi: 0xaf},
-	{value: 0x0004, lo: 0xb1, hi: 0xb5},
-	{value: 0x0014, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	// Block 0x70, offset 0x2f8
-	{value: 0x0034, lo: 0x99, hi: 0x9a},
-	{value: 0x0004, lo: 0x9b, hi: 0x9e},
-	// Block 0x71, offset 0x2fa
-	{value: 0x0004, lo: 0xbc, hi: 0xbe},
-	// Block 0x72, offset 0x2fb
-	{value: 0x0010, lo: 0x85, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x73, offset 0x2fd
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0010, lo: 0xa0, hi: 0xba},
-	// Block 0x74, offset 0x2ff
-	{value: 0x0010, lo: 0x80, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0xbf},
-	// Block 0x75, offset 0x302
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	// Block 0x76, offset 0x303
-	{value: 0x0010, lo: 0x90, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x77, offset 0x305
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0xab},
-	// Block 0x78, offset 0x308
-	{value: 0x0117, lo: 0x80, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb2},
-	{value: 0x0024, lo: 0xb4, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x79, offset 0x30e
-	{value: 0x0117, lo: 0x80, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9d},
-	{value: 0x0024, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x7a, offset 0x312
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb1},
-	// Block 0x7b, offset 0x314
-	{value: 0x0004, lo: 0x80, hi: 0x96},
-	{value: 0x0014, lo: 0x97, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xaf},
-	{value: 0x0012, lo: 0xb0, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xbf},
-	// Block 0x7c, offset 0x319
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x0015, lo: 0xb0, hi: 0xb0},
-	{value: 0x0012, lo: 0xb1, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x8753, lo: 0xbd, hi: 0xbd},
-	{value: 0x0117, lo: 0xbe, hi: 0xbf},
-	// Block 0x7d, offset 0x320
-	{value: 0x0010, lo: 0xb7, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbf},
-	// Block 0x7e, offset 0x324
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8b},
-	{value: 0x0010, lo: 0x8c, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	// Block 0x7f, offset 0x32d
-	{value: 0x0010, lo: 0x80, hi: 0xb3},
-	// Block 0x80, offset 0x32e
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xa0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb7},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x81, offset 0x337
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x82, offset 0x33b
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0x92},
-	{value: 0x0030, lo: 0x93, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0x83, offset 0x340
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb9},
-	{value: 0x0010, lo: 0xba, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x84, offset 0x348
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0004, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x85, offset 0x34e
-	{value: 0x0010, lo: 0x80, hi: 0xa8},
-	{value: 0x0014, lo: 0xa9, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0x86, offset 0x354
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x87, offset 0x35e
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0024, lo: 0xbe, hi: 0xbf},
-	// Block 0x88, offset 0x363
-	{value: 0x0024, lo: 0x81, hi: 0x81},
-	{value: 0x0004, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	// Block 0x89, offset 0x36c
-	{value: 0x0010, lo: 0x81, hi: 0x86},
-	{value: 0x0010, lo: 0x89, hi: 0x8e},
-	{value: 0x0010, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8a, offset 0x372
-	{value: 0x0012, lo: 0x80, hi: 0x92},
-	{value: 0xaf52, lo: 0x93, hi: 0x93},
-	{value: 0x0012, lo: 0x94, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9f},
-	{value: 0x0012, lo: 0xa0, hi: 0xa5},
-	{value: 0x74d2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8b, offset 0x379
-	{value: 0x78d2, lo: 0x80, hi: 0x8f},
-	{value: 0x7cd2, lo: 0x90, hi: 0x9f},
-	{value: 0x80d2, lo: 0xa0, hi: 0xaf},
-	{value: 0x7cd2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8c, offset 0x37d
-	{value: 0x0010, lo: 0x80, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x8d, offset 0x385
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x8e, offset 0x387
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x8b, hi: 0xbb},
-	// Block 0x8f, offset 0x389
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0xbf},
-	// Block 0x90, offset 0x38c
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0004, lo: 0xb2, hi: 0xbf},
-	// Block 0x91, offset 0x38e
-	{value: 0x0004, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x93, hi: 0xbf},
-	// Block 0x92, offset 0x390
-	{value: 0x0010, lo: 0x80, hi: 0xbd},
-	// Block 0x93, offset 0x391
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0x94, offset 0x392
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0xbf},
-	// Block 0x95, offset 0x394
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0xb0, hi: 0xbb},
-	// Block 0x96, offset 0x396
-	{value: 0x0014, lo: 0x80, hi: 0x8f},
-	{value: 0x0054, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0xa0, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xad},
-	{value: 0x0024, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	// Block 0x97, offset 0x39c
-	{value: 0x0010, lo: 0x8d, hi: 0x8f},
-	{value: 0x0054, lo: 0x92, hi: 0x92},
-	{value: 0x0054, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0xb0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0x98, offset 0x3a1
-	{value: 0x0010, lo: 0x80, hi: 0xbc},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x99, offset 0x3a3
-	{value: 0x0054, lo: 0x87, hi: 0x87},
-	{value: 0x0054, lo: 0x8e, hi: 0x8e},
-	{value: 0x0054, lo: 0x9a, hi: 0x9a},
-	{value: 0x5f53, lo: 0xa1, hi: 0xba},
-	{value: 0x0004, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9a, offset 0x3a9
-	{value: 0x0004, lo: 0x80, hi: 0x80},
-	{value: 0x5f52, lo: 0x81, hi: 0x9a},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	// Block 0x9b, offset 0x3ac
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbe},
-	// Block 0x9c, offset 0x3ae
-	{value: 0x0010, lo: 0x82, hi: 0x87},
-	{value: 0x0010, lo: 0x8a, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0x97},
-	{value: 0x0010, lo: 0x9a, hi: 0x9c},
-	{value: 0x0004, lo: 0xa3, hi: 0xa3},
-	{value: 0x0014, lo: 0xb9, hi: 0xbb},
-	// Block 0x9d, offset 0x3b4
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0010, lo: 0x8d, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xba},
-	{value: 0x0010, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9e, offset 0x3b9
-	{value: 0x0010, lo: 0x80, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x9d},
-	// Block 0x9f, offset 0x3bb
-	{value: 0x0010, lo: 0x80, hi: 0xba},
-	// Block 0xa0, offset 0x3bc
-	{value: 0x0010, lo: 0x80, hi: 0xb4},
-	// Block 0xa1, offset 0x3bd
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0xa2, offset 0x3be
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa3, offset 0x3c0
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	// Block 0xa4, offset 0x3c2
-	{value: 0x0010, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xad, hi: 0xbf},
-	// Block 0xa5, offset 0x3c4
-	{value: 0x0010, lo: 0x80, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0xb5},
-	{value: 0x0024, lo: 0xb6, hi: 0xba},
-	// Block 0xa6, offset 0x3c7
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa7, offset 0x3c9
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x91, hi: 0x95},
-	// Block 0xa8, offset 0x3cc
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x97},
-	{value: 0xb253, lo: 0x98, hi: 0x9f},
-	{value: 0xb553, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbf},
-	// Block 0xa9, offset 0x3d4
-	{value: 0xb252, lo: 0x80, hi: 0x87},
-	{value: 0xb552, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0xaa, offset 0x3d7
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0xb553, lo: 0xb0, hi: 0xb7},
-	{value: 0xb253, lo: 0xb8, hi: 0xbf},
-	// Block 0xab, offset 0x3db
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x93},
-	{value: 0xb552, lo: 0x98, hi: 0x9f},
-	{value: 0xb252, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbb},
-	// Block 0xac, offset 0x3e3
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xad, offset 0x3e5
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	// Block 0xae, offset 0x3e6
-	{value: 0x0010, lo: 0x80, hi: 0xb6},
-	// Block 0xaf, offset 0x3e7
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xa7},
-	// Block 0xb0, offset 0x3e9
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xb5},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xb1, offset 0x3ef
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb6},
-	// Block 0xb2, offset 0x3f1
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	// Block 0xb3, offset 0x3f2
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	// Block 0xb4, offset 0x3f4
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb9},
-	// Block 0xb5, offset 0x3f6
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0xb6, offset 0x3f8
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x8e, hi: 0x8e},
-	{value: 0x0024, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x99, hi: 0xb5},
-	{value: 0x0024, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xb7, offset 0x405
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0xb8, offset 0x406
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	// Block 0xb9, offset 0x407
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	// Block 0xba, offset 0x40b
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	// Block 0xbb, offset 0x40d
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	// Block 0xbc, offset 0x40e
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	// Block 0xbd, offset 0x40f
-	{value: 0x5653, lo: 0x80, hi: 0xb2},
-	// Block 0xbe, offset 0x410
-	{value: 0x5652, lo: 0x80, hi: 0xb2},
-	// Block 0xbf, offset 0x411
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xc0, offset 0x414
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xc1, offset 0x417
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x87},
-	{value: 0x0024, lo: 0x88, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x8b},
-	{value: 0x0024, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	// Block 0xc2, offset 0x41d
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xc3, offset 0x421
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xc4, offset 0x425
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb6},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	// Block 0xc5, offset 0x42b
-	{value: 0x0014, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xc6, offset 0x42e
-	{value: 0x0024, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0xc7, offset 0x435
-	{value: 0x0010, lo: 0x84, hi: 0x86},
-	{value: 0x0010, lo: 0x90, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	// Block 0xc8, offset 0x439
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xc9, offset 0x43d
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x89, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	// Block 0xca, offset 0x444
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb4},
-	{value: 0x0030, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xb7},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0xcb, offset 0x44d
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xcc, offset 0x453
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa2},
-	{value: 0x0014, lo: 0xa3, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xcd, offset 0x459
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xce, offset 0x463
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0030, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9d, hi: 0xa3},
-	{value: 0x0024, lo: 0xa6, hi: 0xac},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	// Block 0xcf, offset 0x46d
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xd0, offset 0x46f
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0x9e, hi: 0x9e},
-	// Block 0xd1, offset 0x477
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xd2, offset 0x47d
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd3, offset 0x483
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd4, offset 0x489
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x98, hi: 0x9b},
-	{value: 0x0014, lo: 0x9c, hi: 0x9d},
-	// Block 0xd5, offset 0x48c
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd6, offset 0x492
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd7, offset 0x495
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0014, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb5},
-	{value: 0x0030, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0xd8, offset 0x49d
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	// Block 0xd9, offset 0x49e
-	{value: 0x0014, lo: 0x9d, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xda, offset 0x4a5
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	// Block 0xdb, offset 0x4a9
-	{value: 0x5f53, lo: 0xa0, hi: 0xbf},
-	// Block 0xdc, offset 0x4aa
-	{value: 0x5f52, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xdd, offset 0x4ad
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x8a},
-	{value: 0x0010, lo: 0x8b, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbb, hi: 0xbe},
-	// Block 0xde, offset 0x4b5
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0014, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x98},
-	{value: 0x0014, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0x9c, hi: 0xbf},
-	// Block 0xdf, offset 0x4bb
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x86, hi: 0x89},
-	{value: 0x0014, lo: 0x8a, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x99},
-	{value: 0x0010, lo: 0x9d, hi: 0x9d},
-	// Block 0xe0, offset 0x4c2
-	{value: 0x0010, lo: 0x80, hi: 0xb8},
-	// Block 0xe1, offset 0x4c3
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb6},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xe2, offset 0x4c9
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0xe3, offset 0x4cc
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0014, lo: 0x92, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xa9},
-	{value: 0x0014, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0xe4, offset 0x4d4
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb6},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xe5, offset 0x4db
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa5},
-	{value: 0x0010, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xbf},
-	// Block 0xe6, offset 0x4e5
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0014, lo: 0x90, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0x96},
-	{value: 0x0034, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xe7, offset 0x4ed
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	// Block 0xe8, offset 0x4f0
-	{value: 0x0010, lo: 0x80, hi: 0x99},
-	// Block 0xe9, offset 0x4f1
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	// Block 0xea, offset 0x4f2
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	// Block 0xeb, offset 0x4f3
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	// Block 0xec, offset 0x4f4
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xed, offset 0x4f6
-	{value: 0x0010, lo: 0x90, hi: 0xad},
-	{value: 0x0034, lo: 0xb0, hi: 0xb4},
-	// Block 0xee, offset 0x4f8
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb6},
-	// Block 0xef, offset 0x4fa
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa3, hi: 0xb7},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xf0, offset 0x4fe
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	// Block 0xf1, offset 0x4ff
-	{value: 0x2013, lo: 0x80, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xbf},
-	// Block 0xf2, offset 0x501
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0xbe},
-	// Block 0xf3, offset 0x503
-	{value: 0x0014, lo: 0x8f, hi: 0x9f},
-	// Block 0xf4, offset 0x504
-	{value: 0x0014, lo: 0xa0, hi: 0xa1},
-	// Block 0xf5, offset 0x505
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbc},
-	// Block 0xf6, offset 0x507
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0034, lo: 0x9e, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa3},
-	// Block 0xf7, offset 0x50c
-	{value: 0x0030, lo: 0xa5, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xa9},
-	{value: 0x0030, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbf},
-	// Block 0xf8, offset 0x511
-	{value: 0x0034, lo: 0x80, hi: 0x82},
-	{value: 0x0024, lo: 0x85, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8b},
-	{value: 0x0024, lo: 0xaa, hi: 0xad},
-	// Block 0xf9, offset 0x515
-	{value: 0x0024, lo: 0x82, hi: 0x84},
-	// Block 0xfa, offset 0x516
-	{value: 0x0013, lo: 0x80, hi: 0x99},
-	{value: 0x0012, lo: 0x9a, hi: 0xb3},
-	{value: 0x0013, lo: 0xb4, hi: 0xbf},
-	// Block 0xfb, offset 0x519
-	{value: 0x0013, lo: 0x80, hi: 0x8d},
-	{value: 0x0012, lo: 0x8e, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0xa7},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0xfc, offset 0x51d
-	{value: 0x0013, lo: 0x80, hi: 0x81},
-	{value: 0x0012, lo: 0x82, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0x9c},
-	{value: 0x0013, lo: 0x9e, hi: 0x9f},
-	{value: 0x0013, lo: 0xa2, hi: 0xa2},
-	{value: 0x0013, lo: 0xa5, hi: 0xa6},
-	{value: 0x0013, lo: 0xa9, hi: 0xac},
-	{value: 0x0013, lo: 0xae, hi: 0xb5},
-	{value: 0x0012, lo: 0xb6, hi: 0xb9},
-	{value: 0x0012, lo: 0xbb, hi: 0xbb},
-	{value: 0x0012, lo: 0xbd, hi: 0xbf},
-	// Block 0xfd, offset 0x528
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0012, lo: 0x85, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0xfe, offset 0x52c
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0013, lo: 0x84, hi: 0x85},
-	{value: 0x0013, lo: 0x87, hi: 0x8a},
-	{value: 0x0013, lo: 0x8d, hi: 0x94},
-	{value: 0x0013, lo: 0x96, hi: 0x9c},
-	{value: 0x0012, lo: 0x9e, hi: 0xb7},
-	{value: 0x0013, lo: 0xb8, hi: 0xb9},
-	{value: 0x0013, lo: 0xbb, hi: 0xbe},
-	// Block 0xff, offset 0x534
-	{value: 0x0013, lo: 0x80, hi: 0x84},
-	{value: 0x0013, lo: 0x86, hi: 0x86},
-	{value: 0x0013, lo: 0x8a, hi: 0x90},
-	{value: 0x0012, lo: 0x92, hi: 0xab},
-	{value: 0x0013, lo: 0xac, hi: 0xbf},
-	// Block 0x100, offset 0x539
-	{value: 0x0013, lo: 0x80, hi: 0x85},
-	{value: 0x0012, lo: 0x86, hi: 0x9f},
-	{value: 0x0013, lo: 0xa0, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbf},
-	// Block 0x101, offset 0x53d
-	{value: 0x0012, lo: 0x80, hi: 0x93},
-	{value: 0x0013, lo: 0x94, hi: 0xad},
-	{value: 0x0012, lo: 0xae, hi: 0xbf},
-	// Block 0x102, offset 0x540
-	{value: 0x0012, lo: 0x80, hi: 0x87},
-	{value: 0x0013, lo: 0x88, hi: 0xa1},
-	{value: 0x0012, lo: 0xa2, hi: 0xbb},
-	{value: 0x0013, lo: 0xbc, hi: 0xbf},
-	// Block 0x103, offset 0x544
-	{value: 0x0013, lo: 0x80, hi: 0x95},
-	{value: 0x0012, lo: 0x96, hi: 0xaf},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x104, offset 0x547
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0012, lo: 0x8a, hi: 0xa5},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0x105, offset 0x54a
-	{value: 0x0013, lo: 0x80, hi: 0x80},
-	{value: 0x0012, lo: 0x82, hi: 0x9a},
-	{value: 0x0012, lo: 0x9c, hi: 0xa1},
-	{value: 0x0013, lo: 0xa2, hi: 0xba},
-	{value: 0x0012, lo: 0xbc, hi: 0xbf},
-	// Block 0x106, offset 0x54f
-	{value: 0x0012, lo: 0x80, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0xb4},
-	{value: 0x0012, lo: 0xb6, hi: 0xbf},
-	// Block 0x107, offset 0x553
-	{value: 0x0012, lo: 0x80, hi: 0x8e},
-	{value: 0x0012, lo: 0x90, hi: 0x95},
-	{value: 0x0013, lo: 0x96, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x108, offset 0x557
-	{value: 0x0012, lo: 0x80, hi: 0x88},
-	{value: 0x0012, lo: 0x8a, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0x109, offset 0x55b
-	{value: 0x0012, lo: 0x80, hi: 0x82},
-	{value: 0x0012, lo: 0x84, hi: 0x89},
-	{value: 0x0017, lo: 0x8a, hi: 0x8b},
-	{value: 0x0010, lo: 0x8e, hi: 0xbf},
-	// Block 0x10a, offset 0x55f
-	{value: 0x0014, lo: 0x80, hi: 0xb6},
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x10b, offset 0x561
-	{value: 0x0014, lo: 0x80, hi: 0xac},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x10c, offset 0x563
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x9b, hi: 0x9f},
-	{value: 0x0014, lo: 0xa1, hi: 0xaf},
-	// Block 0x10d, offset 0x566
-	{value: 0x0024, lo: 0x80, hi: 0x86},
-	{value: 0x0024, lo: 0x88, hi: 0x98},
-	{value: 0x0024, lo: 0x9b, hi: 0xa1},
-	{value: 0x0024, lo: 0xa3, hi: 0xa4},
-	{value: 0x0024, lo: 0xa6, hi: 0xaa},
-	// Block 0x10e, offset 0x56b
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0034, lo: 0x90, hi: 0x96},
-	// Block 0x10f, offset 0x56d
-	{value: 0xb852, lo: 0x80, hi: 0x81},
-	{value: 0xbb52, lo: 0x82, hi: 0x83},
-	{value: 0x0024, lo: 0x84, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x110, offset 0x572
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x9f},
-	{value: 0x0010, lo: 0xa1, hi: 0xa2},
-	{value: 0x0010, lo: 0xa4, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb7},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	// Block 0x111, offset 0x57b
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x9b},
-	{value: 0x0010, lo: 0xa1, hi: 0xa3},
-	{value: 0x0010, lo: 0xa5, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xbb},
-	// Block 0x112, offset 0x580
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x113, offset 0x581
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x114, offset 0x584
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	// Block 0x115, offset 0x585
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x116, offset 0x586
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0014, lo: 0xa0, hi: 0xbf},
-	// Block 0x117, offset 0x588
-	{value: 0x0014, lo: 0x80, hi: 0xbf},
-	// Block 0x118, offset 0x589
-	{value: 0x0014, lo: 0x80, hi: 0xaf},
-}
-
-// Total table size 14906 bytes (14KiB); checksum: 362795C7
diff --git a/vendor/golang.org/x/text/cases/tables12.0.0.go b/vendor/golang.org/x/text/cases/tables12.0.0.go
deleted file mode 100644
index ae7dc24072..0000000000
--- a/vendor/golang.org/x/text/cases/tables12.0.0.go
+++ /dev/null
@@ -1,2360 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-//go:build go1.14 && !go1.16
-// +build go1.14,!go1.16
-
-package cases
-
-// UnicodeVersion is the Unicode version from which the tables in this package are derived.
-const UnicodeVersion = "12.0.0"
-
-var xorData string = "" + // Size: 192 bytes
-	"\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" +
-	"\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" +
-	"\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" +
-	"\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" +
-	"\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" +
-	"\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" +
-	"\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" +
-	"\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" +
-	"\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" +
-	"\x1e\x00\x01\x22"
-
-var exceptions string = "" + // Size: 2450 bytes
-	"\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" +
-	"\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" +
-	"\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" +
-	"\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" +
-	"\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" +
-	"\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" +
-	"ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" +
-	"φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" +
-	"\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" +
-	"\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" +
-	"\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" +
-	"\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" +
-	"\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" +
-	"\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" +
-	"\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" +
-	"СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" +
-	"\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" +
-	"\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" +
-	"\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" +
-	"\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" +
-	"\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" +
-	"ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" +
-	"\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" +
-	"\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" +
-	"\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" +
-	"\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" +
-	"ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" +
-	"Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" +
-	"̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" +
-	"́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" +
-	"\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" +
-	"\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" +
-	"\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" +
-	"\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" +
-	"\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" +
-	"STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" +
-	"խ"
-
-// lookup returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookup(s []byte) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupUnsafe(s []byte) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// lookupString returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookupString(s string) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupStringUnsafe(s string) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// caseTrie. Total size: 12396 bytes (12.11 KiB). Checksum: c0656238384c3da1.
-type caseTrie struct{}
-
-func newCaseTrie(i int) *caseTrie {
-	return &caseTrie{}
-}
-
-// lookupValue determines the type of block n and looks up the value for b.
-func (t *caseTrie) lookupValue(n uint32, b byte) uint16 {
-	switch {
-	case n < 20:
-		return uint16(caseValues[n<<6+uint32(b)])
-	default:
-		n -= 20
-		return uint16(sparse.lookup(n, b))
-	}
-}
-
-// caseValues: 22 blocks, 1408 entries, 2816 bytes
-// The third block is the zero block.
-var caseValues = [1408]uint16{
-	// Block 0x0, offset 0x0
-	0x27: 0x0054,
-	0x2e: 0x0054,
-	0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010,
-	0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054,
-	// Block 0x1, offset 0x40
-	0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013,
-	0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013,
-	0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013,
-	0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013,
-	0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013,
-	0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012,
-	0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012,
-	0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012,
-	0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012,
-	0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012,
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112,
-	0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713,
-	0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313,
-	0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653,
-	0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53,
-	0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112,
-	0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853,
-	0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13,
-	0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313,
-	0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010,
-	0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452,
-	// Block 0x4, offset 0x100
-	0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359,
-	0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619,
-	0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313,
-	0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13,
-	0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452,
-	0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112,
-	0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112,
-	0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112,
-	0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112,
-	0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112,
-	0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112,
-	// Block 0x5, offset 0x140
-	0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53,
-	0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112,
-	0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a,
-	0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152,
-	0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012,
-	0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052,
-	0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652,
-	0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52,
-	0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252,
-	0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012,
-	0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012,
-	// Block 0x6, offset 0x180
-	0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012,
-	0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52,
-	0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012,
-	0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012,
-	0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a,
-	0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012,
-	0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012,
-	0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012,
-	0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015,
-	0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014,
-	0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d,
-	0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024,
-	0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024,
-	0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024,
-	0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034,
-	0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024,
-	0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024,
-	0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024,
-	0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004,
-	0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52,
-	0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353,
-	// Block 0x8, offset 0x200
-	0x204: 0x0004, 0x205: 0x0004,
-	0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513,
-	0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013,
-	0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013,
-	0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013,
-	0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53,
-	0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53,
-	0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512,
-	0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012,
-	0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012,
-	0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012,
-	// Block 0x9, offset 0x240
-	0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52,
-	0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52,
-	0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a,
-	0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812,
-	0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112,
-	0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112,
-	0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112,
-	0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112,
-	0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a,
-	0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112,
-	0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053,
-	// Block 0xa, offset 0x280
-	0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852,
-	0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012,
-	0x291: 0x0034,
-	0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024,
-	0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024,
-	0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034,
-	0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024,
-	0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024,
-	0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034,
-	0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034,
-	0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034,
-	// Block 0xb, offset 0x2c0
-	0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053,
-	0x2c7: 0x7053,
-	0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a,
-	0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a,
-	0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a,
-	0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a,
-	0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a,
-	0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a,
-	0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a,
-	0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea,
-	0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a,
-	// Block 0xc, offset 0x300
-	0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812,
-	0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813,
-	0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812,
-	0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812,
-	0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813,
-	0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812,
-	0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813,
-	0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813,
-	0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852,
-	0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152,
-	0x33c: 0x4d52, 0x33d: 0x4d52,
-	// Block 0xd, offset 0x340
-	0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a,
-	0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09,
-	0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa,
-	0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a,
-	0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9,
-	0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a,
-	0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629,
-	0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9,
-	0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a,
-	0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253,
-	0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004,
-	// Block 0xe, offset 0x380
-	0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca,
-	0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853,
-	0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812,
-	0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa,
-	0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004,
-	0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a,
-	0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813,
-	0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004,
-	0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a,
-	0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53,
-	0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004,
-	// Block 0xf, offset 0x3c0
-	0x3c2: 0x0013,
-	0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013,
-	0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013,
-	0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013,
-	0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013,
-	0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013,
-	0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012,
-	0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010,
-	0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012,
-	0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013,
-	// Block 0x10, offset 0x400
-	0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13,
-	0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13,
-	0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752,
-	0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52,
-	0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12,
-	0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12,
-	0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612,
-	// Block 0x11, offset 0x440
-	0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552,
-	0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552,
-	0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052,
-	0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052,
-	0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052,
-	0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53,
-	0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313,
-	0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab,
-	0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313,
-	0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012,
-	0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb,
-	// Block 0x12, offset 0x480
-	0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112,
-	0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713,
-	0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112,
-	0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112,
-	0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112,
-	0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112,
-	0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112,
-	0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012,
-	0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112,
-	0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112,
-	0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112,
-	// Block 0x13, offset 0x4c0
-	0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca,
-	0x4c6: 0x944a,
-	0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a,
-	0x4dd: 0x0010,
-	0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010,
-	0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010,
-	0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010,
-	0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010,
-	0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010,
-	0x4fc: 0x0010, 0x4fe: 0x0010,
-	// Block 0x14, offset 0x500
-	0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213,
-	0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613,
-	0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213,
-	0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13,
-	0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213,
-	0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212,
-	0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12,
-	0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212,
-	0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612,
-	0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212,
-	0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212,
-	// Block 0x15, offset 0x540
-	0x542: 0x0010,
-	0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010,
-	0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010,
-	0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010,
-	0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010,
-	0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010,
-	0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010,
-	0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010,
-	0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010,
-	0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010,
-	0x57c: 0x0010, 0x57e: 0x0010,
-}
-
-// caseIndex: 25 blocks, 1600 entries, 3200 bytes
-// Block 0 is the zero block.
-var caseIndex = [1600]uint16{
-	// Block 0x0, offset 0x0
-	// Block 0x1, offset 0x40
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02,
-	0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07,
-	0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21,
-	0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29,
-	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
-	0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09,
-	0xf0: 0x14, 0xf3: 0x16,
-	// Block 0x4, offset 0x100
-	0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31,
-	0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39,
-	0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41,
-	0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49,
-	// Block 0x5, offset 0x140
-	0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24,
-	0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53,
-	0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24,
-	0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b,
-	0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62,
-	0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69,
-	0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71,
-	0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c,
-	// Block 0x6, offset 0x180
-	0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a,
-	0x192: 0x7b, 0x193: 0x0e,
-	0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81,
-	0x1b8: 0x82,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87,
-	// Block 0x8, offset 0x200
-	0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24,
-	0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24,
-	0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24,
-	0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91,
-	0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98,
-	0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0,
-	0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24,
-	0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24,
-	// Block 0x9, offset 0x240
-	0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24,
-	0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24,
-	0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24,
-	0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24,
-	0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24,
-	0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24,
-	0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24,
-	0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24,
-	// Block 0xa, offset 0x280
-	0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24,
-	0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24,
-	0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24,
-	0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2,
-	// Block 0xb, offset 0x2c0
-	0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5,
-	0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9,
-	0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0,
-	// Block 0xc, offset 0x300
-	0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5,
-	0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb,
-	0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1,
-	0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3,
-	0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9,
-	0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf,
-	0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3,
-	0x33c: 0xd4, 0x33d: 0xd5, 0x33f: 0xd6,
-	// Block 0xd, offset 0x340
-	0x340: 0xd7, 0x341: 0xd8, 0x342: 0xd9, 0x343: 0xda, 0x344: 0xdb, 0x345: 0xdc, 0x346: 0xdd, 0x347: 0xde,
-	0x348: 0xdf, 0x34a: 0xe0, 0x34b: 0xe1, 0x34c: 0xe2, 0x34d: 0xe3,
-	0x350: 0xe4, 0x351: 0xe5, 0x352: 0xe6, 0x353: 0xe7, 0x356: 0xe8, 0x357: 0xe9,
-	0x358: 0xea, 0x359: 0xeb, 0x35a: 0xec, 0x35b: 0xed, 0x35c: 0xee,
-	0x360: 0xef, 0x362: 0xf0, 0x363: 0xf1, 0x366: 0xf2, 0x367: 0xf3,
-	0x368: 0xf4, 0x369: 0xf5, 0x36a: 0xf6, 0x36b: 0xf7,
-	0x370: 0xf8, 0x371: 0xf9, 0x372: 0xfa, 0x374: 0xfb, 0x375: 0xfc, 0x376: 0xfd,
-	0x37b: 0xfe,
-	// Block 0xe, offset 0x380
-	0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24,
-	0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xff,
-	0x390: 0x24, 0x391: 0x100, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x101,
-	// Block 0xf, offset 0x3c0
-	0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24,
-	0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24,
-	0x3d0: 0x102,
-	// Block 0x10, offset 0x400
-	0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24,
-	0x418: 0x24, 0x419: 0x103,
-	// Block 0x11, offset 0x440
-	0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24,
-	0x468: 0xf7, 0x469: 0x104, 0x46b: 0x105, 0x46c: 0x106, 0x46d: 0x107, 0x46e: 0x108,
-	0x479: 0x109, 0x47c: 0x24, 0x47d: 0x10a, 0x47e: 0x10b, 0x47f: 0x10c,
-	// Block 0x12, offset 0x480
-	0x4b0: 0x24, 0x4b1: 0x10d, 0x4b2: 0x10e,
-	// Block 0x13, offset 0x4c0
-	0x4c5: 0x10f, 0x4c6: 0x110,
-	0x4c9: 0x111,
-	0x4d0: 0x112, 0x4d1: 0x113, 0x4d2: 0x114, 0x4d3: 0x115, 0x4d4: 0x116, 0x4d5: 0x117, 0x4d6: 0x118, 0x4d7: 0x119,
-	0x4d8: 0x11a, 0x4d9: 0x11b, 0x4da: 0x11c, 0x4db: 0x11d, 0x4dc: 0x11e, 0x4dd: 0x11f, 0x4de: 0x120, 0x4df: 0x121,
-	0x4e8: 0x122, 0x4e9: 0x123, 0x4ea: 0x124,
-	// Block 0x14, offset 0x500
-	0x500: 0x125, 0x504: 0x126, 0x505: 0x127,
-	0x50b: 0x128,
-	0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x129, 0x524: 0x12, 0x525: 0x12a,
-	0x538: 0x12b, 0x539: 0x13, 0x53a: 0x12c,
-	// Block 0x15, offset 0x540
-	0x544: 0x12d, 0x545: 0x12e, 0x546: 0x12f,
-	0x54f: 0x130,
-	// Block 0x16, offset 0x580
-	0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f,
-	0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13,
-	// Block 0x17, offset 0x5c0
-	0x5c0: 0x131, 0x5c1: 0x132, 0x5c4: 0x132, 0x5c5: 0x132, 0x5c6: 0x132, 0x5c7: 0x133,
-	// Block 0x18, offset 0x600
-	0x620: 0x15,
-}
-
-// sparseOffsets: 289 entries, 578 bytes
-var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x281, 0x283, 0x28a, 0x28e, 0x29a, 0x29b, 0x2a6, 0x2ae, 0x2b6, 0x2bc, 0x2bd, 0x2cb, 0x2d0, 0x2d3, 0x2d8, 0x2dc, 0x2e2, 0x2e7, 0x2ea, 0x2ef, 0x2f4, 0x2f5, 0x2fb, 0x2fd, 0x2fe, 0x300, 0x302, 0x305, 0x306, 0x308, 0x30b, 0x311, 0x315, 0x317, 0x31c, 0x323, 0x32b, 0x334, 0x335, 0x33e, 0x342, 0x347, 0x34f, 0x355, 0x35b, 0x365, 0x36a, 0x373, 0x379, 0x380, 0x384, 0x38c, 0x38e, 0x390, 0x393, 0x395, 0x397, 0x398, 0x399, 0x39b, 0x39d, 0x3a3, 0x3a8, 0x3aa, 0x3b1, 0x3b4, 0x3b6, 0x3bc, 0x3c1, 0x3c3, 0x3c4, 0x3c5, 0x3c6, 0x3c8, 0x3ca, 0x3cc, 0x3cf, 0x3d1, 0x3d4, 0x3dc, 0x3df, 0x3e3, 0x3eb, 0x3ed, 0x3ee, 0x3ef, 0x3f1, 0x3f7, 0x3f9, 0x3fa, 0x3fc, 0x3fe, 0x400, 0x40d, 0x40e, 0x40f, 0x413, 0x415, 0x416, 0x417, 0x418, 0x419, 0x41c, 0x41f, 0x425, 0x426, 0x42a, 0x42e, 0x434, 0x437, 0x43e, 0x442, 0x446, 0x44d, 0x456, 0x45c, 0x462, 0x46c, 0x476, 0x478, 0x481, 0x487, 0x48d, 0x493, 0x496, 0x49c, 0x49f, 0x4a8, 0x4a9, 0x4b0, 0x4b4, 0x4b5, 0x4b8, 0x4ba, 0x4c1, 0x4c9, 0x4cf, 0x4d5, 0x4d6, 0x4dc, 0x4df, 0x4e7, 0x4ee, 0x4f8, 0x500, 0x503, 0x504, 0x505, 0x506, 0x508, 0x509, 0x50b, 0x50d, 0x50f, 0x513, 0x514, 0x516, 0x519, 0x51b, 0x51d, 0x51f, 0x524, 0x529, 0x52d, 0x52e, 0x531, 0x535, 0x540, 0x544, 0x54c, 0x551, 0x555, 0x558, 0x55c, 0x55f, 0x562, 0x567, 0x56b, 0x56f, 0x573, 0x577, 0x579, 0x57b, 0x57e, 0x583, 0x586, 0x588, 0x58b, 0x58d, 0x593, 0x59c, 0x5a1, 0x5a2, 0x5a5, 0x5a6, 0x5a7, 0x5a9, 0x5aa, 0x5ab}
-
-// sparseValues: 1451 entries, 5804 bytes
-var sparseValues = [1451]valueRange{
-	// Block 0x0, offset 0x0
-	{value: 0x0004, lo: 0xa8, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xaa},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0004, lo: 0xaf, hi: 0xaf},
-	{value: 0x0004, lo: 0xb4, hi: 0xb4},
-	{value: 0x001a, lo: 0xb5, hi: 0xb5},
-	{value: 0x0054, lo: 0xb7, hi: 0xb7},
-	{value: 0x0004, lo: 0xb8, hi: 0xb8},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	// Block 0x1, offset 0x9
-	{value: 0x2013, lo: 0x80, hi: 0x96},
-	{value: 0x2013, lo: 0x98, hi: 0x9e},
-	{value: 0x009a, lo: 0x9f, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xb6},
-	{value: 0x2012, lo: 0xb8, hi: 0xbe},
-	{value: 0x0252, lo: 0xbf, hi: 0xbf},
-	// Block 0x2, offset 0xf
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x011b, lo: 0xb0, hi: 0xb0},
-	{value: 0x019a, lo: 0xb1, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb7},
-	{value: 0x0012, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x0553, lo: 0xbf, hi: 0xbf},
-	// Block 0x3, offset 0x18
-	{value: 0x0552, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x01da, lo: 0x89, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xb7},
-	{value: 0x0253, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x028a, lo: 0xbf, hi: 0xbf},
-	// Block 0x4, offset 0x24
-	{value: 0x0117, lo: 0x80, hi: 0x9f},
-	{value: 0x2f53, lo: 0xa0, hi: 0xa0},
-	{value: 0x0012, lo: 0xa1, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xb3},
-	{value: 0x0012, lo: 0xb4, hi: 0xb9},
-	{value: 0x090b, lo: 0xba, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x2953, lo: 0xbd, hi: 0xbd},
-	{value: 0x098b, lo: 0xbe, hi: 0xbe},
-	{value: 0x0a0a, lo: 0xbf, hi: 0xbf},
-	// Block 0x5, offset 0x2e
-	{value: 0x0015, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x97},
-	{value: 0x0004, lo: 0x98, hi: 0x9d},
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0015, lo: 0xa0, hi: 0xa4},
-	{value: 0x0004, lo: 0xa5, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xbf},
-	// Block 0x6, offset 0x35
-	{value: 0x0024, lo: 0x80, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbf},
-	// Block 0x7, offset 0x38
-	{value: 0x6553, lo: 0x80, hi: 0x8f},
-	{value: 0x2013, lo: 0x90, hi: 0x9f},
-	{value: 0x5f53, lo: 0xa0, hi: 0xaf},
-	{value: 0x2012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8, offset 0x3c
-	{value: 0x5f52, lo: 0x80, hi: 0x8f},
-	{value: 0x6552, lo: 0x90, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x9, offset 0x3f
-	{value: 0x0117, lo: 0x80, hi: 0x81},
-	{value: 0x0024, lo: 0x83, hi: 0x87},
-	{value: 0x0014, lo: 0x88, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xbf},
-	// Block 0xa, offset 0x43
-	{value: 0x0f13, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x0316, lo: 0x89, hi: 0x8a},
-	{value: 0x0716, lo: 0x8b, hi: 0x8c},
-	{value: 0x0316, lo: 0x8d, hi: 0x8e},
-	{value: 0x0f12, lo: 0x8f, hi: 0x8f},
-	{value: 0x0117, lo: 0x90, hi: 0xbf},
-	// Block 0xb, offset 0x4d
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x6553, lo: 0xb1, hi: 0xbf},
-	// Block 0xc, offset 0x4f
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6853, lo: 0x90, hi: 0x96},
-	{value: 0x0014, lo: 0x99, hi: 0x99},
-	{value: 0x0010, lo: 0x9b, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0012, lo: 0xa0, hi: 0xa0},
-	{value: 0x6552, lo: 0xa1, hi: 0xaf},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0xd, offset 0x57
-	{value: 0x0034, lo: 0x81, hi: 0x82},
-	{value: 0x0024, lo: 0x84, hi: 0x84},
-	{value: 0x0034, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0xaa},
-	{value: 0x0010, lo: 0xaf, hi: 0xb3},
-	{value: 0x0054, lo: 0xb4, hi: 0xb4},
-	// Block 0xe, offset 0x5e
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0024, lo: 0x90, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0014, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xf, offset 0x63
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9c},
-	{value: 0x0024, lo: 0x9d, hi: 0x9e},
-	{value: 0x0034, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0034, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x10, offset 0x71
-	{value: 0x0010, lo: 0x80, hi: 0xbf},
-	// Block 0x11, offset 0x72
-	{value: 0x0010, lo: 0x80, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0024, lo: 0x9f, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xaa, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x12, offset 0x80
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0034, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0034, lo: 0xb1, hi: 0xb1},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbd},
-	{value: 0x0034, lo: 0xbe, hi: 0xbe},
-	{value: 0x0024, lo: 0xbf, hi: 0xbf},
-	// Block 0x13, offset 0x8f
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0024, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x88},
-	{value: 0x0024, lo: 0x89, hi: 0x8a},
-	{value: 0x0010, lo: 0x8d, hi: 0xbf},
-	// Block 0x14, offset 0x99
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x15, offset 0x9c
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xb1},
-	{value: 0x0034, lo: 0xb2, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0x16, offset 0xa3
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x99},
-	{value: 0x0014, lo: 0x9a, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0xa3},
-	{value: 0x0014, lo: 0xa4, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xad},
-	// Block 0x17, offset 0xab
-	{value: 0x0010, lo: 0x80, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0xa0, hi: 0xaa},
-	// Block 0x18, offset 0xae
-	{value: 0x0010, lo: 0xa0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbd},
-	// Block 0x19, offset 0xb0
-	{value: 0x0034, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0024, lo: 0xaa, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbf},
-	// Block 0x1a, offset 0xbf
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1b, offset 0xc5
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0x1c, offset 0xd3
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb6, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1d, offset 0xde
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xb1},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	// Block 0x1e, offset 0xeb
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x1f, offset 0xf6
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x99, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x20, offset 0x102
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x21, offset 0x10c
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x85},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xbf},
-	// Block 0x22, offset 0x118
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x23, offset 0x123
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x24, offset 0x12f
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0010, lo: 0xa8, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x25, offset 0x13b
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x26, offset 0x143
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb9},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbf},
-	// Block 0x27, offset 0x14c
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x88},
-	{value: 0x0014, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x28, offset 0x156
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x29, offset 0x161
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb2},
-	// Block 0x2a, offset 0x16d
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x2b, offset 0x174
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x94, hi: 0x97},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xba, hi: 0xbf},
-	// Block 0x2c, offset 0x17f
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x96},
-	{value: 0x0010, lo: 0x9a, hi: 0xb1},
-	{value: 0x0010, lo: 0xb3, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x2d, offset 0x184
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x94},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9f},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	// Block 0x2e, offset 0x18c
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xba},
-	// Block 0x2f, offset 0x18f
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x30, offset 0x194
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xba},
-	{value: 0x0014, lo: 0xbb, hi: 0xbc},
-	// Block 0x31, offset 0x198
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x32, offset 0x19c
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0034, lo: 0x98, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0034, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x33, offset 0x1a3
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xac},
-	{value: 0x0034, lo: 0xb1, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xba, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x34, offset 0x1ac
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0024, lo: 0x82, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x86, hi: 0x87},
-	{value: 0x0010, lo: 0x88, hi: 0x8c},
-	{value: 0x0014, lo: 0x8d, hi: 0x97},
-	{value: 0x0014, lo: 0x99, hi: 0xbc},
-	// Block 0x35, offset 0x1b4
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	// Block 0x36, offset 0x1b5
-	{value: 0x0010, lo: 0xab, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbe},
-	// Block 0x37, offset 0x1be
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x96, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x99},
-	{value: 0x0014, lo: 0x9e, hi: 0xa0},
-	{value: 0x0010, lo: 0xa2, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xad},
-	{value: 0x0014, lo: 0xb1, hi: 0xb4},
-	// Block 0x38, offset 0x1c5
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x6c53, lo: 0xa0, hi: 0xbf},
-	// Block 0x39, offset 0x1cd
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x9a, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x3a, offset 0x1d3
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x3b, offset 0x1d8
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x82, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3c, offset 0x1dc
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3d, offset 0x1df
-	{value: 0x0010, lo: 0x80, hi: 0x9a},
-	{value: 0x0024, lo: 0x9d, hi: 0x9f},
-	// Block 0x3e, offset 0x1e1
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x7453, lo: 0xa0, hi: 0xaf},
-	{value: 0x7853, lo: 0xb0, hi: 0xbf},
-	// Block 0x3f, offset 0x1e4
-	{value: 0x7c53, lo: 0x80, hi: 0x8f},
-	{value: 0x8053, lo: 0x90, hi: 0x9f},
-	{value: 0x7c53, lo: 0xa0, hi: 0xaf},
-	{value: 0x0813, lo: 0xb0, hi: 0xb5},
-	{value: 0x0892, lo: 0xb8, hi: 0xbd},
-	// Block 0x40, offset 0x1e9
-	{value: 0x0010, lo: 0x81, hi: 0xbf},
-	// Block 0x41, offset 0x1ea
-	{value: 0x0010, lo: 0x80, hi: 0xac},
-	{value: 0x0010, lo: 0xaf, hi: 0xbf},
-	// Block 0x42, offset 0x1ec
-	{value: 0x0010, lo: 0x81, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x43, offset 0x1ee
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb8},
-	// Block 0x44, offset 0x1f0
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0034, lo: 0x94, hi: 0x94},
-	{value: 0x0010, lo: 0xa0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	// Block 0x45, offset 0x1f7
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xac},
-	{value: 0x0010, lo: 0xae, hi: 0xb0},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	// Block 0x46, offset 0x1fc
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x47, offset 0x200
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x89, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0014, lo: 0x93, hi: 0x93},
-	{value: 0x0004, lo: 0x97, hi: 0x97},
-	{value: 0x0024, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0x48, offset 0x209
-	{value: 0x0014, lo: 0x8b, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x49, offset 0x20c
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb8},
-	// Block 0x4a, offset 0x20f
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x4b, offset 0x215
-	{value: 0x0010, lo: 0x80, hi: 0xb5},
-	// Block 0x4c, offset 0x216
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbb},
-	// Block 0x4d, offset 0x221
-	{value: 0x0010, lo: 0x86, hi: 0x8f},
-	// Block 0x4e, offset 0x222
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x4f, offset 0x223
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	// Block 0x50, offset 0x228
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x9e},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xac},
-	{value: 0x0010, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xbc},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x51, offset 0x235
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xa7, hi: 0xa7},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	{value: 0x0034, lo: 0xb5, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbc},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0x52, offset 0x23d
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x53, offset 0x245
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0030, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8b},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xab, hi: 0xab},
-	{value: 0x0034, lo: 0xac, hi: 0xac},
-	{value: 0x0024, lo: 0xad, hi: 0xb3},
-	// Block 0x54, offset 0x24e
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0030, lo: 0xaa, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbf},
-	// Block 0x55, offset 0x257
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0030, lo: 0xb2, hi: 0xb3},
-	// Block 0x56, offset 0x260
-	{value: 0x0010, lo: 0x80, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0x57, offset 0x265
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8d, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x58, offset 0x268
-	{value: 0x31ea, lo: 0x80, hi: 0x80},
-	{value: 0x326a, lo: 0x81, hi: 0x81},
-	{value: 0x32ea, lo: 0x82, hi: 0x82},
-	{value: 0x336a, lo: 0x83, hi: 0x83},
-	{value: 0x33ea, lo: 0x84, hi: 0x84},
-	{value: 0x346a, lo: 0x85, hi: 0x85},
-	{value: 0x34ea, lo: 0x86, hi: 0x86},
-	{value: 0x356a, lo: 0x87, hi: 0x87},
-	{value: 0x35ea, lo: 0x88, hi: 0x88},
-	{value: 0x8353, lo: 0x90, hi: 0xba},
-	{value: 0x8353, lo: 0xbd, hi: 0xbf},
-	// Block 0x59, offset 0x273
-	{value: 0x0024, lo: 0x90, hi: 0x92},
-	{value: 0x0034, lo: 0x94, hi: 0x99},
-	{value: 0x0024, lo: 0x9a, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9f},
-	{value: 0x0024, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0034, lo: 0xa2, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xb3},
-	{value: 0x0024, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb7},
-	{value: 0x0024, lo: 0xb8, hi: 0xb9},
-	{value: 0x0010, lo: 0xba, hi: 0xba},
-	// Block 0x5a, offset 0x281
-	{value: 0x0012, lo: 0x80, hi: 0xab},
-	{value: 0x0015, lo: 0xac, hi: 0xbf},
-	// Block 0x5b, offset 0x283
-	{value: 0x0015, lo: 0x80, hi: 0xaa},
-	{value: 0x0012, lo: 0xab, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb8},
-	{value: 0x8752, lo: 0xb9, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbc},
-	{value: 0x8b52, lo: 0xbd, hi: 0xbd},
-	{value: 0x0012, lo: 0xbe, hi: 0xbf},
-	// Block 0x5c, offset 0x28a
-	{value: 0x0012, lo: 0x80, hi: 0x8d},
-	{value: 0x8f52, lo: 0x8e, hi: 0x8e},
-	{value: 0x0012, lo: 0x8f, hi: 0x9a},
-	{value: 0x0015, lo: 0x9b, hi: 0xbf},
-	// Block 0x5d, offset 0x28e
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0024, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb9},
-	{value: 0x0024, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbd},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x5e, offset 0x29a
-	{value: 0x0117, lo: 0x80, hi: 0xbf},
-	// Block 0x5f, offset 0x29b
-	{value: 0x0117, lo: 0x80, hi: 0x95},
-	{value: 0x369a, lo: 0x96, hi: 0x96},
-	{value: 0x374a, lo: 0x97, hi: 0x97},
-	{value: 0x37fa, lo: 0x98, hi: 0x98},
-	{value: 0x38aa, lo: 0x99, hi: 0x99},
-	{value: 0x395a, lo: 0x9a, hi: 0x9a},
-	{value: 0x3a0a, lo: 0x9b, hi: 0x9b},
-	{value: 0x0012, lo: 0x9c, hi: 0x9d},
-	{value: 0x3abb, lo: 0x9e, hi: 0x9e},
-	{value: 0x0012, lo: 0x9f, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x60, offset 0x2a6
-	{value: 0x0812, lo: 0x80, hi: 0x87},
-	{value: 0x0813, lo: 0x88, hi: 0x8f},
-	{value: 0x0812, lo: 0x90, hi: 0x95},
-	{value: 0x0813, lo: 0x98, hi: 0x9d},
-	{value: 0x0812, lo: 0xa0, hi: 0xa7},
-	{value: 0x0813, lo: 0xa8, hi: 0xaf},
-	{value: 0x0812, lo: 0xb0, hi: 0xb7},
-	{value: 0x0813, lo: 0xb8, hi: 0xbf},
-	// Block 0x61, offset 0x2ae
-	{value: 0x0004, lo: 0x8b, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8f},
-	{value: 0x0054, lo: 0x98, hi: 0x99},
-	{value: 0x0054, lo: 0xa4, hi: 0xa4},
-	{value: 0x0054, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xaa, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xaf},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x62, offset 0x2b6
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x94, hi: 0x94},
-	{value: 0x0014, lo: 0xa0, hi: 0xa4},
-	{value: 0x0014, lo: 0xa6, hi: 0xaf},
-	{value: 0x0015, lo: 0xb1, hi: 0xb1},
-	{value: 0x0015, lo: 0xbf, hi: 0xbf},
-	// Block 0x63, offset 0x2bc
-	{value: 0x0015, lo: 0x90, hi: 0x9c},
-	// Block 0x64, offset 0x2bd
-	{value: 0x0024, lo: 0x90, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0xa0},
-	{value: 0x0024, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa4},
-	{value: 0x0034, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa7},
-	{value: 0x0034, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xa9},
-	{value: 0x0034, lo: 0xaa, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	// Block 0x65, offset 0x2cb
-	{value: 0x0016, lo: 0x85, hi: 0x86},
-	{value: 0x0012, lo: 0x87, hi: 0x89},
-	{value: 0xa452, lo: 0x8e, hi: 0x8e},
-	{value: 0x1013, lo: 0xa0, hi: 0xaf},
-	{value: 0x1012, lo: 0xb0, hi: 0xbf},
-	// Block 0x66, offset 0x2d0
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x88},
-	// Block 0x67, offset 0x2d3
-	{value: 0xa753, lo: 0xb6, hi: 0xb7},
-	{value: 0xaa53, lo: 0xb8, hi: 0xb9},
-	{value: 0xad53, lo: 0xba, hi: 0xbb},
-	{value: 0xaa53, lo: 0xbc, hi: 0xbd},
-	{value: 0xa753, lo: 0xbe, hi: 0xbf},
-	// Block 0x68, offset 0x2d8
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6553, lo: 0x90, hi: 0x9f},
-	{value: 0xb053, lo: 0xa0, hi: 0xae},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0x69, offset 0x2dc
-	{value: 0x0117, lo: 0x80, hi: 0xa3},
-	{value: 0x0012, lo: 0xa4, hi: 0xa4},
-	{value: 0x0716, lo: 0xab, hi: 0xac},
-	{value: 0x0316, lo: 0xad, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb3},
-	// Block 0x6a, offset 0x2e2
-	{value: 0x6c52, lo: 0x80, hi: 0x9f},
-	{value: 0x7052, lo: 0xa0, hi: 0xa5},
-	{value: 0x7052, lo: 0xa7, hi: 0xa7},
-	{value: 0x7052, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x6b, offset 0x2e7
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x6c, offset 0x2ea
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0010, lo: 0xb0, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x6d, offset 0x2ef
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9e},
-	{value: 0x0024, lo: 0xa0, hi: 0xbf},
-	// Block 0x6e, offset 0x2f4
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	// Block 0x6f, offset 0x2f5
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0xaa, hi: 0xad},
-	{value: 0x0030, lo: 0xae, hi: 0xaf},
-	{value: 0x0004, lo: 0xb1, hi: 0xb5},
-	{value: 0x0014, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	// Block 0x70, offset 0x2fb
-	{value: 0x0034, lo: 0x99, hi: 0x9a},
-	{value: 0x0004, lo: 0x9b, hi: 0x9e},
-	// Block 0x71, offset 0x2fd
-	{value: 0x0004, lo: 0xbc, hi: 0xbe},
-	// Block 0x72, offset 0x2fe
-	{value: 0x0010, lo: 0x85, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x73, offset 0x300
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0010, lo: 0xa0, hi: 0xba},
-	// Block 0x74, offset 0x302
-	{value: 0x0010, lo: 0x80, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0xbf},
-	// Block 0x75, offset 0x305
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	// Block 0x76, offset 0x306
-	{value: 0x0010, lo: 0x90, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x77, offset 0x308
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0xab},
-	// Block 0x78, offset 0x30b
-	{value: 0x0117, lo: 0x80, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb2},
-	{value: 0x0024, lo: 0xb4, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x79, offset 0x311
-	{value: 0x0117, lo: 0x80, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9d},
-	{value: 0x0024, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x7a, offset 0x315
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb1},
-	// Block 0x7b, offset 0x317
-	{value: 0x0004, lo: 0x80, hi: 0x96},
-	{value: 0x0014, lo: 0x97, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xaf},
-	{value: 0x0012, lo: 0xb0, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xbf},
-	// Block 0x7c, offset 0x31c
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x0015, lo: 0xb0, hi: 0xb0},
-	{value: 0x0012, lo: 0xb1, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x8753, lo: 0xbd, hi: 0xbd},
-	{value: 0x0117, lo: 0xbe, hi: 0xbf},
-	// Block 0x7d, offset 0x323
-	{value: 0x0117, lo: 0x82, hi: 0x83},
-	{value: 0x6553, lo: 0x84, hi: 0x84},
-	{value: 0x908b, lo: 0x85, hi: 0x85},
-	{value: 0x8f53, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0xb7, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbf},
-	// Block 0x7e, offset 0x32b
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8b},
-	{value: 0x0010, lo: 0x8c, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	// Block 0x7f, offset 0x334
-	{value: 0x0010, lo: 0x80, hi: 0xb3},
-	// Block 0x80, offset 0x335
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xa0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb7},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x81, offset 0x33e
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x82, offset 0x342
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0x92},
-	{value: 0x0030, lo: 0x93, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0x83, offset 0x347
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb9},
-	{value: 0x0010, lo: 0xba, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x84, offset 0x34f
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0004, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x85, offset 0x355
-	{value: 0x0010, lo: 0x80, hi: 0xa8},
-	{value: 0x0014, lo: 0xa9, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0x86, offset 0x35b
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x87, offset 0x365
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0024, lo: 0xbe, hi: 0xbf},
-	// Block 0x88, offset 0x36a
-	{value: 0x0024, lo: 0x81, hi: 0x81},
-	{value: 0x0004, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	// Block 0x89, offset 0x373
-	{value: 0x0010, lo: 0x81, hi: 0x86},
-	{value: 0x0010, lo: 0x89, hi: 0x8e},
-	{value: 0x0010, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8a, offset 0x379
-	{value: 0x0012, lo: 0x80, hi: 0x92},
-	{value: 0xb352, lo: 0x93, hi: 0x93},
-	{value: 0x0012, lo: 0x94, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9f},
-	{value: 0x0012, lo: 0xa0, hi: 0xa7},
-	{value: 0x74d2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8b, offset 0x380
-	{value: 0x78d2, lo: 0x80, hi: 0x8f},
-	{value: 0x7cd2, lo: 0x90, hi: 0x9f},
-	{value: 0x80d2, lo: 0xa0, hi: 0xaf},
-	{value: 0x7cd2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8c, offset 0x384
-	{value: 0x0010, lo: 0x80, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x8d, offset 0x38c
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x8e, offset 0x38e
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x8b, hi: 0xbb},
-	// Block 0x8f, offset 0x390
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0xbf},
-	// Block 0x90, offset 0x393
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0004, lo: 0xb2, hi: 0xbf},
-	// Block 0x91, offset 0x395
-	{value: 0x0004, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x93, hi: 0xbf},
-	// Block 0x92, offset 0x397
-	{value: 0x0010, lo: 0x80, hi: 0xbd},
-	// Block 0x93, offset 0x398
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0x94, offset 0x399
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0xbf},
-	// Block 0x95, offset 0x39b
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0xb0, hi: 0xbb},
-	// Block 0x96, offset 0x39d
-	{value: 0x0014, lo: 0x80, hi: 0x8f},
-	{value: 0x0054, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0xa0, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xad},
-	{value: 0x0024, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	// Block 0x97, offset 0x3a3
-	{value: 0x0010, lo: 0x8d, hi: 0x8f},
-	{value: 0x0054, lo: 0x92, hi: 0x92},
-	{value: 0x0054, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0xb0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0x98, offset 0x3a8
-	{value: 0x0010, lo: 0x80, hi: 0xbc},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x99, offset 0x3aa
-	{value: 0x0054, lo: 0x87, hi: 0x87},
-	{value: 0x0054, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0054, lo: 0x9a, hi: 0x9a},
-	{value: 0x5f53, lo: 0xa1, hi: 0xba},
-	{value: 0x0004, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9a, offset 0x3b1
-	{value: 0x0004, lo: 0x80, hi: 0x80},
-	{value: 0x5f52, lo: 0x81, hi: 0x9a},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	// Block 0x9b, offset 0x3b4
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbe},
-	// Block 0x9c, offset 0x3b6
-	{value: 0x0010, lo: 0x82, hi: 0x87},
-	{value: 0x0010, lo: 0x8a, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0x97},
-	{value: 0x0010, lo: 0x9a, hi: 0x9c},
-	{value: 0x0004, lo: 0xa3, hi: 0xa3},
-	{value: 0x0014, lo: 0xb9, hi: 0xbb},
-	// Block 0x9d, offset 0x3bc
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0010, lo: 0x8d, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xba},
-	{value: 0x0010, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9e, offset 0x3c1
-	{value: 0x0010, lo: 0x80, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x9d},
-	// Block 0x9f, offset 0x3c3
-	{value: 0x0010, lo: 0x80, hi: 0xba},
-	// Block 0xa0, offset 0x3c4
-	{value: 0x0010, lo: 0x80, hi: 0xb4},
-	// Block 0xa1, offset 0x3c5
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0xa2, offset 0x3c6
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa3, offset 0x3c8
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	// Block 0xa4, offset 0x3ca
-	{value: 0x0010, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xad, hi: 0xbf},
-	// Block 0xa5, offset 0x3cc
-	{value: 0x0010, lo: 0x80, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0xb5},
-	{value: 0x0024, lo: 0xb6, hi: 0xba},
-	// Block 0xa6, offset 0x3cf
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa7, offset 0x3d1
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x91, hi: 0x95},
-	// Block 0xa8, offset 0x3d4
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x97},
-	{value: 0xb653, lo: 0x98, hi: 0x9f},
-	{value: 0xb953, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbf},
-	// Block 0xa9, offset 0x3dc
-	{value: 0xb652, lo: 0x80, hi: 0x87},
-	{value: 0xb952, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0xaa, offset 0x3df
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0xb953, lo: 0xb0, hi: 0xb7},
-	{value: 0xb653, lo: 0xb8, hi: 0xbf},
-	// Block 0xab, offset 0x3e3
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x93},
-	{value: 0xb952, lo: 0x98, hi: 0x9f},
-	{value: 0xb652, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbb},
-	// Block 0xac, offset 0x3eb
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xad, offset 0x3ed
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	// Block 0xae, offset 0x3ee
-	{value: 0x0010, lo: 0x80, hi: 0xb6},
-	// Block 0xaf, offset 0x3ef
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xa7},
-	// Block 0xb0, offset 0x3f1
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xb5},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xb1, offset 0x3f7
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb6},
-	// Block 0xb2, offset 0x3f9
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	// Block 0xb3, offset 0x3fa
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	// Block 0xb4, offset 0x3fc
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb9},
-	// Block 0xb5, offset 0x3fe
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0xb6, offset 0x400
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x8e, hi: 0x8e},
-	{value: 0x0024, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x99, hi: 0xb5},
-	{value: 0x0024, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xb7, offset 0x40d
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0xb8, offset 0x40e
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	// Block 0xb9, offset 0x40f
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	// Block 0xba, offset 0x413
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	// Block 0xbb, offset 0x415
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	// Block 0xbc, offset 0x416
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	// Block 0xbd, offset 0x417
-	{value: 0x5653, lo: 0x80, hi: 0xb2},
-	// Block 0xbe, offset 0x418
-	{value: 0x5652, lo: 0x80, hi: 0xb2},
-	// Block 0xbf, offset 0x419
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xc0, offset 0x41c
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xc1, offset 0x41f
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x87},
-	{value: 0x0024, lo: 0x88, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x8b},
-	{value: 0x0024, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	// Block 0xc2, offset 0x425
-	{value: 0x0010, lo: 0xa0, hi: 0xb6},
-	// Block 0xc3, offset 0x426
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xc4, offset 0x42a
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xc5, offset 0x42e
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb6},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	// Block 0xc6, offset 0x434
-	{value: 0x0014, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xc7, offset 0x437
-	{value: 0x0024, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0xc8, offset 0x43e
-	{value: 0x0010, lo: 0x84, hi: 0x86},
-	{value: 0x0010, lo: 0x90, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	// Block 0xc9, offset 0x442
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xca, offset 0x446
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x89, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	// Block 0xcb, offset 0x44d
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb4},
-	{value: 0x0030, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xb7},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0xcc, offset 0x456
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xcd, offset 0x45c
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa2},
-	{value: 0x0014, lo: 0xa3, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xce, offset 0x462
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xcf, offset 0x46c
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0030, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9d, hi: 0xa3},
-	{value: 0x0024, lo: 0xa6, hi: 0xac},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	// Block 0xd0, offset 0x476
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xd1, offset 0x478
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0x9f, hi: 0x9f},
-	// Block 0xd2, offset 0x481
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xd3, offset 0x487
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd4, offset 0x48d
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd5, offset 0x493
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x98, hi: 0x9b},
-	{value: 0x0014, lo: 0x9c, hi: 0x9d},
-	// Block 0xd6, offset 0x496
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd7, offset 0x49c
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd8, offset 0x49f
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0014, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb5},
-	{value: 0x0030, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	// Block 0xd9, offset 0x4a8
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	// Block 0xda, offset 0x4a9
-	{value: 0x0014, lo: 0x9d, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xdb, offset 0x4b0
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	// Block 0xdc, offset 0x4b4
-	{value: 0x5f53, lo: 0xa0, hi: 0xbf},
-	// Block 0xdd, offset 0x4b5
-	{value: 0x5f52, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xde, offset 0x4b8
-	{value: 0x0010, lo: 0xa0, hi: 0xa7},
-	{value: 0x0010, lo: 0xaa, hi: 0xbf},
-	// Block 0xdf, offset 0x4ba
-	{value: 0x0010, lo: 0x80, hi: 0x93},
-	{value: 0x0014, lo: 0x94, hi: 0x97},
-	{value: 0x0014, lo: 0x9a, hi: 0x9b},
-	{value: 0x0010, lo: 0x9c, hi: 0x9f},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	// Block 0xe0, offset 0x4c1
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x8a},
-	{value: 0x0010, lo: 0x8b, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbb, hi: 0xbe},
-	// Block 0xe1, offset 0x4c9
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0014, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x98},
-	{value: 0x0014, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0x9c, hi: 0xbf},
-	// Block 0xe2, offset 0x4cf
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0014, lo: 0x8a, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x99},
-	{value: 0x0010, lo: 0x9d, hi: 0x9d},
-	// Block 0xe3, offset 0x4d5
-	{value: 0x0010, lo: 0x80, hi: 0xb8},
-	// Block 0xe4, offset 0x4d6
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb6},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xe5, offset 0x4dc
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0xe6, offset 0x4df
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0014, lo: 0x92, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xa9},
-	{value: 0x0014, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0xe7, offset 0x4e7
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb6},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xe8, offset 0x4ee
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa5},
-	{value: 0x0010, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xbf},
-	// Block 0xe9, offset 0x4f8
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0014, lo: 0x90, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0x96},
-	{value: 0x0034, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xea, offset 0x500
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	// Block 0xeb, offset 0x503
-	{value: 0x0010, lo: 0x80, hi: 0x99},
-	// Block 0xec, offset 0x504
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	// Block 0xed, offset 0x505
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	// Block 0xee, offset 0x506
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	{value: 0x0014, lo: 0xb0, hi: 0xb8},
-	// Block 0xef, offset 0x508
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	// Block 0xf0, offset 0x509
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xf1, offset 0x50b
-	{value: 0x0010, lo: 0x90, hi: 0xad},
-	{value: 0x0034, lo: 0xb0, hi: 0xb4},
-	// Block 0xf2, offset 0x50d
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb6},
-	// Block 0xf3, offset 0x50f
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa3, hi: 0xb7},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xf4, offset 0x513
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	// Block 0xf5, offset 0x514
-	{value: 0x2013, lo: 0x80, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xbf},
-	// Block 0xf6, offset 0x516
-	{value: 0x0010, lo: 0x80, hi: 0x8a},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0xf7, offset 0x519
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0014, lo: 0x8f, hi: 0x9f},
-	// Block 0xf8, offset 0x51b
-	{value: 0x0014, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa3, hi: 0xa3},
-	// Block 0xf9, offset 0x51d
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbc},
-	// Block 0xfa, offset 0x51f
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0034, lo: 0x9e, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa3},
-	// Block 0xfb, offset 0x524
-	{value: 0x0030, lo: 0xa5, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xa9},
-	{value: 0x0030, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbf},
-	// Block 0xfc, offset 0x529
-	{value: 0x0034, lo: 0x80, hi: 0x82},
-	{value: 0x0024, lo: 0x85, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8b},
-	{value: 0x0024, lo: 0xaa, hi: 0xad},
-	// Block 0xfd, offset 0x52d
-	{value: 0x0024, lo: 0x82, hi: 0x84},
-	// Block 0xfe, offset 0x52e
-	{value: 0x0013, lo: 0x80, hi: 0x99},
-	{value: 0x0012, lo: 0x9a, hi: 0xb3},
-	{value: 0x0013, lo: 0xb4, hi: 0xbf},
-	// Block 0xff, offset 0x531
-	{value: 0x0013, lo: 0x80, hi: 0x8d},
-	{value: 0x0012, lo: 0x8e, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0xa7},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0x100, offset 0x535
-	{value: 0x0013, lo: 0x80, hi: 0x81},
-	{value: 0x0012, lo: 0x82, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0x9c},
-	{value: 0x0013, lo: 0x9e, hi: 0x9f},
-	{value: 0x0013, lo: 0xa2, hi: 0xa2},
-	{value: 0x0013, lo: 0xa5, hi: 0xa6},
-	{value: 0x0013, lo: 0xa9, hi: 0xac},
-	{value: 0x0013, lo: 0xae, hi: 0xb5},
-	{value: 0x0012, lo: 0xb6, hi: 0xb9},
-	{value: 0x0012, lo: 0xbb, hi: 0xbb},
-	{value: 0x0012, lo: 0xbd, hi: 0xbf},
-	// Block 0x101, offset 0x540
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0012, lo: 0x85, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0x102, offset 0x544
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0013, lo: 0x84, hi: 0x85},
-	{value: 0x0013, lo: 0x87, hi: 0x8a},
-	{value: 0x0013, lo: 0x8d, hi: 0x94},
-	{value: 0x0013, lo: 0x96, hi: 0x9c},
-	{value: 0x0012, lo: 0x9e, hi: 0xb7},
-	{value: 0x0013, lo: 0xb8, hi: 0xb9},
-	{value: 0x0013, lo: 0xbb, hi: 0xbe},
-	// Block 0x103, offset 0x54c
-	{value: 0x0013, lo: 0x80, hi: 0x84},
-	{value: 0x0013, lo: 0x86, hi: 0x86},
-	{value: 0x0013, lo: 0x8a, hi: 0x90},
-	{value: 0x0012, lo: 0x92, hi: 0xab},
-	{value: 0x0013, lo: 0xac, hi: 0xbf},
-	// Block 0x104, offset 0x551
-	{value: 0x0013, lo: 0x80, hi: 0x85},
-	{value: 0x0012, lo: 0x86, hi: 0x9f},
-	{value: 0x0013, lo: 0xa0, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbf},
-	// Block 0x105, offset 0x555
-	{value: 0x0012, lo: 0x80, hi: 0x93},
-	{value: 0x0013, lo: 0x94, hi: 0xad},
-	{value: 0x0012, lo: 0xae, hi: 0xbf},
-	// Block 0x106, offset 0x558
-	{value: 0x0012, lo: 0x80, hi: 0x87},
-	{value: 0x0013, lo: 0x88, hi: 0xa1},
-	{value: 0x0012, lo: 0xa2, hi: 0xbb},
-	{value: 0x0013, lo: 0xbc, hi: 0xbf},
-	// Block 0x107, offset 0x55c
-	{value: 0x0013, lo: 0x80, hi: 0x95},
-	{value: 0x0012, lo: 0x96, hi: 0xaf},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x108, offset 0x55f
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0012, lo: 0x8a, hi: 0xa5},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0x109, offset 0x562
-	{value: 0x0013, lo: 0x80, hi: 0x80},
-	{value: 0x0012, lo: 0x82, hi: 0x9a},
-	{value: 0x0012, lo: 0x9c, hi: 0xa1},
-	{value: 0x0013, lo: 0xa2, hi: 0xba},
-	{value: 0x0012, lo: 0xbc, hi: 0xbf},
-	// Block 0x10a, offset 0x567
-	{value: 0x0012, lo: 0x80, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0xb4},
-	{value: 0x0012, lo: 0xb6, hi: 0xbf},
-	// Block 0x10b, offset 0x56b
-	{value: 0x0012, lo: 0x80, hi: 0x8e},
-	{value: 0x0012, lo: 0x90, hi: 0x95},
-	{value: 0x0013, lo: 0x96, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x10c, offset 0x56f
-	{value: 0x0012, lo: 0x80, hi: 0x88},
-	{value: 0x0012, lo: 0x8a, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0x10d, offset 0x573
-	{value: 0x0012, lo: 0x80, hi: 0x82},
-	{value: 0x0012, lo: 0x84, hi: 0x89},
-	{value: 0x0017, lo: 0x8a, hi: 0x8b},
-	{value: 0x0010, lo: 0x8e, hi: 0xbf},
-	// Block 0x10e, offset 0x577
-	{value: 0x0014, lo: 0x80, hi: 0xb6},
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x10f, offset 0x579
-	{value: 0x0014, lo: 0x80, hi: 0xac},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x110, offset 0x57b
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x9b, hi: 0x9f},
-	{value: 0x0014, lo: 0xa1, hi: 0xaf},
-	// Block 0x111, offset 0x57e
-	{value: 0x0024, lo: 0x80, hi: 0x86},
-	{value: 0x0024, lo: 0x88, hi: 0x98},
-	{value: 0x0024, lo: 0x9b, hi: 0xa1},
-	{value: 0x0024, lo: 0xa3, hi: 0xa4},
-	{value: 0x0024, lo: 0xa6, hi: 0xaa},
-	// Block 0x112, offset 0x583
-	{value: 0x0010, lo: 0x80, hi: 0xac},
-	{value: 0x0024, lo: 0xb0, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xbd},
-	// Block 0x113, offset 0x586
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	// Block 0x114, offset 0x588
-	{value: 0x0010, lo: 0x80, hi: 0xab},
-	{value: 0x0024, lo: 0xac, hi: 0xaf},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x115, offset 0x58b
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0034, lo: 0x90, hi: 0x96},
-	// Block 0x116, offset 0x58d
-	{value: 0xbc52, lo: 0x80, hi: 0x81},
-	{value: 0xbf52, lo: 0x82, hi: 0x83},
-	{value: 0x0024, lo: 0x84, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8b},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x117, offset 0x593
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x9f},
-	{value: 0x0010, lo: 0xa1, hi: 0xa2},
-	{value: 0x0010, lo: 0xa4, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb7},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	// Block 0x118, offset 0x59c
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x9b},
-	{value: 0x0010, lo: 0xa1, hi: 0xa3},
-	{value: 0x0010, lo: 0xa5, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xbb},
-	// Block 0x119, offset 0x5a1
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x11a, offset 0x5a2
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x11b, offset 0x5a5
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	// Block 0x11c, offset 0x5a6
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x11d, offset 0x5a7
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0014, lo: 0xa0, hi: 0xbf},
-	// Block 0x11e, offset 0x5a9
-	{value: 0x0014, lo: 0x80, hi: 0xbf},
-	// Block 0x11f, offset 0x5aa
-	{value: 0x0014, lo: 0x80, hi: 0xaf},
-}
-
-// Total table size 15070 bytes (14KiB); checksum: 1EB13752
diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go
deleted file mode 100644
index cd874775b3..0000000000
--- a/vendor/golang.org/x/text/cases/tables13.0.0.go
+++ /dev/null
@@ -1,2400 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-//go:build go1.16
-// +build go1.16
-
-package cases
-
-// UnicodeVersion is the Unicode version from which the tables in this package are derived.
-const UnicodeVersion = "13.0.0"
-
-var xorData string = "" + // Size: 192 bytes
-	"\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" +
-	"\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" +
-	"\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" +
-	"\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" +
-	"\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" +
-	"\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" +
-	"\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" +
-	"\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" +
-	"\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" +
-	"\x1e\x00\x01\x22"
-
-var exceptions string = "" + // Size: 2450 bytes
-	"\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" +
-	"\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" +
-	"\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" +
-	"\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" +
-	"\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" +
-	"\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" +
-	"ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" +
-	"φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" +
-	"\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" +
-	"\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" +
-	"\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" +
-	"\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" +
-	"\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" +
-	"\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" +
-	"\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" +
-	"СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" +
-	"\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" +
-	"\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" +
-	"\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" +
-	"\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" +
-	"\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" +
-	"ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" +
-	"\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" +
-	"\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" +
-	"\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" +
-	"\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" +
-	"ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" +
-	"Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" +
-	"̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" +
-	"́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" +
-	"\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" +
-	"\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" +
-	"\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" +
-	"\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" +
-	"\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" +
-	"STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" +
-	"խ"
-
-// lookup returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookup(s []byte) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupUnsafe(s []byte) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// lookupString returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookupString(s string) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupStringUnsafe(s string) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// caseTrie. Total size: 12538 bytes (12.24 KiB). Checksum: af4dfa7d60c71d4c.
-type caseTrie struct{}
-
-func newCaseTrie(i int) *caseTrie {
-	return &caseTrie{}
-}
-
-// lookupValue determines the type of block n and looks up the value for b.
-func (t *caseTrie) lookupValue(n uint32, b byte) uint16 {
-	switch {
-	case n < 20:
-		return uint16(caseValues[n<<6+uint32(b)])
-	default:
-		n -= 20
-		return uint16(sparse.lookup(n, b))
-	}
-}
-
-// caseValues: 22 blocks, 1408 entries, 2816 bytes
-// The third block is the zero block.
-var caseValues = [1408]uint16{
-	// Block 0x0, offset 0x0
-	0x27: 0x0054,
-	0x2e: 0x0054,
-	0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010,
-	0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054,
-	// Block 0x1, offset 0x40
-	0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013,
-	0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013,
-	0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013,
-	0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013,
-	0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013,
-	0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012,
-	0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012,
-	0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012,
-	0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012,
-	0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012,
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112,
-	0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713,
-	0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313,
-	0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653,
-	0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53,
-	0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112,
-	0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853,
-	0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13,
-	0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313,
-	0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010,
-	0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452,
-	// Block 0x4, offset 0x100
-	0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359,
-	0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619,
-	0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313,
-	0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13,
-	0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452,
-	0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112,
-	0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112,
-	0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112,
-	0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112,
-	0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112,
-	0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112,
-	// Block 0x5, offset 0x140
-	0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53,
-	0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112,
-	0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a,
-	0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152,
-	0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012,
-	0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052,
-	0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652,
-	0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52,
-	0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252,
-	0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012,
-	0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012,
-	// Block 0x6, offset 0x180
-	0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012,
-	0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52,
-	0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012,
-	0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012,
-	0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a,
-	0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012,
-	0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012,
-	0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012,
-	0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015,
-	0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014,
-	0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d,
-	0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024,
-	0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024,
-	0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024,
-	0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034,
-	0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024,
-	0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024,
-	0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024,
-	0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004,
-	0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52,
-	0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353,
-	// Block 0x8, offset 0x200
-	0x204: 0x0004, 0x205: 0x0004,
-	0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513,
-	0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013,
-	0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013,
-	0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013,
-	0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53,
-	0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53,
-	0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512,
-	0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012,
-	0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012,
-	0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012,
-	// Block 0x9, offset 0x240
-	0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52,
-	0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52,
-	0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a,
-	0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812,
-	0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112,
-	0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112,
-	0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112,
-	0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112,
-	0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a,
-	0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112,
-	0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053,
-	// Block 0xa, offset 0x280
-	0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852,
-	0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010,
-	0x291: 0x0034,
-	0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024,
-	0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024,
-	0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034,
-	0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024,
-	0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024,
-	0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034,
-	0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034,
-	0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034,
-	// Block 0xb, offset 0x2c0
-	0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053,
-	0x2c7: 0x7053,
-	0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a,
-	0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a,
-	0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a,
-	0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a,
-	0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a,
-	0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a,
-	0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a,
-	0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea,
-	0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a,
-	// Block 0xc, offset 0x300
-	0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812,
-	0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813,
-	0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812,
-	0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812,
-	0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813,
-	0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812,
-	0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813,
-	0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813,
-	0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852,
-	0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152,
-	0x33c: 0x4d52, 0x33d: 0x4d52,
-	// Block 0xd, offset 0x340
-	0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a,
-	0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09,
-	0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa,
-	0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a,
-	0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9,
-	0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a,
-	0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629,
-	0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9,
-	0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a,
-	0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253,
-	0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004,
-	// Block 0xe, offset 0x380
-	0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca,
-	0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853,
-	0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812,
-	0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa,
-	0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004,
-	0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a,
-	0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813,
-	0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004,
-	0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a,
-	0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53,
-	0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004,
-	// Block 0xf, offset 0x3c0
-	0x3c2: 0x0013,
-	0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013,
-	0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013,
-	0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013,
-	0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013,
-	0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013,
-	0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012,
-	0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010,
-	0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012,
-	0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013,
-	// Block 0x10, offset 0x400
-	0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13,
-	0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13,
-	0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752,
-	0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52,
-	0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12,
-	0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12,
-	0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612,
-	// Block 0x11, offset 0x440
-	0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552,
-	0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552,
-	0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052,
-	0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052,
-	0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052,
-	0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53,
-	0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313,
-	0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab,
-	0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313,
-	0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012,
-	0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb,
-	// Block 0x12, offset 0x480
-	0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112,
-	0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713,
-	0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112,
-	0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112,
-	0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112,
-	0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112,
-	0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112,
-	0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012,
-	0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112,
-	0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112,
-	0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112,
-	// Block 0x13, offset 0x4c0
-	0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca,
-	0x4c6: 0x944a,
-	0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a,
-	0x4dd: 0x0010,
-	0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010,
-	0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010,
-	0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010,
-	0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010,
-	0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010,
-	0x4fc: 0x0010, 0x4fe: 0x0010,
-	// Block 0x14, offset 0x500
-	0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213,
-	0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613,
-	0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213,
-	0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13,
-	0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213,
-	0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212,
-	0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12,
-	0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212,
-	0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612,
-	0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212,
-	0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212,
-	// Block 0x15, offset 0x540
-	0x542: 0x0010,
-	0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010,
-	0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010,
-	0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010,
-	0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010,
-	0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010,
-	0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010,
-	0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010,
-	0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010,
-	0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010,
-	0x57c: 0x0010, 0x57e: 0x0010,
-}
-
-// caseIndex: 25 blocks, 1600 entries, 3200 bytes
-// Block 0 is the zero block.
-var caseIndex = [1600]uint16{
-	// Block 0x0, offset 0x0
-	// Block 0x1, offset 0x40
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02,
-	0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07,
-	0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21,
-	0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29,
-	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
-	0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09,
-	0xf0: 0x14, 0xf3: 0x16,
-	// Block 0x4, offset 0x100
-	0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31,
-	0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39,
-	0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41,
-	0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49,
-	// Block 0x5, offset 0x140
-	0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24,
-	0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53,
-	0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24,
-	0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b,
-	0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62,
-	0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16b: 0x66, 0x16c: 0x67, 0x16d: 0x68, 0x16e: 0x69, 0x16f: 0x6a,
-	0x170: 0x6b, 0x171: 0x6c, 0x172: 0x6d, 0x173: 0x6e, 0x174: 0x6f, 0x175: 0x70, 0x176: 0x71, 0x177: 0x72,
-	0x178: 0x73, 0x179: 0x73, 0x17a: 0x74, 0x17b: 0x73, 0x17c: 0x75, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c,
-	// Block 0x6, offset 0x180
-	0x180: 0x76, 0x181: 0x77, 0x182: 0x78, 0x183: 0x79, 0x184: 0x0d, 0x185: 0x7a, 0x186: 0x7b,
-	0x192: 0x7c, 0x193: 0x0e,
-	0x1b0: 0x7d, 0x1b1: 0x0f, 0x1b2: 0x73, 0x1b3: 0x7e, 0x1b4: 0x7f, 0x1b5: 0x80, 0x1b6: 0x81, 0x1b7: 0x82,
-	0x1b8: 0x83,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x84, 0x1c2: 0x85, 0x1c3: 0x86, 0x1c4: 0x87, 0x1c5: 0x24, 0x1c6: 0x88,
-	// Block 0x8, offset 0x200
-	0x200: 0x89, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24,
-	0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24,
-	0x210: 0x24, 0x211: 0x24, 0x212: 0x8a, 0x213: 0x8b, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24,
-	0x218: 0x8c, 0x219: 0x8d, 0x21a: 0x8e, 0x21b: 0x8f, 0x21c: 0x90, 0x21d: 0x91, 0x21e: 0x10, 0x21f: 0x92,
-	0x220: 0x93, 0x221: 0x94, 0x222: 0x24, 0x223: 0x95, 0x224: 0x96, 0x225: 0x97, 0x226: 0x98, 0x227: 0x99,
-	0x228: 0x9a, 0x229: 0x9b, 0x22a: 0x9c, 0x22b: 0x9d, 0x22c: 0x9e, 0x22d: 0x9f, 0x22e: 0xa0, 0x22f: 0xa1,
-	0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24,
-	0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24,
-	// Block 0x9, offset 0x240
-	0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24,
-	0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24,
-	0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24,
-	0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24,
-	0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24,
-	0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24,
-	0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24,
-	0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24,
-	// Block 0xa, offset 0x280
-	0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24,
-	0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24,
-	0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24,
-	0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa2, 0x29f: 0xa3,
-	// Block 0xb, offset 0x2c0
-	0x2ec: 0x11, 0x2ed: 0xa4, 0x2ee: 0xa5, 0x2ef: 0xa6,
-	0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa7, 0x2f5: 0xa8, 0x2f6: 0xa9, 0x2f7: 0xaa,
-	0x2f8: 0xab, 0x2f9: 0xac, 0x2fa: 0x24, 0x2fb: 0xad, 0x2fc: 0xae, 0x2fd: 0xaf, 0x2fe: 0xb0, 0x2ff: 0xb1,
-	// Block 0xc, offset 0x300
-	0x300: 0xb2, 0x301: 0xb3, 0x302: 0x24, 0x303: 0xb4, 0x305: 0xb5, 0x307: 0xb6,
-	0x30a: 0xb7, 0x30b: 0xb8, 0x30c: 0xb9, 0x30d: 0xba, 0x30e: 0xbb, 0x30f: 0xbc,
-	0x310: 0xbd, 0x311: 0xbe, 0x312: 0xbf, 0x313: 0xc0, 0x314: 0xc1, 0x315: 0xc2,
-	0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc3, 0x31d: 0xc4,
-	0x320: 0xc5, 0x321: 0xc6, 0x322: 0xc7, 0x323: 0xc8, 0x324: 0xc9, 0x326: 0xca,
-	0x328: 0xcb, 0x329: 0xcc, 0x32a: 0xcd, 0x32b: 0xce, 0x32c: 0x5f, 0x32d: 0xcf, 0x32e: 0xd0,
-	0x330: 0x24, 0x331: 0xd1, 0x332: 0xd2, 0x333: 0xd3, 0x334: 0xd4,
-	0x33a: 0xd5, 0x33c: 0xd6, 0x33d: 0xd7, 0x33e: 0xd8, 0x33f: 0xd9,
-	// Block 0xd, offset 0x340
-	0x340: 0xda, 0x341: 0xdb, 0x342: 0xdc, 0x343: 0xdd, 0x344: 0xde, 0x345: 0xdf, 0x346: 0xe0, 0x347: 0xe1,
-	0x348: 0xe2, 0x34a: 0xe3, 0x34b: 0xe4, 0x34c: 0xe5, 0x34d: 0xe6,
-	0x350: 0xe7, 0x351: 0xe8, 0x352: 0xe9, 0x353: 0xea, 0x356: 0xeb, 0x357: 0xec,
-	0x358: 0xed, 0x359: 0xee, 0x35a: 0xef, 0x35b: 0xf0, 0x35c: 0xf1,
-	0x360: 0xf2, 0x362: 0xf3, 0x363: 0xf4, 0x364: 0xf5, 0x365: 0xf6, 0x366: 0xf7, 0x367: 0xf8,
-	0x368: 0xf9, 0x369: 0xfa, 0x36a: 0xfb, 0x36b: 0xfc,
-	0x370: 0xfd, 0x371: 0xfe, 0x372: 0xff, 0x374: 0x100, 0x375: 0x101, 0x376: 0x102,
-	0x37b: 0x103, 0x37e: 0x104,
-	// Block 0xe, offset 0x380
-	0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24,
-	0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0x105,
-	0x390: 0x24, 0x391: 0x106, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x107,
-	// Block 0xf, offset 0x3c0
-	0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24,
-	0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24,
-	0x3d0: 0x108,
-	// Block 0x10, offset 0x400
-	0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24,
-	0x418: 0x24, 0x419: 0x109,
-	// Block 0x11, offset 0x440
-	0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24,
-	0x468: 0xfc, 0x469: 0x10a, 0x46b: 0x10b, 0x46c: 0x10c, 0x46d: 0x10d, 0x46e: 0x10e,
-	0x479: 0x10f, 0x47c: 0x24, 0x47d: 0x110, 0x47e: 0x111, 0x47f: 0x112,
-	// Block 0x12, offset 0x480
-	0x4b0: 0x24, 0x4b1: 0x113, 0x4b2: 0x114,
-	// Block 0x13, offset 0x4c0
-	0x4c5: 0x115, 0x4c6: 0x116,
-	0x4c9: 0x117,
-	0x4d0: 0x118, 0x4d1: 0x119, 0x4d2: 0x11a, 0x4d3: 0x11b, 0x4d4: 0x11c, 0x4d5: 0x11d, 0x4d6: 0x11e, 0x4d7: 0x11f,
-	0x4d8: 0x120, 0x4d9: 0x121, 0x4da: 0x122, 0x4db: 0x123, 0x4dc: 0x124, 0x4dd: 0x125, 0x4de: 0x126, 0x4df: 0x127,
-	0x4e8: 0x128, 0x4e9: 0x129, 0x4ea: 0x12a,
-	// Block 0x14, offset 0x500
-	0x500: 0x12b, 0x504: 0x12c, 0x505: 0x12d,
-	0x50b: 0x12e,
-	0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x12f, 0x524: 0x12, 0x525: 0x130,
-	0x538: 0x131, 0x539: 0x13, 0x53a: 0x132,
-	// Block 0x15, offset 0x540
-	0x544: 0x133, 0x545: 0x134, 0x546: 0x135,
-	0x54f: 0x136,
-	0x56f: 0x137,
-	// Block 0x16, offset 0x580
-	0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f,
-	0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13,
-	// Block 0x17, offset 0x5c0
-	0x5c0: 0x138, 0x5c1: 0x139, 0x5c4: 0x139, 0x5c5: 0x139, 0x5c6: 0x139, 0x5c7: 0x13a,
-	// Block 0x18, offset 0x600
-	0x620: 0x15,
-}
-
-// sparseOffsets: 296 entries, 592 bytes
-var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xc0, 0xc6, 0xd4, 0xdf, 0xec, 0xf7, 0x103, 0x10d, 0x119, 0x124, 0x130, 0x13c, 0x144, 0x14d, 0x157, 0x162, 0x16e, 0x174, 0x17f, 0x185, 0x18d, 0x190, 0x195, 0x199, 0x19d, 0x1a4, 0x1ad, 0x1b5, 0x1b6, 0x1bf, 0x1c6, 0x1ce, 0x1d4, 0x1d9, 0x1dd, 0x1e0, 0x1e2, 0x1e5, 0x1ea, 0x1eb, 0x1ed, 0x1ef, 0x1f1, 0x1f8, 0x1fd, 0x201, 0x20a, 0x20d, 0x210, 0x216, 0x217, 0x222, 0x223, 0x224, 0x229, 0x236, 0x23f, 0x240, 0x248, 0x251, 0x25a, 0x263, 0x268, 0x26b, 0x276, 0x284, 0x286, 0x28d, 0x291, 0x29d, 0x29e, 0x2a9, 0x2b1, 0x2b9, 0x2bf, 0x2c0, 0x2ce, 0x2d3, 0x2d6, 0x2db, 0x2df, 0x2e5, 0x2ea, 0x2ed, 0x2f2, 0x2f7, 0x2f8, 0x2fe, 0x300, 0x301, 0x303, 0x305, 0x308, 0x309, 0x30b, 0x30e, 0x314, 0x318, 0x31a, 0x31f, 0x326, 0x331, 0x33b, 0x33c, 0x345, 0x349, 0x34e, 0x356, 0x35c, 0x362, 0x36c, 0x371, 0x37a, 0x380, 0x389, 0x38d, 0x395, 0x397, 0x399, 0x39c, 0x39e, 0x3a0, 0x3a1, 0x3a2, 0x3a4, 0x3a6, 0x3ac, 0x3b1, 0x3b3, 0x3ba, 0x3bd, 0x3bf, 0x3c5, 0x3ca, 0x3cc, 0x3cd, 0x3ce, 0x3cf, 0x3d1, 0x3d3, 0x3d5, 0x3d8, 0x3da, 0x3dd, 0x3e5, 0x3e8, 0x3ec, 0x3f4, 0x3f6, 0x3f7, 0x3f8, 0x3fa, 0x400, 0x402, 0x403, 0x405, 0x407, 0x409, 0x416, 0x417, 0x418, 0x41c, 0x41e, 0x41f, 0x420, 0x421, 0x422, 0x425, 0x428, 0x42b, 0x431, 0x432, 0x434, 0x438, 0x43c, 0x442, 0x445, 0x44c, 0x450, 0x454, 0x45d, 0x466, 0x46c, 0x472, 0x47c, 0x486, 0x488, 0x491, 0x497, 0x49d, 0x4a3, 0x4a6, 0x4ac, 0x4af, 0x4b8, 0x4b9, 0x4c0, 0x4c4, 0x4c5, 0x4c8, 0x4d2, 0x4d5, 0x4d7, 0x4de, 0x4e6, 0x4ec, 0x4f2, 0x4f3, 0x4f9, 0x4fc, 0x504, 0x50b, 0x515, 0x51d, 0x520, 0x521, 0x522, 0x523, 0x524, 0x526, 0x527, 0x529, 0x52b, 0x52d, 0x531, 0x532, 0x534, 0x537, 0x539, 0x53c, 0x53e, 0x543, 0x548, 0x54c, 0x54d, 0x550, 0x554, 0x55f, 0x563, 0x56b, 0x570, 0x574, 0x577, 0x57b, 0x57e, 0x581, 0x586, 0x58a, 0x58e, 0x592, 0x596, 0x598, 0x59a, 0x59d, 0x5a2, 0x5a5, 0x5a7, 0x5aa, 0x5ac, 0x5b2, 0x5bb, 0x5c0, 0x5c1, 0x5c4, 0x5c5, 0x5c6, 0x5c7, 0x5c9, 0x5ca, 0x5cb}
-
-// sparseValues: 1483 entries, 5932 bytes
-var sparseValues = [1483]valueRange{
-	// Block 0x0, offset 0x0
-	{value: 0x0004, lo: 0xa8, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xaa},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0004, lo: 0xaf, hi: 0xaf},
-	{value: 0x0004, lo: 0xb4, hi: 0xb4},
-	{value: 0x001a, lo: 0xb5, hi: 0xb5},
-	{value: 0x0054, lo: 0xb7, hi: 0xb7},
-	{value: 0x0004, lo: 0xb8, hi: 0xb8},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	// Block 0x1, offset 0x9
-	{value: 0x2013, lo: 0x80, hi: 0x96},
-	{value: 0x2013, lo: 0x98, hi: 0x9e},
-	{value: 0x009a, lo: 0x9f, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xb6},
-	{value: 0x2012, lo: 0xb8, hi: 0xbe},
-	{value: 0x0252, lo: 0xbf, hi: 0xbf},
-	// Block 0x2, offset 0xf
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x011b, lo: 0xb0, hi: 0xb0},
-	{value: 0x019a, lo: 0xb1, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb7},
-	{value: 0x0012, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x0553, lo: 0xbf, hi: 0xbf},
-	// Block 0x3, offset 0x18
-	{value: 0x0552, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x01da, lo: 0x89, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xb7},
-	{value: 0x0253, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x028a, lo: 0xbf, hi: 0xbf},
-	// Block 0x4, offset 0x24
-	{value: 0x0117, lo: 0x80, hi: 0x9f},
-	{value: 0x2f53, lo: 0xa0, hi: 0xa0},
-	{value: 0x0012, lo: 0xa1, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xb3},
-	{value: 0x0012, lo: 0xb4, hi: 0xb9},
-	{value: 0x090b, lo: 0xba, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x2953, lo: 0xbd, hi: 0xbd},
-	{value: 0x098b, lo: 0xbe, hi: 0xbe},
-	{value: 0x0a0a, lo: 0xbf, hi: 0xbf},
-	// Block 0x5, offset 0x2e
-	{value: 0x0015, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x97},
-	{value: 0x0004, lo: 0x98, hi: 0x9d},
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0015, lo: 0xa0, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xbf},
-	// Block 0x6, offset 0x34
-	{value: 0x0024, lo: 0x80, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbf},
-	// Block 0x7, offset 0x37
-	{value: 0x6553, lo: 0x80, hi: 0x8f},
-	{value: 0x2013, lo: 0x90, hi: 0x9f},
-	{value: 0x5f53, lo: 0xa0, hi: 0xaf},
-	{value: 0x2012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8, offset 0x3b
-	{value: 0x5f52, lo: 0x80, hi: 0x8f},
-	{value: 0x6552, lo: 0x90, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x9, offset 0x3e
-	{value: 0x0117, lo: 0x80, hi: 0x81},
-	{value: 0x0024, lo: 0x83, hi: 0x87},
-	{value: 0x0014, lo: 0x88, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xbf},
-	// Block 0xa, offset 0x42
-	{value: 0x0f13, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x0316, lo: 0x89, hi: 0x8a},
-	{value: 0x0716, lo: 0x8b, hi: 0x8c},
-	{value: 0x0316, lo: 0x8d, hi: 0x8e},
-	{value: 0x0f12, lo: 0x8f, hi: 0x8f},
-	{value: 0x0117, lo: 0x90, hi: 0xbf},
-	// Block 0xb, offset 0x4c
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x6553, lo: 0xb1, hi: 0xbf},
-	// Block 0xc, offset 0x4e
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6853, lo: 0x90, hi: 0x96},
-	{value: 0x0014, lo: 0x99, hi: 0x99},
-	{value: 0x0010, lo: 0x9a, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0054, lo: 0x9f, hi: 0x9f},
-	{value: 0x0012, lo: 0xa0, hi: 0xa0},
-	{value: 0x6552, lo: 0xa1, hi: 0xaf},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0xd, offset 0x57
-	{value: 0x0034, lo: 0x81, hi: 0x82},
-	{value: 0x0024, lo: 0x84, hi: 0x84},
-	{value: 0x0034, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0xaa},
-	{value: 0x0010, lo: 0xaf, hi: 0xb3},
-	{value: 0x0054, lo: 0xb4, hi: 0xb4},
-	// Block 0xe, offset 0x5e
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0024, lo: 0x90, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0014, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xf, offset 0x63
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9c},
-	{value: 0x0024, lo: 0x9d, hi: 0x9e},
-	{value: 0x0034, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0034, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x10, offset 0x71
-	{value: 0x0010, lo: 0x80, hi: 0xbf},
-	// Block 0x11, offset 0x72
-	{value: 0x0010, lo: 0x80, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0024, lo: 0x9f, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xaa, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x12, offset 0x80
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0034, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0034, lo: 0xb1, hi: 0xb1},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbd},
-	{value: 0x0034, lo: 0xbe, hi: 0xbe},
-	{value: 0x0024, lo: 0xbf, hi: 0xbf},
-	// Block 0x13, offset 0x8f
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0024, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x88},
-	{value: 0x0024, lo: 0x89, hi: 0x8a},
-	{value: 0x0010, lo: 0x8d, hi: 0xbf},
-	// Block 0x14, offset 0x99
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x15, offset 0x9c
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xb1},
-	{value: 0x0034, lo: 0xb2, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0x16, offset 0xa3
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x99},
-	{value: 0x0014, lo: 0x9a, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0xa3},
-	{value: 0x0014, lo: 0xa4, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xad},
-	// Block 0x17, offset 0xab
-	{value: 0x0010, lo: 0x80, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0xa0, hi: 0xaa},
-	// Block 0x18, offset 0xae
-	{value: 0x0010, lo: 0xa0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0x19, offset 0xb0
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0034, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0024, lo: 0xaa, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbf},
-	// Block 0x1a, offset 0xc0
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1b, offset 0xc6
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0x1c, offset 0xd4
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb6, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1d, offset 0xdf
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xb1},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	// Block 0x1e, offset 0xec
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x1f, offset 0xf7
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x99, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x20, offset 0x103
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x21, offset 0x10d
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x85},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xbf},
-	// Block 0x22, offset 0x119
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x23, offset 0x124
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x24, offset 0x130
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0010, lo: 0xa8, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x25, offset 0x13c
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x26, offset 0x144
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb9},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbf},
-	// Block 0x27, offset 0x14d
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x88},
-	{value: 0x0014, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x28, offset 0x157
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x29, offset 0x162
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb2},
-	// Block 0x2a, offset 0x16e
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x2b, offset 0x174
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x94, hi: 0x97},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xba, hi: 0xbf},
-	// Block 0x2c, offset 0x17f
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x96},
-	{value: 0x0010, lo: 0x9a, hi: 0xb1},
-	{value: 0x0010, lo: 0xb3, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x2d, offset 0x185
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x94},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9f},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	// Block 0x2e, offset 0x18d
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xba},
-	// Block 0x2f, offset 0x190
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x30, offset 0x195
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xba},
-	{value: 0x0014, lo: 0xbb, hi: 0xbc},
-	// Block 0x31, offset 0x199
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x32, offset 0x19d
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0034, lo: 0x98, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0034, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x33, offset 0x1a4
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xac},
-	{value: 0x0034, lo: 0xb1, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xba, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x34, offset 0x1ad
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0024, lo: 0x82, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x86, hi: 0x87},
-	{value: 0x0010, lo: 0x88, hi: 0x8c},
-	{value: 0x0014, lo: 0x8d, hi: 0x97},
-	{value: 0x0014, lo: 0x99, hi: 0xbc},
-	// Block 0x35, offset 0x1b5
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	// Block 0x36, offset 0x1b6
-	{value: 0x0010, lo: 0xab, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbe},
-	// Block 0x37, offset 0x1bf
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x96, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x99},
-	{value: 0x0014, lo: 0x9e, hi: 0xa0},
-	{value: 0x0010, lo: 0xa2, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xad},
-	{value: 0x0014, lo: 0xb1, hi: 0xb4},
-	// Block 0x38, offset 0x1c6
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x6c53, lo: 0xa0, hi: 0xbf},
-	// Block 0x39, offset 0x1ce
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x9a, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x3a, offset 0x1d4
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x3b, offset 0x1d9
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x82, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3c, offset 0x1dd
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3d, offset 0x1e0
-	{value: 0x0010, lo: 0x80, hi: 0x9a},
-	{value: 0x0024, lo: 0x9d, hi: 0x9f},
-	// Block 0x3e, offset 0x1e2
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x7453, lo: 0xa0, hi: 0xaf},
-	{value: 0x7853, lo: 0xb0, hi: 0xbf},
-	// Block 0x3f, offset 0x1e5
-	{value: 0x7c53, lo: 0x80, hi: 0x8f},
-	{value: 0x8053, lo: 0x90, hi: 0x9f},
-	{value: 0x7c53, lo: 0xa0, hi: 0xaf},
-	{value: 0x0813, lo: 0xb0, hi: 0xb5},
-	{value: 0x0892, lo: 0xb8, hi: 0xbd},
-	// Block 0x40, offset 0x1ea
-	{value: 0x0010, lo: 0x81, hi: 0xbf},
-	// Block 0x41, offset 0x1eb
-	{value: 0x0010, lo: 0x80, hi: 0xac},
-	{value: 0x0010, lo: 0xaf, hi: 0xbf},
-	// Block 0x42, offset 0x1ed
-	{value: 0x0010, lo: 0x81, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x43, offset 0x1ef
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb8},
-	// Block 0x44, offset 0x1f1
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0034, lo: 0x94, hi: 0x94},
-	{value: 0x0010, lo: 0xa0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	// Block 0x45, offset 0x1f8
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xac},
-	{value: 0x0010, lo: 0xae, hi: 0xb0},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	// Block 0x46, offset 0x1fd
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x47, offset 0x201
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x89, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0014, lo: 0x93, hi: 0x93},
-	{value: 0x0004, lo: 0x97, hi: 0x97},
-	{value: 0x0024, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0x48, offset 0x20a
-	{value: 0x0014, lo: 0x8b, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x49, offset 0x20d
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb8},
-	// Block 0x4a, offset 0x210
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x4b, offset 0x216
-	{value: 0x0010, lo: 0x80, hi: 0xb5},
-	// Block 0x4c, offset 0x217
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbb},
-	// Block 0x4d, offset 0x222
-	{value: 0x0010, lo: 0x86, hi: 0x8f},
-	// Block 0x4e, offset 0x223
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x4f, offset 0x224
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	// Block 0x50, offset 0x229
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x9e},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xac},
-	{value: 0x0010, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xbc},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x51, offset 0x236
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xa7, hi: 0xa7},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	{value: 0x0034, lo: 0xb5, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbc},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x52, offset 0x23f
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	// Block 0x53, offset 0x240
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x54, offset 0x248
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0030, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8b},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xab, hi: 0xab},
-	{value: 0x0034, lo: 0xac, hi: 0xac},
-	{value: 0x0024, lo: 0xad, hi: 0xb3},
-	// Block 0x55, offset 0x251
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0030, lo: 0xaa, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbf},
-	// Block 0x56, offset 0x25a
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0030, lo: 0xb2, hi: 0xb3},
-	// Block 0x57, offset 0x263
-	{value: 0x0010, lo: 0x80, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0x58, offset 0x268
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8d, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x59, offset 0x26b
-	{value: 0x31ea, lo: 0x80, hi: 0x80},
-	{value: 0x326a, lo: 0x81, hi: 0x81},
-	{value: 0x32ea, lo: 0x82, hi: 0x82},
-	{value: 0x336a, lo: 0x83, hi: 0x83},
-	{value: 0x33ea, lo: 0x84, hi: 0x84},
-	{value: 0x346a, lo: 0x85, hi: 0x85},
-	{value: 0x34ea, lo: 0x86, hi: 0x86},
-	{value: 0x356a, lo: 0x87, hi: 0x87},
-	{value: 0x35ea, lo: 0x88, hi: 0x88},
-	{value: 0x8353, lo: 0x90, hi: 0xba},
-	{value: 0x8353, lo: 0xbd, hi: 0xbf},
-	// Block 0x5a, offset 0x276
-	{value: 0x0024, lo: 0x90, hi: 0x92},
-	{value: 0x0034, lo: 0x94, hi: 0x99},
-	{value: 0x0024, lo: 0x9a, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9f},
-	{value: 0x0024, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0034, lo: 0xa2, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xb3},
-	{value: 0x0024, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb7},
-	{value: 0x0024, lo: 0xb8, hi: 0xb9},
-	{value: 0x0010, lo: 0xba, hi: 0xba},
-	// Block 0x5b, offset 0x284
-	{value: 0x0012, lo: 0x80, hi: 0xab},
-	{value: 0x0015, lo: 0xac, hi: 0xbf},
-	// Block 0x5c, offset 0x286
-	{value: 0x0015, lo: 0x80, hi: 0xaa},
-	{value: 0x0012, lo: 0xab, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb8},
-	{value: 0x8752, lo: 0xb9, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbc},
-	{value: 0x8b52, lo: 0xbd, hi: 0xbd},
-	{value: 0x0012, lo: 0xbe, hi: 0xbf},
-	// Block 0x5d, offset 0x28d
-	{value: 0x0012, lo: 0x80, hi: 0x8d},
-	{value: 0x8f52, lo: 0x8e, hi: 0x8e},
-	{value: 0x0012, lo: 0x8f, hi: 0x9a},
-	{value: 0x0015, lo: 0x9b, hi: 0xbf},
-	// Block 0x5e, offset 0x291
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0024, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb9},
-	{value: 0x0024, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbd},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x5f, offset 0x29d
-	{value: 0x0117, lo: 0x80, hi: 0xbf},
-	// Block 0x60, offset 0x29e
-	{value: 0x0117, lo: 0x80, hi: 0x95},
-	{value: 0x369a, lo: 0x96, hi: 0x96},
-	{value: 0x374a, lo: 0x97, hi: 0x97},
-	{value: 0x37fa, lo: 0x98, hi: 0x98},
-	{value: 0x38aa, lo: 0x99, hi: 0x99},
-	{value: 0x395a, lo: 0x9a, hi: 0x9a},
-	{value: 0x3a0a, lo: 0x9b, hi: 0x9b},
-	{value: 0x0012, lo: 0x9c, hi: 0x9d},
-	{value: 0x3abb, lo: 0x9e, hi: 0x9e},
-	{value: 0x0012, lo: 0x9f, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x61, offset 0x2a9
-	{value: 0x0812, lo: 0x80, hi: 0x87},
-	{value: 0x0813, lo: 0x88, hi: 0x8f},
-	{value: 0x0812, lo: 0x90, hi: 0x95},
-	{value: 0x0813, lo: 0x98, hi: 0x9d},
-	{value: 0x0812, lo: 0xa0, hi: 0xa7},
-	{value: 0x0813, lo: 0xa8, hi: 0xaf},
-	{value: 0x0812, lo: 0xb0, hi: 0xb7},
-	{value: 0x0813, lo: 0xb8, hi: 0xbf},
-	// Block 0x62, offset 0x2b1
-	{value: 0x0004, lo: 0x8b, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8f},
-	{value: 0x0054, lo: 0x98, hi: 0x99},
-	{value: 0x0054, lo: 0xa4, hi: 0xa4},
-	{value: 0x0054, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xaa, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xaf},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x63, offset 0x2b9
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x94, hi: 0x94},
-	{value: 0x0014, lo: 0xa0, hi: 0xa4},
-	{value: 0x0014, lo: 0xa6, hi: 0xaf},
-	{value: 0x0015, lo: 0xb1, hi: 0xb1},
-	{value: 0x0015, lo: 0xbf, hi: 0xbf},
-	// Block 0x64, offset 0x2bf
-	{value: 0x0015, lo: 0x90, hi: 0x9c},
-	// Block 0x65, offset 0x2c0
-	{value: 0x0024, lo: 0x90, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0xa0},
-	{value: 0x0024, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa4},
-	{value: 0x0034, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa7},
-	{value: 0x0034, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xa9},
-	{value: 0x0034, lo: 0xaa, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	// Block 0x66, offset 0x2ce
-	{value: 0x0016, lo: 0x85, hi: 0x86},
-	{value: 0x0012, lo: 0x87, hi: 0x89},
-	{value: 0xa452, lo: 0x8e, hi: 0x8e},
-	{value: 0x1013, lo: 0xa0, hi: 0xaf},
-	{value: 0x1012, lo: 0xb0, hi: 0xbf},
-	// Block 0x67, offset 0x2d3
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x88},
-	// Block 0x68, offset 0x2d6
-	{value: 0xa753, lo: 0xb6, hi: 0xb7},
-	{value: 0xaa53, lo: 0xb8, hi: 0xb9},
-	{value: 0xad53, lo: 0xba, hi: 0xbb},
-	{value: 0xaa53, lo: 0xbc, hi: 0xbd},
-	{value: 0xa753, lo: 0xbe, hi: 0xbf},
-	// Block 0x69, offset 0x2db
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6553, lo: 0x90, hi: 0x9f},
-	{value: 0xb053, lo: 0xa0, hi: 0xae},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0x6a, offset 0x2df
-	{value: 0x0117, lo: 0x80, hi: 0xa3},
-	{value: 0x0012, lo: 0xa4, hi: 0xa4},
-	{value: 0x0716, lo: 0xab, hi: 0xac},
-	{value: 0x0316, lo: 0xad, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb3},
-	// Block 0x6b, offset 0x2e5
-	{value: 0x6c52, lo: 0x80, hi: 0x9f},
-	{value: 0x7052, lo: 0xa0, hi: 0xa5},
-	{value: 0x7052, lo: 0xa7, hi: 0xa7},
-	{value: 0x7052, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x6c, offset 0x2ea
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x6d, offset 0x2ed
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0010, lo: 0xb0, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x6e, offset 0x2f2
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9e},
-	{value: 0x0024, lo: 0xa0, hi: 0xbf},
-	// Block 0x6f, offset 0x2f7
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	// Block 0x70, offset 0x2f8
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0xaa, hi: 0xad},
-	{value: 0x0030, lo: 0xae, hi: 0xaf},
-	{value: 0x0004, lo: 0xb1, hi: 0xb5},
-	{value: 0x0014, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	// Block 0x71, offset 0x2fe
-	{value: 0x0034, lo: 0x99, hi: 0x9a},
-	{value: 0x0004, lo: 0x9b, hi: 0x9e},
-	// Block 0x72, offset 0x300
-	{value: 0x0004, lo: 0xbc, hi: 0xbe},
-	// Block 0x73, offset 0x301
-	{value: 0x0010, lo: 0x85, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x74, offset 0x303
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x75, offset 0x305
-	{value: 0x0010, lo: 0x80, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0xbf},
-	// Block 0x76, offset 0x308
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	// Block 0x77, offset 0x309
-	{value: 0x0010, lo: 0x90, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x78, offset 0x30b
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0xab},
-	// Block 0x79, offset 0x30e
-	{value: 0x0117, lo: 0x80, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb2},
-	{value: 0x0024, lo: 0xb4, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x7a, offset 0x314
-	{value: 0x0117, lo: 0x80, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9d},
-	{value: 0x0024, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x7b, offset 0x318
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb1},
-	// Block 0x7c, offset 0x31a
-	{value: 0x0004, lo: 0x80, hi: 0x87},
-	{value: 0x0014, lo: 0x88, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xaf},
-	{value: 0x0012, lo: 0xb0, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xbf},
-	// Block 0x7d, offset 0x31f
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x0015, lo: 0xb0, hi: 0xb0},
-	{value: 0x0012, lo: 0xb1, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x8753, lo: 0xbd, hi: 0xbd},
-	{value: 0x0117, lo: 0xbe, hi: 0xbf},
-	// Block 0x7e, offset 0x326
-	{value: 0x0117, lo: 0x82, hi: 0x83},
-	{value: 0x6553, lo: 0x84, hi: 0x84},
-	{value: 0x908b, lo: 0x85, hi: 0x85},
-	{value: 0x8f53, lo: 0x86, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x0316, lo: 0x89, hi: 0x8a},
-	{value: 0x0316, lo: 0xb5, hi: 0xb6},
-	{value: 0x0010, lo: 0xb7, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbf},
-	// Block 0x7f, offset 0x331
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8b},
-	{value: 0x0010, lo: 0x8c, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0034, lo: 0xac, hi: 0xac},
-	// Block 0x80, offset 0x33b
-	{value: 0x0010, lo: 0x80, hi: 0xb3},
-	// Block 0x81, offset 0x33c
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xa0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb7},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x82, offset 0x345
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x83, offset 0x349
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0x92},
-	{value: 0x0030, lo: 0x93, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0x84, offset 0x34e
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb9},
-	{value: 0x0010, lo: 0xba, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x85, offset 0x356
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0004, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x86, offset 0x35c
-	{value: 0x0010, lo: 0x80, hi: 0xa8},
-	{value: 0x0014, lo: 0xa9, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0x87, offset 0x362
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x88, offset 0x36c
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0024, lo: 0xbe, hi: 0xbf},
-	// Block 0x89, offset 0x371
-	{value: 0x0024, lo: 0x81, hi: 0x81},
-	{value: 0x0004, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	// Block 0x8a, offset 0x37a
-	{value: 0x0010, lo: 0x81, hi: 0x86},
-	{value: 0x0010, lo: 0x89, hi: 0x8e},
-	{value: 0x0010, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8b, offset 0x380
-	{value: 0x0012, lo: 0x80, hi: 0x92},
-	{value: 0xb352, lo: 0x93, hi: 0x93},
-	{value: 0x0012, lo: 0x94, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9f},
-	{value: 0x0012, lo: 0xa0, hi: 0xa8},
-	{value: 0x0014, lo: 0xa9, hi: 0xa9},
-	{value: 0x0004, lo: 0xaa, hi: 0xab},
-	{value: 0x74d2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8c, offset 0x389
-	{value: 0x78d2, lo: 0x80, hi: 0x8f},
-	{value: 0x7cd2, lo: 0x90, hi: 0x9f},
-	{value: 0x80d2, lo: 0xa0, hi: 0xaf},
-	{value: 0x7cd2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8d, offset 0x38d
-	{value: 0x0010, lo: 0x80, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x8e, offset 0x395
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x8f, offset 0x397
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x8b, hi: 0xbb},
-	// Block 0x90, offset 0x399
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0xbf},
-	// Block 0x91, offset 0x39c
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0004, lo: 0xb2, hi: 0xbf},
-	// Block 0x92, offset 0x39e
-	{value: 0x0004, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x93, hi: 0xbf},
-	// Block 0x93, offset 0x3a0
-	{value: 0x0010, lo: 0x80, hi: 0xbd},
-	// Block 0x94, offset 0x3a1
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0x95, offset 0x3a2
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0xbf},
-	// Block 0x96, offset 0x3a4
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0xb0, hi: 0xbb},
-	// Block 0x97, offset 0x3a6
-	{value: 0x0014, lo: 0x80, hi: 0x8f},
-	{value: 0x0054, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0xa0, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xad},
-	{value: 0x0024, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	// Block 0x98, offset 0x3ac
-	{value: 0x0010, lo: 0x8d, hi: 0x8f},
-	{value: 0x0054, lo: 0x92, hi: 0x92},
-	{value: 0x0054, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0xb0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0x99, offset 0x3b1
-	{value: 0x0010, lo: 0x80, hi: 0xbc},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x9a, offset 0x3b3
-	{value: 0x0054, lo: 0x87, hi: 0x87},
-	{value: 0x0054, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0054, lo: 0x9a, hi: 0x9a},
-	{value: 0x5f53, lo: 0xa1, hi: 0xba},
-	{value: 0x0004, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9b, offset 0x3ba
-	{value: 0x0004, lo: 0x80, hi: 0x80},
-	{value: 0x5f52, lo: 0x81, hi: 0x9a},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	// Block 0x9c, offset 0x3bd
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbe},
-	// Block 0x9d, offset 0x3bf
-	{value: 0x0010, lo: 0x82, hi: 0x87},
-	{value: 0x0010, lo: 0x8a, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0x97},
-	{value: 0x0010, lo: 0x9a, hi: 0x9c},
-	{value: 0x0004, lo: 0xa3, hi: 0xa3},
-	{value: 0x0014, lo: 0xb9, hi: 0xbb},
-	// Block 0x9e, offset 0x3c5
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0010, lo: 0x8d, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xba},
-	{value: 0x0010, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9f, offset 0x3ca
-	{value: 0x0010, lo: 0x80, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x9d},
-	// Block 0xa0, offset 0x3cc
-	{value: 0x0010, lo: 0x80, hi: 0xba},
-	// Block 0xa1, offset 0x3cd
-	{value: 0x0010, lo: 0x80, hi: 0xb4},
-	// Block 0xa2, offset 0x3ce
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0xa3, offset 0x3cf
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa4, offset 0x3d1
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	// Block 0xa5, offset 0x3d3
-	{value: 0x0010, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xad, hi: 0xbf},
-	// Block 0xa6, offset 0x3d5
-	{value: 0x0010, lo: 0x80, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0xb5},
-	{value: 0x0024, lo: 0xb6, hi: 0xba},
-	// Block 0xa7, offset 0x3d8
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa8, offset 0x3da
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x91, hi: 0x95},
-	// Block 0xa9, offset 0x3dd
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x97},
-	{value: 0xb653, lo: 0x98, hi: 0x9f},
-	{value: 0xb953, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbf},
-	// Block 0xaa, offset 0x3e5
-	{value: 0xb652, lo: 0x80, hi: 0x87},
-	{value: 0xb952, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0xab, offset 0x3e8
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0xb953, lo: 0xb0, hi: 0xb7},
-	{value: 0xb653, lo: 0xb8, hi: 0xbf},
-	// Block 0xac, offset 0x3ec
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x93},
-	{value: 0xb952, lo: 0x98, hi: 0x9f},
-	{value: 0xb652, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbb},
-	// Block 0xad, offset 0x3f4
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xae, offset 0x3f6
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	// Block 0xaf, offset 0x3f7
-	{value: 0x0010, lo: 0x80, hi: 0xb6},
-	// Block 0xb0, offset 0x3f8
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xa7},
-	// Block 0xb1, offset 0x3fa
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xb5},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xb2, offset 0x400
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb6},
-	// Block 0xb3, offset 0x402
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	// Block 0xb4, offset 0x403
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	// Block 0xb5, offset 0x405
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb9},
-	// Block 0xb6, offset 0x407
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0xb7, offset 0x409
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x8e, hi: 0x8e},
-	{value: 0x0024, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x99, hi: 0xb5},
-	{value: 0x0024, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xb8, offset 0x416
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0xb9, offset 0x417
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	// Block 0xba, offset 0x418
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	// Block 0xbb, offset 0x41c
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	// Block 0xbc, offset 0x41e
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	// Block 0xbd, offset 0x41f
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	// Block 0xbe, offset 0x420
-	{value: 0x5653, lo: 0x80, hi: 0xb2},
-	// Block 0xbf, offset 0x421
-	{value: 0x5652, lo: 0x80, hi: 0xb2},
-	// Block 0xc0, offset 0x422
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xc1, offset 0x425
-	{value: 0x0010, lo: 0x80, hi: 0xa9},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0010, lo: 0xb0, hi: 0xb1},
-	// Block 0xc2, offset 0x428
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xc3, offset 0x42b
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x87},
-	{value: 0x0024, lo: 0x88, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x8b},
-	{value: 0x0024, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	// Block 0xc4, offset 0x431
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xc5, offset 0x432
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0010, lo: 0xa0, hi: 0xb6},
-	// Block 0xc6, offset 0x434
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xc7, offset 0x438
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xc8, offset 0x43c
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb6},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	// Block 0xc9, offset 0x442
-	{value: 0x0014, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xca, offset 0x445
-	{value: 0x0024, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0xcb, offset 0x44c
-	{value: 0x0010, lo: 0x84, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	// Block 0xcc, offset 0x450
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xcd, offset 0x454
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x89, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	// Block 0xce, offset 0x45d
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb4},
-	{value: 0x0030, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xb7},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0xcf, offset 0x466
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xd0, offset 0x46c
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa2},
-	{value: 0x0014, lo: 0xa3, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xd1, offset 0x472
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xd2, offset 0x47c
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0030, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9d, hi: 0xa3},
-	{value: 0x0024, lo: 0xa6, hi: 0xac},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	// Block 0xd3, offset 0x486
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xd4, offset 0x488
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	// Block 0xd5, offset 0x491
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xd6, offset 0x497
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd7, offset 0x49d
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd8, offset 0x4a3
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x98, hi: 0x9b},
-	{value: 0x0014, lo: 0x9c, hi: 0x9d},
-	// Block 0xd9, offset 0x4a6
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xda, offset 0x4ac
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xdb, offset 0x4af
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0014, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb5},
-	{value: 0x0030, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	// Block 0xdc, offset 0x4b8
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	// Block 0xdd, offset 0x4b9
-	{value: 0x0014, lo: 0x9d, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xde, offset 0x4c0
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	// Block 0xdf, offset 0x4c4
-	{value: 0x5f53, lo: 0xa0, hi: 0xbf},
-	// Block 0xe0, offset 0x4c5
-	{value: 0x5f52, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xe1, offset 0x4c8
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x89, hi: 0x89},
-	{value: 0x0010, lo: 0x8c, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0xb5},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0014, lo: 0xbb, hi: 0xbc},
-	{value: 0x0030, lo: 0xbd, hi: 0xbd},
-	{value: 0x0034, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xe2, offset 0x4d2
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0034, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xe3, offset 0x4d5
-	{value: 0x0010, lo: 0xa0, hi: 0xa7},
-	{value: 0x0010, lo: 0xaa, hi: 0xbf},
-	// Block 0xe4, offset 0x4d7
-	{value: 0x0010, lo: 0x80, hi: 0x93},
-	{value: 0x0014, lo: 0x94, hi: 0x97},
-	{value: 0x0014, lo: 0x9a, hi: 0x9b},
-	{value: 0x0010, lo: 0x9c, hi: 0x9f},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	// Block 0xe5, offset 0x4de
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x8a},
-	{value: 0x0010, lo: 0x8b, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbb, hi: 0xbe},
-	// Block 0xe6, offset 0x4e6
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0014, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x98},
-	{value: 0x0014, lo: 0x99, hi: 0x9b},
-	{value: 0x0010, lo: 0x9c, hi: 0xbf},
-	// Block 0xe7, offset 0x4ec
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0014, lo: 0x8a, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x99},
-	{value: 0x0010, lo: 0x9d, hi: 0x9d},
-	// Block 0xe8, offset 0x4f2
-	{value: 0x0010, lo: 0x80, hi: 0xb8},
-	// Block 0xe9, offset 0x4f3
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb6},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xea, offset 0x4f9
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0xeb, offset 0x4fc
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0014, lo: 0x92, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xa9},
-	{value: 0x0014, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0xec, offset 0x504
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb6},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xed, offset 0x50b
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa5},
-	{value: 0x0010, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xbf},
-	// Block 0xee, offset 0x515
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0014, lo: 0x90, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0x96},
-	{value: 0x0034, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xef, offset 0x51d
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	// Block 0xf0, offset 0x520
-	{value: 0x0010, lo: 0xb0, hi: 0xb0},
-	// Block 0xf1, offset 0x521
-	{value: 0x0010, lo: 0x80, hi: 0x99},
-	// Block 0xf2, offset 0x522
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	// Block 0xf3, offset 0x523
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	// Block 0xf4, offset 0x524
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	{value: 0x0014, lo: 0xb0, hi: 0xb8},
-	// Block 0xf5, offset 0x526
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	// Block 0xf6, offset 0x527
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xf7, offset 0x529
-	{value: 0x0010, lo: 0x90, hi: 0xad},
-	{value: 0x0034, lo: 0xb0, hi: 0xb4},
-	// Block 0xf8, offset 0x52b
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb6},
-	// Block 0xf9, offset 0x52d
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa3, hi: 0xb7},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xfa, offset 0x531
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	// Block 0xfb, offset 0x532
-	{value: 0x2013, lo: 0x80, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xbf},
-	// Block 0xfc, offset 0x534
-	{value: 0x0010, lo: 0x80, hi: 0x8a},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0xfd, offset 0x537
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0014, lo: 0x8f, hi: 0x9f},
-	// Block 0xfe, offset 0x539
-	{value: 0x0014, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa3, hi: 0xa4},
-	{value: 0x0030, lo: 0xb0, hi: 0xb1},
-	// Block 0xff, offset 0x53c
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbc},
-	// Block 0x100, offset 0x53e
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0034, lo: 0x9e, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa3},
-	// Block 0x101, offset 0x543
-	{value: 0x0030, lo: 0xa5, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xa9},
-	{value: 0x0030, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbf},
-	// Block 0x102, offset 0x548
-	{value: 0x0034, lo: 0x80, hi: 0x82},
-	{value: 0x0024, lo: 0x85, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8b},
-	{value: 0x0024, lo: 0xaa, hi: 0xad},
-	// Block 0x103, offset 0x54c
-	{value: 0x0024, lo: 0x82, hi: 0x84},
-	// Block 0x104, offset 0x54d
-	{value: 0x0013, lo: 0x80, hi: 0x99},
-	{value: 0x0012, lo: 0x9a, hi: 0xb3},
-	{value: 0x0013, lo: 0xb4, hi: 0xbf},
-	// Block 0x105, offset 0x550
-	{value: 0x0013, lo: 0x80, hi: 0x8d},
-	{value: 0x0012, lo: 0x8e, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0xa7},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0x106, offset 0x554
-	{value: 0x0013, lo: 0x80, hi: 0x81},
-	{value: 0x0012, lo: 0x82, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0x9c},
-	{value: 0x0013, lo: 0x9e, hi: 0x9f},
-	{value: 0x0013, lo: 0xa2, hi: 0xa2},
-	{value: 0x0013, lo: 0xa5, hi: 0xa6},
-	{value: 0x0013, lo: 0xa9, hi: 0xac},
-	{value: 0x0013, lo: 0xae, hi: 0xb5},
-	{value: 0x0012, lo: 0xb6, hi: 0xb9},
-	{value: 0x0012, lo: 0xbb, hi: 0xbb},
-	{value: 0x0012, lo: 0xbd, hi: 0xbf},
-	// Block 0x107, offset 0x55f
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0012, lo: 0x85, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0x108, offset 0x563
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0013, lo: 0x84, hi: 0x85},
-	{value: 0x0013, lo: 0x87, hi: 0x8a},
-	{value: 0x0013, lo: 0x8d, hi: 0x94},
-	{value: 0x0013, lo: 0x96, hi: 0x9c},
-	{value: 0x0012, lo: 0x9e, hi: 0xb7},
-	{value: 0x0013, lo: 0xb8, hi: 0xb9},
-	{value: 0x0013, lo: 0xbb, hi: 0xbe},
-	// Block 0x109, offset 0x56b
-	{value: 0x0013, lo: 0x80, hi: 0x84},
-	{value: 0x0013, lo: 0x86, hi: 0x86},
-	{value: 0x0013, lo: 0x8a, hi: 0x90},
-	{value: 0x0012, lo: 0x92, hi: 0xab},
-	{value: 0x0013, lo: 0xac, hi: 0xbf},
-	// Block 0x10a, offset 0x570
-	{value: 0x0013, lo: 0x80, hi: 0x85},
-	{value: 0x0012, lo: 0x86, hi: 0x9f},
-	{value: 0x0013, lo: 0xa0, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbf},
-	// Block 0x10b, offset 0x574
-	{value: 0x0012, lo: 0x80, hi: 0x93},
-	{value: 0x0013, lo: 0x94, hi: 0xad},
-	{value: 0x0012, lo: 0xae, hi: 0xbf},
-	// Block 0x10c, offset 0x577
-	{value: 0x0012, lo: 0x80, hi: 0x87},
-	{value: 0x0013, lo: 0x88, hi: 0xa1},
-	{value: 0x0012, lo: 0xa2, hi: 0xbb},
-	{value: 0x0013, lo: 0xbc, hi: 0xbf},
-	// Block 0x10d, offset 0x57b
-	{value: 0x0013, lo: 0x80, hi: 0x95},
-	{value: 0x0012, lo: 0x96, hi: 0xaf},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x10e, offset 0x57e
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0012, lo: 0x8a, hi: 0xa5},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0x10f, offset 0x581
-	{value: 0x0013, lo: 0x80, hi: 0x80},
-	{value: 0x0012, lo: 0x82, hi: 0x9a},
-	{value: 0x0012, lo: 0x9c, hi: 0xa1},
-	{value: 0x0013, lo: 0xa2, hi: 0xba},
-	{value: 0x0012, lo: 0xbc, hi: 0xbf},
-	// Block 0x110, offset 0x586
-	{value: 0x0012, lo: 0x80, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0xb4},
-	{value: 0x0012, lo: 0xb6, hi: 0xbf},
-	// Block 0x111, offset 0x58a
-	{value: 0x0012, lo: 0x80, hi: 0x8e},
-	{value: 0x0012, lo: 0x90, hi: 0x95},
-	{value: 0x0013, lo: 0x96, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x112, offset 0x58e
-	{value: 0x0012, lo: 0x80, hi: 0x88},
-	{value: 0x0012, lo: 0x8a, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0x113, offset 0x592
-	{value: 0x0012, lo: 0x80, hi: 0x82},
-	{value: 0x0012, lo: 0x84, hi: 0x89},
-	{value: 0x0017, lo: 0x8a, hi: 0x8b},
-	{value: 0x0010, lo: 0x8e, hi: 0xbf},
-	// Block 0x114, offset 0x596
-	{value: 0x0014, lo: 0x80, hi: 0xb6},
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x115, offset 0x598
-	{value: 0x0014, lo: 0x80, hi: 0xac},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x116, offset 0x59a
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x9b, hi: 0x9f},
-	{value: 0x0014, lo: 0xa1, hi: 0xaf},
-	// Block 0x117, offset 0x59d
-	{value: 0x0024, lo: 0x80, hi: 0x86},
-	{value: 0x0024, lo: 0x88, hi: 0x98},
-	{value: 0x0024, lo: 0x9b, hi: 0xa1},
-	{value: 0x0024, lo: 0xa3, hi: 0xa4},
-	{value: 0x0024, lo: 0xa6, hi: 0xaa},
-	// Block 0x118, offset 0x5a2
-	{value: 0x0010, lo: 0x80, hi: 0xac},
-	{value: 0x0024, lo: 0xb0, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xbd},
-	// Block 0x119, offset 0x5a5
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	// Block 0x11a, offset 0x5a7
-	{value: 0x0010, lo: 0x80, hi: 0xab},
-	{value: 0x0024, lo: 0xac, hi: 0xaf},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x11b, offset 0x5aa
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0034, lo: 0x90, hi: 0x96},
-	// Block 0x11c, offset 0x5ac
-	{value: 0xbc52, lo: 0x80, hi: 0x81},
-	{value: 0xbf52, lo: 0x82, hi: 0x83},
-	{value: 0x0024, lo: 0x84, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8b},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x11d, offset 0x5b2
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x9f},
-	{value: 0x0010, lo: 0xa1, hi: 0xa2},
-	{value: 0x0010, lo: 0xa4, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb7},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	// Block 0x11e, offset 0x5bb
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x9b},
-	{value: 0x0010, lo: 0xa1, hi: 0xa3},
-	{value: 0x0010, lo: 0xa5, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xbb},
-	// Block 0x11f, offset 0x5c0
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x120, offset 0x5c1
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x121, offset 0x5c4
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	// Block 0x122, offset 0x5c5
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x123, offset 0x5c6
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x124, offset 0x5c7
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0014, lo: 0xa0, hi: 0xbf},
-	// Block 0x125, offset 0x5c9
-	{value: 0x0014, lo: 0x80, hi: 0xbf},
-	// Block 0x126, offset 0x5ca
-	{value: 0x0014, lo: 0x80, hi: 0xaf},
-}
-
-// Total table size 15212 bytes (14KiB); checksum: 1EB13752
diff --git a/vendor/golang.org/x/text/cases/tables9.0.0.go b/vendor/golang.org/x/text/cases/tables9.0.0.go
deleted file mode 100644
index 636d5d14df..0000000000
--- a/vendor/golang.org/x/text/cases/tables9.0.0.go
+++ /dev/null
@@ -1,2216 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-//go:build !go1.10
-// +build !go1.10
-
-package cases
-
-// UnicodeVersion is the Unicode version from which the tables in this package are derived.
-const UnicodeVersion = "9.0.0"
-
-var xorData string = "" + // Size: 185 bytes
-	"\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" +
-	"\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" +
-	"\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" +
-	"\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" +
-	"\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" +
-	"\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" +
-	"\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" +
-	"\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" +
-	"\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22"
-
-var exceptions string = "" + // Size: 2068 bytes
-	"\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" +
-	"\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" +
-	"\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" +
-	"\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" +
-	"\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" +
-	"\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" +
-	"Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" +
-	"\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" +
-	"Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" +
-	"\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" +
-	"ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" +
-	"ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" +
-	"\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" +
-	"\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" +
-	"\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" +
-	"Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" +
-	"\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" +
-	"\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" +
-	"\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" +
-	"ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" +
-	"\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" +
-	"ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" +
-	"̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" +
-	"ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" +
-	"\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" +
-	"\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" +
-	"\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" +
-	"Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" +
-	"stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" +
-	"ԽՄխ"
-
-// lookup returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookup(s []byte) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupUnsafe(s []byte) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// lookupString returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *caseTrie) lookupString(s string) (v uint16, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return caseValues[c0], 1
-	case c0 < 0xC2:
-		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := caseIndex[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = caseIndex[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = caseIndex[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *caseTrie) lookupStringUnsafe(s string) uint16 {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return caseValues[c0]
-	}
-	i := caseIndex[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = caseIndex[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-
-// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 795fe57ee5135873.
-type caseTrie struct{}
-
-func newCaseTrie(i int) *caseTrie {
-	return &caseTrie{}
-}
-
-// lookupValue determines the type of block n and looks up the value for b.
-func (t *caseTrie) lookupValue(n uint32, b byte) uint16 {
-	switch {
-	case n < 18:
-		return uint16(caseValues[n<<6+uint32(b)])
-	default:
-		n -= 18
-		return uint16(sparse.lookup(n, b))
-	}
-}
-
-// caseValues: 20 blocks, 1280 entries, 2560 bytes
-// The third block is the zero block.
-var caseValues = [1280]uint16{
-	// Block 0x0, offset 0x0
-	0x27: 0x0054,
-	0x2e: 0x0054,
-	0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010,
-	0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054,
-	// Block 0x1, offset 0x40
-	0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013,
-	0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013,
-	0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013,
-	0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013,
-	0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013,
-	0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012,
-	0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012,
-	0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012,
-	0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012,
-	0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012,
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112,
-	0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713,
-	0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313,
-	0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653,
-	0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53,
-	0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112,
-	0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853,
-	0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13,
-	0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313,
-	0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010,
-	0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452,
-	// Block 0x4, offset 0x100
-	0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359,
-	0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619,
-	0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313,
-	0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13,
-	0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452,
-	0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112,
-	0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112,
-	0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112,
-	0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112,
-	0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112,
-	0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112,
-	// Block 0x5, offset 0x140
-	0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53,
-	0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112,
-	0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a,
-	0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152,
-	0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012,
-	0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052,
-	0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652,
-	0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52,
-	0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252,
-	0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012,
-	0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012,
-	// Block 0x6, offset 0x180
-	0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012,
-	0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52,
-	0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012,
-	0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012,
-	0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a,
-	0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012,
-	0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012,
-	0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012,
-	0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015,
-	0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014,
-	0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d,
-	0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024,
-	0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024,
-	0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024,
-	0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034,
-	0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024,
-	0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024,
-	0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024,
-	0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004,
-	0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52,
-	0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353,
-	// Block 0x8, offset 0x200
-	0x204: 0x0004, 0x205: 0x0004,
-	0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513,
-	0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013,
-	0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013,
-	0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013,
-	0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53,
-	0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53,
-	0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512,
-	0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012,
-	0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012,
-	0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012,
-	// Block 0x9, offset 0x240
-	0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52,
-	0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52,
-	0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a,
-	0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812,
-	0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112,
-	0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112,
-	0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112,
-	0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112,
-	0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a,
-	0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112,
-	0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053,
-	// Block 0xa, offset 0x280
-	0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812,
-	0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813,
-	0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812,
-	0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812,
-	0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813,
-	0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812,
-	0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813,
-	0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813,
-	0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152,
-	0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52,
-	0x2bc: 0x4d52, 0x2bd: 0x4d52,
-	// Block 0xb, offset 0x2c0
-	0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea,
-	0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289,
-	0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a,
-	0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca,
-	0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369,
-	0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a,
-	0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9,
-	0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449,
-	0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a,
-	0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53,
-	0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004,
-	// Block 0xc, offset 0x300
-	0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a,
-	0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153,
-	0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812,
-	0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a,
-	0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004,
-	0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa,
-	0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813,
-	0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004,
-	0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a,
-	0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53,
-	0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004,
-	// Block 0xd, offset 0x340
-	0x342: 0x0013,
-	0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013,
-	0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013,
-	0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013,
-	0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013,
-	0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013,
-	0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012,
-	0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010,
-	0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012,
-	0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013,
-	// Block 0xe, offset 0x380
-	0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13,
-	0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13,
-	0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052,
-	0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352,
-	0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12,
-	0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12,
-	0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612,
-	// Block 0xf, offset 0x3c0
-	0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552,
-	0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552,
-	0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952,
-	0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952,
-	0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952,
-	0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853,
-	0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313,
-	0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b,
-	0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313,
-	0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012,
-	0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b,
-	// Block 0x10, offset 0x400
-	0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112,
-	0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713,
-	0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112,
-	0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112,
-	0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112,
-	0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112,
-	0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112,
-	0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b,
-	0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112,
-	0x436: 0x0113, 0x437: 0x0112,
-	// Block 0x11, offset 0x440
-	0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea,
-	0x446: 0x7c6a,
-	0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a,
-	0x45d: 0x0010,
-	0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010,
-	0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010,
-	0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010,
-	0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010,
-	0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010,
-	0x47c: 0x0010, 0x47e: 0x0010,
-	// Block 0x12, offset 0x480
-	0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213,
-	0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613,
-	0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213,
-	0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13,
-	0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213,
-	0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212,
-	0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12,
-	0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212,
-	0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612,
-	0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212,
-	0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212,
-	// Block 0x13, offset 0x4c0
-	0x4c2: 0x0010,
-	0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010,
-	0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010,
-	0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010,
-	0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010,
-	0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010,
-	0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010,
-	0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010,
-	0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010,
-	0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010,
-	0x4fc: 0x0010, 0x4fe: 0x0010,
-}
-
-// caseIndex: 25 blocks, 1600 entries, 3200 bytes
-// Block 0 is the zero block.
-var caseIndex = [1600]uint16{
-	// Block 0x0, offset 0x0
-	// Block 0x1, offset 0x40
-	// Block 0x2, offset 0x80
-	// Block 0x3, offset 0xc0
-	0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02,
-	0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07,
-	0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20,
-	0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28,
-	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
-	0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09,
-	0xf0: 0x14, 0xf3: 0x16,
-	// Block 0x4, offset 0x100
-	0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30,
-	0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38,
-	0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40,
-	0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48,
-	// Block 0x5, offset 0x140
-	0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23,
-	0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53,
-	0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23,
-	0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b,
-	0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62,
-	0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69,
-	0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71,
-	0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a,
-	// Block 0x6, offset 0x180
-	0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a,
-	0x192: 0x7b, 0x193: 0x0c,
-	0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81,
-	0x1b8: 0x82,
-	// Block 0x7, offset 0x1c0
-	0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87,
-	// Block 0x8, offset 0x200
-	0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23,
-	0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23,
-	0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23,
-	0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91,
-	0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98,
-	0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0,
-	0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23,
-	0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23,
-	// Block 0x9, offset 0x240
-	0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23,
-	0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23,
-	0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23,
-	0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23,
-	0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23,
-	0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23,
-	0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23,
-	0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23,
-	// Block 0xa, offset 0x280
-	0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23,
-	0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23,
-	0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23,
-	0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2,
-	// Block 0xb, offset 0x2c0
-	0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5,
-	0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9,
-	0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0,
-	// Block 0xc, offset 0x300
-	0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5,
-	0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb,
-	0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1,
-	0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3,
-	0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9,
-	0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf,
-	0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2,
-	// Block 0xd, offset 0x340
-	0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda,
-	0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf,
-	0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5,
-	0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea,
-	0x362: 0xeb, 0x363: 0xec,
-	0x36b: 0xed,
-	0x370: 0xee, 0x371: 0xef, 0x372: 0xf0,
-	// Block 0xe, offset 0x380
-	0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23,
-	0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1,
-	0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3,
-	// Block 0xf, offset 0x3c0
-	0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23,
-	0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23,
-	0x3d0: 0xf2,
-	// Block 0x10, offset 0x400
-	0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23,
-	0x418: 0x23, 0x419: 0xf4,
-	// Block 0x11, offset 0x440
-	0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23,
-	0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9,
-	0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc,
-	// Block 0x12, offset 0x480
-	0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe,
-	// Block 0x13, offset 0x4c0
-	0x4c5: 0xff, 0x4c6: 0x100,
-	0x4c9: 0x101,
-	0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109,
-	0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111,
-	0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114,
-	// Block 0x14, offset 0x500
-	0x500: 0x115,
-	0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117,
-	0x538: 0x118, 0x539: 0x11, 0x53a: 0x119,
-	// Block 0x15, offset 0x540
-	0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c,
-	0x54f: 0x11d,
-	// Block 0x16, offset 0x580
-	0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f,
-	0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13,
-	// Block 0x17, offset 0x5c0
-	0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120,
-	// Block 0x18, offset 0x600
-	0x620: 0x15,
-}
-
-// sparseOffsets: 272 entries, 544 bytes
-var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550}
-
-// sparseValues: 1360 entries, 5440 bytes
-var sparseValues = [1360]valueRange{
-	// Block 0x0, offset 0x0
-	{value: 0x0004, lo: 0xa8, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xaa},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0004, lo: 0xaf, hi: 0xaf},
-	{value: 0x0004, lo: 0xb4, hi: 0xb4},
-	{value: 0x001a, lo: 0xb5, hi: 0xb5},
-	{value: 0x0054, lo: 0xb7, hi: 0xb7},
-	{value: 0x0004, lo: 0xb8, hi: 0xb8},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	// Block 0x1, offset 0x9
-	{value: 0x2013, lo: 0x80, hi: 0x96},
-	{value: 0x2013, lo: 0x98, hi: 0x9e},
-	{value: 0x009a, lo: 0x9f, hi: 0x9f},
-	{value: 0x2012, lo: 0xa0, hi: 0xb6},
-	{value: 0x2012, lo: 0xb8, hi: 0xbe},
-	{value: 0x0252, lo: 0xbf, hi: 0xbf},
-	// Block 0x2, offset 0xf
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x011b, lo: 0xb0, hi: 0xb0},
-	{value: 0x019a, lo: 0xb1, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb7},
-	{value: 0x0012, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x0553, lo: 0xbf, hi: 0xbf},
-	// Block 0x3, offset 0x18
-	{value: 0x0552, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x01da, lo: 0x89, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xb7},
-	{value: 0x0253, lo: 0xb8, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x0316, lo: 0xbd, hi: 0xbe},
-	{value: 0x028a, lo: 0xbf, hi: 0xbf},
-	// Block 0x4, offset 0x24
-	{value: 0x0117, lo: 0x80, hi: 0x9f},
-	{value: 0x2f53, lo: 0xa0, hi: 0xa0},
-	{value: 0x0012, lo: 0xa1, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xb3},
-	{value: 0x0012, lo: 0xb4, hi: 0xb9},
-	{value: 0x090b, lo: 0xba, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x2953, lo: 0xbd, hi: 0xbd},
-	{value: 0x098b, lo: 0xbe, hi: 0xbe},
-	{value: 0x0a0a, lo: 0xbf, hi: 0xbf},
-	// Block 0x5, offset 0x2e
-	{value: 0x0015, lo: 0x80, hi: 0x81},
-	{value: 0x0004, lo: 0x82, hi: 0x85},
-	{value: 0x0014, lo: 0x86, hi: 0x91},
-	{value: 0x0004, lo: 0x92, hi: 0x96},
-	{value: 0x0054, lo: 0x97, hi: 0x97},
-	{value: 0x0004, lo: 0x98, hi: 0x9f},
-	{value: 0x0015, lo: 0xa0, hi: 0xa4},
-	{value: 0x0004, lo: 0xa5, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xac},
-	{value: 0x0004, lo: 0xad, hi: 0xad},
-	{value: 0x0014, lo: 0xae, hi: 0xae},
-	{value: 0x0004, lo: 0xaf, hi: 0xbf},
-	// Block 0x6, offset 0x3a
-	{value: 0x0024, lo: 0x80, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbf},
-	// Block 0x7, offset 0x3d
-	{value: 0x6553, lo: 0x80, hi: 0x8f},
-	{value: 0x2013, lo: 0x90, hi: 0x9f},
-	{value: 0x5f53, lo: 0xa0, hi: 0xaf},
-	{value: 0x2012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8, offset 0x41
-	{value: 0x5f52, lo: 0x80, hi: 0x8f},
-	{value: 0x6552, lo: 0x90, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x9, offset 0x44
-	{value: 0x0117, lo: 0x80, hi: 0x81},
-	{value: 0x0024, lo: 0x83, hi: 0x87},
-	{value: 0x0014, lo: 0x88, hi: 0x89},
-	{value: 0x0117, lo: 0x8a, hi: 0xbf},
-	// Block 0xa, offset 0x48
-	{value: 0x0f13, lo: 0x80, hi: 0x80},
-	{value: 0x0316, lo: 0x81, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0316, lo: 0x85, hi: 0x86},
-	{value: 0x0f16, lo: 0x87, hi: 0x88},
-	{value: 0x0316, lo: 0x89, hi: 0x8a},
-	{value: 0x0716, lo: 0x8b, hi: 0x8c},
-	{value: 0x0316, lo: 0x8d, hi: 0x8e},
-	{value: 0x0f12, lo: 0x8f, hi: 0x8f},
-	{value: 0x0117, lo: 0x90, hi: 0xbf},
-	// Block 0xb, offset 0x52
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x6553, lo: 0xb1, hi: 0xbf},
-	// Block 0xc, offset 0x54
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6853, lo: 0x90, hi: 0x96},
-	{value: 0x0014, lo: 0x99, hi: 0x99},
-	{value: 0x6552, lo: 0xa1, hi: 0xaf},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0xd, offset 0x59
-	{value: 0x6852, lo: 0x80, hi: 0x86},
-	{value: 0x198a, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x91, hi: 0x91},
-	{value: 0x0024, lo: 0x92, hi: 0x95},
-	{value: 0x0034, lo: 0x96, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x99},
-	{value: 0x0034, lo: 0x9a, hi: 0x9b},
-	{value: 0x0024, lo: 0x9c, hi: 0xa1},
-	{value: 0x0034, lo: 0xa2, hi: 0xa7},
-	{value: 0x0024, lo: 0xa8, hi: 0xa9},
-	{value: 0x0034, lo: 0xaa, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xaf},
-	{value: 0x0034, lo: 0xb0, hi: 0xbd},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xe, offset 0x69
-	{value: 0x0034, lo: 0x81, hi: 0x82},
-	{value: 0x0024, lo: 0x84, hi: 0x84},
-	{value: 0x0034, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xb3},
-	{value: 0x0054, lo: 0xb4, hi: 0xb4},
-	// Block 0xf, offset 0x70
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0024, lo: 0x90, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0014, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x10, offset 0x75
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x8a},
-	{value: 0x0034, lo: 0x8b, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9c},
-	{value: 0x0024, lo: 0x9d, hi: 0x9e},
-	{value: 0x0034, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0034, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x11, offset 0x83
-	{value: 0x0010, lo: 0x80, hi: 0xbf},
-	// Block 0x12, offset 0x84
-	{value: 0x0010, lo: 0x80, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0024, lo: 0x9f, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xaa, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x13, offset 0x92
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0034, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0034, lo: 0xb1, hi: 0xb1},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbc},
-	{value: 0x0024, lo: 0xbd, hi: 0xbd},
-	{value: 0x0034, lo: 0xbe, hi: 0xbe},
-	{value: 0x0024, lo: 0xbf, hi: 0xbf},
-	// Block 0x14, offset 0xa1
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0024, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x88},
-	{value: 0x0024, lo: 0x89, hi: 0x8a},
-	{value: 0x0010, lo: 0x8d, hi: 0xbf},
-	// Block 0x15, offset 0xab
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x16, offset 0xae
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0024, lo: 0xab, hi: 0xb1},
-	{value: 0x0034, lo: 0xb2, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	// Block 0x17, offset 0xb4
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0024, lo: 0x96, hi: 0x99},
-	{value: 0x0014, lo: 0x9a, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0xa3},
-	{value: 0x0014, lo: 0xa4, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xad},
-	// Block 0x18, offset 0xbc
-	{value: 0x0010, lo: 0x80, hi: 0x98},
-	{value: 0x0034, lo: 0x99, hi: 0x9b},
-	// Block 0x19, offset 0xbe
-	{value: 0x0010, lo: 0xa0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbd},
-	// Block 0x1a, offset 0xc0
-	{value: 0x0024, lo: 0x94, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0034, lo: 0xa3, hi: 0xa3},
-	{value: 0x0024, lo: 0xa4, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0024, lo: 0xaa, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xb2},
-	{value: 0x0024, lo: 0xb3, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbf},
-	// Block 0x1b, offset 0xce
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1c, offset 0xd4
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0024, lo: 0x93, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x98, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0x1d, offset 0xe2
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb6, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x1e, offset 0xed
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xb1},
-	// Block 0x1f, offset 0xf8
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x20, offset 0x103
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x91, hi: 0x91},
-	{value: 0x0010, lo: 0x99, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x21, offset 0x10f
-	{value: 0x0014, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x22, offset 0x119
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x85},
-	{value: 0x0014, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x89, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	// Block 0x23, offset 0x124
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x24, offset 0x12f
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9c, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	// Block 0x25, offset 0x13b
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8a},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	{value: 0x0010, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0010, lo: 0xa8, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x26, offset 0x147
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x82},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x27, offset 0x14f
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb9},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbf},
-	// Block 0x28, offset 0x157
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x88},
-	{value: 0x0014, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0034, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	// Block 0x29, offset 0x161
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x2a, offset 0x16c
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x95, hi: 0x96},
-	{value: 0x0010, lo: 0x9e, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb1, hi: 0xb2},
-	// Block 0x2b, offset 0x178
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0xba},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x2c, offset 0x17e
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8e, hi: 0x8e},
-	{value: 0x0010, lo: 0x94, hi: 0x97},
-	{value: 0x0010, lo: 0x9f, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa3},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xba, hi: 0xbf},
-	// Block 0x2d, offset 0x189
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x96},
-	{value: 0x0010, lo: 0x9a, hi: 0xb1},
-	{value: 0x0010, lo: 0xb3, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x2e, offset 0x18e
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x8f, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x94},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9f},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	// Block 0x2f, offset 0x196
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xba},
-	// Block 0x30, offset 0x199
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x87},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x31, offset 0x19e
-	{value: 0x0014, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb4, hi: 0xb7},
-	{value: 0x0034, lo: 0xb8, hi: 0xb9},
-	{value: 0x0014, lo: 0xbb, hi: 0xbc},
-	// Block 0x32, offset 0x1a2
-	{value: 0x0004, lo: 0x86, hi: 0x86},
-	{value: 0x0034, lo: 0x88, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x33, offset 0x1a6
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0034, lo: 0x98, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0034, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x34, offset 0x1ad
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xac},
-	{value: 0x0034, lo: 0xb1, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xba, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x35, offset 0x1b6
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0024, lo: 0x82, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0024, lo: 0x86, hi: 0x87},
-	{value: 0x0010, lo: 0x88, hi: 0x8c},
-	{value: 0x0014, lo: 0x8d, hi: 0x97},
-	{value: 0x0014, lo: 0x99, hi: 0xbc},
-	// Block 0x36, offset 0x1be
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	// Block 0x37, offset 0x1bf
-	{value: 0x0010, lo: 0xab, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	{value: 0x0010, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbe},
-	// Block 0x38, offset 0x1c8
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x96, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x99},
-	{value: 0x0014, lo: 0x9e, hi: 0xa0},
-	{value: 0x0010, lo: 0xa2, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xad},
-	{value: 0x0014, lo: 0xb1, hi: 0xb4},
-	// Block 0x39, offset 0x1cf
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x6c53, lo: 0xa0, hi: 0xbf},
-	// Block 0x3a, offset 0x1d7
-	{value: 0x7053, lo: 0x80, hi: 0x85},
-	{value: 0x7053, lo: 0x87, hi: 0x87},
-	{value: 0x7053, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xba},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x3b, offset 0x1dd
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x9a, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x3c, offset 0x1e3
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x3d, offset 0x1e8
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x82, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3e, offset 0x1ec
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0010, lo: 0x92, hi: 0x95},
-	{value: 0x0010, lo: 0x98, hi: 0xbf},
-	// Block 0x3f, offset 0x1ef
-	{value: 0x0010, lo: 0x80, hi: 0x9a},
-	{value: 0x0024, lo: 0x9d, hi: 0x9f},
-	// Block 0x40, offset 0x1f1
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x7453, lo: 0xa0, hi: 0xaf},
-	{value: 0x7853, lo: 0xb0, hi: 0xbf},
-	// Block 0x41, offset 0x1f4
-	{value: 0x7c53, lo: 0x80, hi: 0x8f},
-	{value: 0x8053, lo: 0x90, hi: 0x9f},
-	{value: 0x7c53, lo: 0xa0, hi: 0xaf},
-	{value: 0x0813, lo: 0xb0, hi: 0xb5},
-	{value: 0x0892, lo: 0xb8, hi: 0xbd},
-	// Block 0x42, offset 0x1f9
-	{value: 0x0010, lo: 0x81, hi: 0xbf},
-	// Block 0x43, offset 0x1fa
-	{value: 0x0010, lo: 0x80, hi: 0xac},
-	{value: 0x0010, lo: 0xaf, hi: 0xbf},
-	// Block 0x44, offset 0x1fc
-	{value: 0x0010, lo: 0x81, hi: 0x9a},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x45, offset 0x1fe
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xae, hi: 0xb8},
-	// Block 0x46, offset 0x200
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	{value: 0x0010, lo: 0x8e, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0034, lo: 0x94, hi: 0x94},
-	{value: 0x0010, lo: 0xa0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	// Block 0x47, offset 0x207
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0014, lo: 0x92, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xac},
-	{value: 0x0010, lo: 0xae, hi: 0xb0},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	// Block 0x48, offset 0x20c
-	{value: 0x0014, lo: 0xb4, hi: 0xb5},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0x49, offset 0x210
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0014, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0014, lo: 0x89, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x92},
-	{value: 0x0014, lo: 0x93, hi: 0x93},
-	{value: 0x0004, lo: 0x97, hi: 0x97},
-	{value: 0x0024, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0x4a, offset 0x219
-	{value: 0x0014, lo: 0x8b, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x4b, offset 0x21c
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb7},
-	// Block 0x4c, offset 0x21f
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x4d, offset 0x225
-	{value: 0x0010, lo: 0x80, hi: 0xb5},
-	// Block 0x4e, offset 0x226
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xb9},
-	{value: 0x0024, lo: 0xba, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbb},
-	// Block 0x4f, offset 0x231
-	{value: 0x0010, lo: 0x86, hi: 0x8f},
-	// Block 0x50, offset 0x232
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x51, offset 0x233
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0024, lo: 0x97, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x98},
-	{value: 0x0010, lo: 0x99, hi: 0x9a},
-	{value: 0x0014, lo: 0x9b, hi: 0x9b},
-	// Block 0x52, offset 0x238
-	{value: 0x0010, lo: 0x95, hi: 0x95},
-	{value: 0x0014, lo: 0x96, hi: 0x96},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0014, lo: 0x98, hi: 0x9e},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa2},
-	{value: 0x0010, lo: 0xa3, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xac},
-	{value: 0x0010, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0024, lo: 0xb5, hi: 0xbc},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x53, offset 0x245
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xa7, hi: 0xa7},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	{value: 0x0034, lo: 0xb5, hi: 0xba},
-	{value: 0x0024, lo: 0xbb, hi: 0xbc},
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0x54, offset 0x24d
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x55, offset 0x255
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x83},
-	{value: 0x0030, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x8b},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xab, hi: 0xab},
-	{value: 0x0034, lo: 0xac, hi: 0xac},
-	{value: 0x0024, lo: 0xad, hi: 0xb3},
-	// Block 0x56, offset 0x25e
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0030, lo: 0xaa, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xbf},
-	// Block 0x57, offset 0x267
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa9},
-	{value: 0x0010, lo: 0xaa, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0030, lo: 0xb2, hi: 0xb3},
-	// Block 0x58, offset 0x270
-	{value: 0x0010, lo: 0x80, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0x59, offset 0x275
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8d, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x5a, offset 0x278
-	{value: 0x1a6a, lo: 0x80, hi: 0x80},
-	{value: 0x1aea, lo: 0x81, hi: 0x81},
-	{value: 0x1b6a, lo: 0x82, hi: 0x82},
-	{value: 0x1bea, lo: 0x83, hi: 0x83},
-	{value: 0x1c6a, lo: 0x84, hi: 0x84},
-	{value: 0x1cea, lo: 0x85, hi: 0x85},
-	{value: 0x1d6a, lo: 0x86, hi: 0x86},
-	{value: 0x1dea, lo: 0x87, hi: 0x87},
-	{value: 0x1e6a, lo: 0x88, hi: 0x88},
-	// Block 0x5b, offset 0x281
-	{value: 0x0024, lo: 0x90, hi: 0x92},
-	{value: 0x0034, lo: 0x94, hi: 0x99},
-	{value: 0x0024, lo: 0x9a, hi: 0x9b},
-	{value: 0x0034, lo: 0x9c, hi: 0x9f},
-	{value: 0x0024, lo: 0xa0, hi: 0xa0},
-	{value: 0x0010, lo: 0xa1, hi: 0xa1},
-	{value: 0x0034, lo: 0xa2, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xb3},
-	{value: 0x0024, lo: 0xb4, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb6},
-	{value: 0x0024, lo: 0xb8, hi: 0xb9},
-	// Block 0x5c, offset 0x28e
-	{value: 0x0012, lo: 0x80, hi: 0xab},
-	{value: 0x0015, lo: 0xac, hi: 0xbf},
-	// Block 0x5d, offset 0x290
-	{value: 0x0015, lo: 0x80, hi: 0xaa},
-	{value: 0x0012, lo: 0xab, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb8},
-	{value: 0x8452, lo: 0xb9, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbc},
-	{value: 0x8852, lo: 0xbd, hi: 0xbd},
-	{value: 0x0012, lo: 0xbe, hi: 0xbf},
-	// Block 0x5e, offset 0x297
-	{value: 0x0012, lo: 0x80, hi: 0x9a},
-	{value: 0x0015, lo: 0x9b, hi: 0xbf},
-	// Block 0x5f, offset 0x299
-	{value: 0x0024, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0024, lo: 0x83, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0024, lo: 0x8b, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x90},
-	{value: 0x0024, lo: 0x91, hi: 0xb5},
-	{value: 0x0024, lo: 0xbb, hi: 0xbb},
-	{value: 0x0034, lo: 0xbc, hi: 0xbd},
-	{value: 0x0024, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x60, offset 0x2a4
-	{value: 0x0117, lo: 0x80, hi: 0xbf},
-	// Block 0x61, offset 0x2a5
-	{value: 0x0117, lo: 0x80, hi: 0x95},
-	{value: 0x1f1a, lo: 0x96, hi: 0x96},
-	{value: 0x1fca, lo: 0x97, hi: 0x97},
-	{value: 0x207a, lo: 0x98, hi: 0x98},
-	{value: 0x212a, lo: 0x99, hi: 0x99},
-	{value: 0x21da, lo: 0x9a, hi: 0x9a},
-	{value: 0x228a, lo: 0x9b, hi: 0x9b},
-	{value: 0x0012, lo: 0x9c, hi: 0x9d},
-	{value: 0x233b, lo: 0x9e, hi: 0x9e},
-	{value: 0x0012, lo: 0x9f, hi: 0x9f},
-	{value: 0x0117, lo: 0xa0, hi: 0xbf},
-	// Block 0x62, offset 0x2b0
-	{value: 0x0812, lo: 0x80, hi: 0x87},
-	{value: 0x0813, lo: 0x88, hi: 0x8f},
-	{value: 0x0812, lo: 0x90, hi: 0x95},
-	{value: 0x0813, lo: 0x98, hi: 0x9d},
-	{value: 0x0812, lo: 0xa0, hi: 0xa7},
-	{value: 0x0813, lo: 0xa8, hi: 0xaf},
-	{value: 0x0812, lo: 0xb0, hi: 0xb7},
-	{value: 0x0813, lo: 0xb8, hi: 0xbf},
-	// Block 0x63, offset 0x2b8
-	{value: 0x0004, lo: 0x8b, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8f},
-	{value: 0x0054, lo: 0x98, hi: 0x99},
-	{value: 0x0054, lo: 0xa4, hi: 0xa4},
-	{value: 0x0054, lo: 0xa7, hi: 0xa7},
-	{value: 0x0014, lo: 0xaa, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xaf},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x64, offset 0x2c0
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x94, hi: 0x94},
-	{value: 0x0014, lo: 0xa0, hi: 0xa4},
-	{value: 0x0014, lo: 0xa6, hi: 0xaf},
-	{value: 0x0015, lo: 0xb1, hi: 0xb1},
-	{value: 0x0015, lo: 0xbf, hi: 0xbf},
-	// Block 0x65, offset 0x2c6
-	{value: 0x0015, lo: 0x90, hi: 0x9c},
-	// Block 0x66, offset 0x2c7
-	{value: 0x0024, lo: 0x90, hi: 0x91},
-	{value: 0x0034, lo: 0x92, hi: 0x93},
-	{value: 0x0024, lo: 0x94, hi: 0x97},
-	{value: 0x0034, lo: 0x98, hi: 0x9a},
-	{value: 0x0024, lo: 0x9b, hi: 0x9c},
-	{value: 0x0014, lo: 0x9d, hi: 0xa0},
-	{value: 0x0024, lo: 0xa1, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa4},
-	{value: 0x0034, lo: 0xa5, hi: 0xa6},
-	{value: 0x0024, lo: 0xa7, hi: 0xa7},
-	{value: 0x0034, lo: 0xa8, hi: 0xa8},
-	{value: 0x0024, lo: 0xa9, hi: 0xa9},
-	{value: 0x0034, lo: 0xaa, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	// Block 0x67, offset 0x2d5
-	{value: 0x0016, lo: 0x85, hi: 0x86},
-	{value: 0x0012, lo: 0x87, hi: 0x89},
-	{value: 0x9d52, lo: 0x8e, hi: 0x8e},
-	{value: 0x1013, lo: 0xa0, hi: 0xaf},
-	{value: 0x1012, lo: 0xb0, hi: 0xbf},
-	// Block 0x68, offset 0x2da
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0716, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x88},
-	// Block 0x69, offset 0x2dd
-	{value: 0xa053, lo: 0xb6, hi: 0xb7},
-	{value: 0xa353, lo: 0xb8, hi: 0xb9},
-	{value: 0xa653, lo: 0xba, hi: 0xbb},
-	{value: 0xa353, lo: 0xbc, hi: 0xbd},
-	{value: 0xa053, lo: 0xbe, hi: 0xbf},
-	// Block 0x6a, offset 0x2e2
-	{value: 0x3013, lo: 0x80, hi: 0x8f},
-	{value: 0x6553, lo: 0x90, hi: 0x9f},
-	{value: 0xa953, lo: 0xa0, hi: 0xae},
-	{value: 0x3012, lo: 0xb0, hi: 0xbf},
-	// Block 0x6b, offset 0x2e6
-	{value: 0x0117, lo: 0x80, hi: 0xa3},
-	{value: 0x0012, lo: 0xa4, hi: 0xa4},
-	{value: 0x0716, lo: 0xab, hi: 0xac},
-	{value: 0x0316, lo: 0xad, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xb3},
-	// Block 0x6c, offset 0x2ec
-	{value: 0x6c52, lo: 0x80, hi: 0x9f},
-	{value: 0x7052, lo: 0xa0, hi: 0xa5},
-	{value: 0x7052, lo: 0xa7, hi: 0xa7},
-	{value: 0x7052, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x6d, offset 0x2f1
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0x6e, offset 0x2f4
-	{value: 0x0010, lo: 0x80, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0010, lo: 0xb0, hi: 0xb6},
-	{value: 0x0010, lo: 0xb8, hi: 0xbe},
-	// Block 0x6f, offset 0x2f9
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x8e},
-	{value: 0x0010, lo: 0x90, hi: 0x96},
-	{value: 0x0010, lo: 0x98, hi: 0x9e},
-	{value: 0x0024, lo: 0xa0, hi: 0xbf},
-	// Block 0x70, offset 0x2fe
-	{value: 0x0014, lo: 0xaf, hi: 0xaf},
-	// Block 0x71, offset 0x2ff
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0xaa, hi: 0xad},
-	{value: 0x0030, lo: 0xae, hi: 0xaf},
-	{value: 0x0004, lo: 0xb1, hi: 0xb5},
-	{value: 0x0014, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	// Block 0x72, offset 0x305
-	{value: 0x0034, lo: 0x99, hi: 0x9a},
-	{value: 0x0004, lo: 0x9b, hi: 0x9e},
-	// Block 0x73, offset 0x307
-	{value: 0x0004, lo: 0xbc, hi: 0xbe},
-	// Block 0x74, offset 0x308
-	{value: 0x0010, lo: 0x85, hi: 0xad},
-	{value: 0x0010, lo: 0xb1, hi: 0xbf},
-	// Block 0x75, offset 0x30a
-	{value: 0x0010, lo: 0x80, hi: 0x8e},
-	{value: 0x0010, lo: 0xa0, hi: 0xba},
-	// Block 0x76, offset 0x30c
-	{value: 0x0010, lo: 0x80, hi: 0x94},
-	{value: 0x0014, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0x96, hi: 0xbf},
-	// Block 0x77, offset 0x30f
-	{value: 0x0010, lo: 0x80, hi: 0x8c},
-	// Block 0x78, offset 0x310
-	{value: 0x0010, lo: 0x90, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	// Block 0x79, offset 0x312
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0xab},
-	// Block 0x7a, offset 0x315
-	{value: 0x0117, lo: 0x80, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xae},
-	{value: 0x0024, lo: 0xaf, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb2},
-	{value: 0x0024, lo: 0xb4, hi: 0xbd},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x7b, offset 0x31b
-	{value: 0x0117, lo: 0x80, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9d},
-	{value: 0x0024, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0x7c, offset 0x31f
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb1},
-	// Block 0x7d, offset 0x321
-	{value: 0x0004, lo: 0x80, hi: 0x96},
-	{value: 0x0014, lo: 0x97, hi: 0x9f},
-	{value: 0x0004, lo: 0xa0, hi: 0xa1},
-	{value: 0x0117, lo: 0xa2, hi: 0xaf},
-	{value: 0x0012, lo: 0xb0, hi: 0xb1},
-	{value: 0x0117, lo: 0xb2, hi: 0xbf},
-	// Block 0x7e, offset 0x327
-	{value: 0x0117, lo: 0x80, hi: 0xaf},
-	{value: 0x0015, lo: 0xb0, hi: 0xb0},
-	{value: 0x0012, lo: 0xb1, hi: 0xb8},
-	{value: 0x0316, lo: 0xb9, hi: 0xba},
-	{value: 0x0716, lo: 0xbb, hi: 0xbc},
-	{value: 0x8453, lo: 0xbd, hi: 0xbd},
-	{value: 0x0117, lo: 0xbe, hi: 0xbf},
-	// Block 0x7f, offset 0x32e
-	{value: 0x0010, lo: 0xb7, hi: 0xb7},
-	{value: 0x0015, lo: 0xb8, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbf},
-	// Block 0x80, offset 0x332
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0014, lo: 0x82, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8b},
-	{value: 0x0010, lo: 0x8c, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa6},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	// Block 0x81, offset 0x33b
-	{value: 0x0010, lo: 0x80, hi: 0xb3},
-	// Block 0x82, offset 0x33c
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0034, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x85, hi: 0x85},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0024, lo: 0xa0, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb7},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x83, offset 0x344
-	{value: 0x0010, lo: 0x80, hi: 0xa5},
-	{value: 0x0014, lo: 0xa6, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x84, offset 0x348
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0014, lo: 0x87, hi: 0x91},
-	{value: 0x0010, lo: 0x92, hi: 0x92},
-	{value: 0x0030, lo: 0x93, hi: 0x93},
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0x85, offset 0x34d
-	{value: 0x0014, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xb9},
-	{value: 0x0010, lo: 0xba, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0x86, offset 0x355
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0004, lo: 0xa6, hi: 0xa6},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x87, offset 0x35b
-	{value: 0x0010, lo: 0x80, hi: 0xa8},
-	{value: 0x0014, lo: 0xa9, hi: 0xae},
-	{value: 0x0010, lo: 0xaf, hi: 0xb0},
-	{value: 0x0014, lo: 0xb1, hi: 0xb2},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0x88, offset 0x361
-	{value: 0x0010, lo: 0x80, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x8b},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0010, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbd},
-	// Block 0x89, offset 0x36b
-	{value: 0x0024, lo: 0xb0, hi: 0xb0},
-	{value: 0x0024, lo: 0xb2, hi: 0xb3},
-	{value: 0x0034, lo: 0xb4, hi: 0xb4},
-	{value: 0x0024, lo: 0xb7, hi: 0xb8},
-	{value: 0x0024, lo: 0xbe, hi: 0xbf},
-	// Block 0x8a, offset 0x370
-	{value: 0x0024, lo: 0x81, hi: 0x81},
-	{value: 0x0004, lo: 0x9d, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xab},
-	{value: 0x0014, lo: 0xac, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb2, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	// Block 0x8b, offset 0x379
-	{value: 0x0010, lo: 0x81, hi: 0x86},
-	{value: 0x0010, lo: 0x89, hi: 0x8e},
-	{value: 0x0010, lo: 0x91, hi: 0x96},
-	{value: 0x0010, lo: 0xa0, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0x8c, offset 0x37f
-	{value: 0x0012, lo: 0x80, hi: 0x92},
-	{value: 0xac52, lo: 0x93, hi: 0x93},
-	{value: 0x0012, lo: 0x94, hi: 0x9a},
-	{value: 0x0004, lo: 0x9b, hi: 0x9b},
-	{value: 0x0015, lo: 0x9c, hi: 0x9f},
-	{value: 0x0012, lo: 0xa0, hi: 0xa5},
-	{value: 0x74d2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8d, offset 0x386
-	{value: 0x78d2, lo: 0x80, hi: 0x8f},
-	{value: 0x7cd2, lo: 0x90, hi: 0x9f},
-	{value: 0x80d2, lo: 0xa0, hi: 0xaf},
-	{value: 0x7cd2, lo: 0xb0, hi: 0xbf},
-	// Block 0x8e, offset 0x38a
-	{value: 0x0010, lo: 0x80, hi: 0xa4},
-	{value: 0x0014, lo: 0xa5, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa7},
-	{value: 0x0014, lo: 0xa8, hi: 0xa8},
-	{value: 0x0010, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0034, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0x8f, offset 0x392
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0x90, offset 0x394
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x8b, hi: 0xbb},
-	// Block 0x91, offset 0x396
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x86, hi: 0xbf},
-	// Block 0x92, offset 0x399
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0004, lo: 0xb2, hi: 0xbf},
-	// Block 0x93, offset 0x39b
-	{value: 0x0004, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x93, hi: 0xbf},
-	// Block 0x94, offset 0x39d
-	{value: 0x0010, lo: 0x80, hi: 0xbd},
-	// Block 0x95, offset 0x39e
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0x96, offset 0x39f
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0xbf},
-	// Block 0x97, offset 0x3a1
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0xb0, hi: 0xbb},
-	// Block 0x98, offset 0x3a3
-	{value: 0x0014, lo: 0x80, hi: 0x8f},
-	{value: 0x0054, lo: 0x93, hi: 0x93},
-	{value: 0x0024, lo: 0xa0, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xad},
-	{value: 0x0024, lo: 0xae, hi: 0xaf},
-	{value: 0x0010, lo: 0xb3, hi: 0xb4},
-	// Block 0x99, offset 0x3a9
-	{value: 0x0010, lo: 0x8d, hi: 0x8f},
-	{value: 0x0054, lo: 0x92, hi: 0x92},
-	{value: 0x0054, lo: 0x95, hi: 0x95},
-	{value: 0x0010, lo: 0xb0, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0x9a, offset 0x3ae
-	{value: 0x0010, lo: 0x80, hi: 0xbc},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0x9b, offset 0x3b0
-	{value: 0x0054, lo: 0x87, hi: 0x87},
-	{value: 0x0054, lo: 0x8e, hi: 0x8e},
-	{value: 0x0054, lo: 0x9a, hi: 0x9a},
-	{value: 0x5f53, lo: 0xa1, hi: 0xba},
-	{value: 0x0004, lo: 0xbe, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0x9c, offset 0x3b6
-	{value: 0x0004, lo: 0x80, hi: 0x80},
-	{value: 0x5f52, lo: 0x81, hi: 0x9a},
-	{value: 0x0004, lo: 0xb0, hi: 0xb0},
-	// Block 0x9d, offset 0x3b9
-	{value: 0x0014, lo: 0x9e, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xbe},
-	// Block 0x9e, offset 0x3bb
-	{value: 0x0010, lo: 0x82, hi: 0x87},
-	{value: 0x0010, lo: 0x8a, hi: 0x8f},
-	{value: 0x0010, lo: 0x92, hi: 0x97},
-	{value: 0x0010, lo: 0x9a, hi: 0x9c},
-	{value: 0x0004, lo: 0xa3, hi: 0xa3},
-	{value: 0x0014, lo: 0xb9, hi: 0xbb},
-	// Block 0x9f, offset 0x3c1
-	{value: 0x0010, lo: 0x80, hi: 0x8b},
-	{value: 0x0010, lo: 0x8d, hi: 0xa6},
-	{value: 0x0010, lo: 0xa8, hi: 0xba},
-	{value: 0x0010, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xa0, offset 0x3c6
-	{value: 0x0010, lo: 0x80, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x9d},
-	// Block 0xa1, offset 0x3c8
-	{value: 0x0010, lo: 0x80, hi: 0xba},
-	// Block 0xa2, offset 0x3c9
-	{value: 0x0010, lo: 0x80, hi: 0xb4},
-	// Block 0xa3, offset 0x3ca
-	{value: 0x0034, lo: 0xbd, hi: 0xbd},
-	// Block 0xa4, offset 0x3cb
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa5, offset 0x3cd
-	{value: 0x0010, lo: 0x80, hi: 0x90},
-	{value: 0x0034, lo: 0xa0, hi: 0xa0},
-	// Block 0xa6, offset 0x3cf
-	{value: 0x0010, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xa7, offset 0x3d1
-	{value: 0x0010, lo: 0x80, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0xb5},
-	{value: 0x0024, lo: 0xb6, hi: 0xba},
-	// Block 0xa8, offset 0x3d4
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xbf},
-	// Block 0xa9, offset 0x3d6
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x91, hi: 0x95},
-	// Block 0xaa, offset 0x3d9
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x97},
-	{value: 0xaf53, lo: 0x98, hi: 0x9f},
-	{value: 0xb253, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbf},
-	// Block 0xab, offset 0x3e1
-	{value: 0xaf52, lo: 0x80, hi: 0x87},
-	{value: 0xb252, lo: 0x88, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0xbf},
-	// Block 0xac, offset 0x3e4
-	{value: 0x0010, lo: 0x80, hi: 0x9d},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0xb253, lo: 0xb0, hi: 0xb7},
-	{value: 0xaf53, lo: 0xb8, hi: 0xbf},
-	// Block 0xad, offset 0x3e8
-	{value: 0x2813, lo: 0x80, hi: 0x87},
-	{value: 0x3813, lo: 0x88, hi: 0x8f},
-	{value: 0x2813, lo: 0x90, hi: 0x93},
-	{value: 0xb252, lo: 0x98, hi: 0x9f},
-	{value: 0xaf52, lo: 0xa0, hi: 0xa7},
-	{value: 0x2812, lo: 0xa8, hi: 0xaf},
-	{value: 0x3812, lo: 0xb0, hi: 0xb7},
-	{value: 0x2812, lo: 0xb8, hi: 0xbb},
-	// Block 0xae, offset 0x3f0
-	{value: 0x0010, lo: 0x80, hi: 0xa7},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xaf, offset 0x3f2
-	{value: 0x0010, lo: 0x80, hi: 0xa3},
-	// Block 0xb0, offset 0x3f3
-	{value: 0x0010, lo: 0x80, hi: 0xb6},
-	// Block 0xb1, offset 0x3f4
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xa7},
-	// Block 0xb2, offset 0x3f6
-	{value: 0x0010, lo: 0x80, hi: 0x85},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xb5},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0010, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xb3, offset 0x3fc
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb6},
-	// Block 0xb4, offset 0x3fe
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	// Block 0xb5, offset 0x3ff
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb5},
-	// Block 0xb6, offset 0x401
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb9},
-	// Block 0xb7, offset 0x403
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0010, lo: 0xbe, hi: 0xbf},
-	// Block 0xb8, offset 0x405
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x83},
-	{value: 0x0014, lo: 0x85, hi: 0x86},
-	{value: 0x0014, lo: 0x8c, hi: 0x8c},
-	{value: 0x0034, lo: 0x8d, hi: 0x8d},
-	{value: 0x0014, lo: 0x8e, hi: 0x8e},
-	{value: 0x0024, lo: 0x8f, hi: 0x8f},
-	{value: 0x0010, lo: 0x90, hi: 0x93},
-	{value: 0x0010, lo: 0x95, hi: 0x97},
-	{value: 0x0010, lo: 0x99, hi: 0xb3},
-	{value: 0x0024, lo: 0xb8, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xb9, offset 0x412
-	{value: 0x0010, lo: 0xa0, hi: 0xbc},
-	// Block 0xba, offset 0x413
-	{value: 0x0010, lo: 0x80, hi: 0x9c},
-	// Block 0xbb, offset 0x414
-	{value: 0x0010, lo: 0x80, hi: 0x87},
-	{value: 0x0010, lo: 0x89, hi: 0xa4},
-	{value: 0x0024, lo: 0xa5, hi: 0xa5},
-	{value: 0x0034, lo: 0xa6, hi: 0xa6},
-	// Block 0xbc, offset 0x418
-	{value: 0x0010, lo: 0x80, hi: 0x95},
-	{value: 0x0010, lo: 0xa0, hi: 0xb2},
-	// Block 0xbd, offset 0x41a
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	// Block 0xbe, offset 0x41b
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	// Block 0xbf, offset 0x41c
-	{value: 0x5653, lo: 0x80, hi: 0xb2},
-	// Block 0xc0, offset 0x41d
-	{value: 0x5652, lo: 0x80, hi: 0xb2},
-	// Block 0xc1, offset 0x41e
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xc2, offset 0x422
-	{value: 0x0014, lo: 0x80, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0xa6, hi: 0xaf},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xc3, offset 0x426
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb6},
-	{value: 0x0010, lo: 0xb7, hi: 0xb8},
-	{value: 0x0034, lo: 0xb9, hi: 0xba},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	// Block 0xc4, offset 0x42c
-	{value: 0x0010, lo: 0x90, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xc5, offset 0x42e
-	{value: 0x0024, lo: 0x80, hi: 0x82},
-	{value: 0x0010, lo: 0x83, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb4},
-	{value: 0x0010, lo: 0xb6, hi: 0xbf},
-	// Block 0xc6, offset 0x435
-	{value: 0x0010, lo: 0x90, hi: 0xb2},
-	{value: 0x0034, lo: 0xb3, hi: 0xb3},
-	{value: 0x0010, lo: 0xb6, hi: 0xb6},
-	// Block 0xc7, offset 0x438
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0xb5},
-	{value: 0x0014, lo: 0xb6, hi: 0xbe},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xc8, offset 0x43c
-	{value: 0x0030, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0014, lo: 0x8b, hi: 0x8c},
-	{value: 0x0010, lo: 0x90, hi: 0x9a},
-	{value: 0x0010, lo: 0x9c, hi: 0x9c},
-	// Block 0xc9, offset 0x442
-	{value: 0x0010, lo: 0x80, hi: 0x91},
-	{value: 0x0010, lo: 0x93, hi: 0xae},
-	{value: 0x0014, lo: 0xaf, hi: 0xb1},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0014, lo: 0xb4, hi: 0xb4},
-	{value: 0x0030, lo: 0xb5, hi: 0xb5},
-	{value: 0x0034, lo: 0xb6, hi: 0xb6},
-	{value: 0x0014, lo: 0xb7, hi: 0xb7},
-	{value: 0x0014, lo: 0xbe, hi: 0xbe},
-	// Block 0xca, offset 0x44b
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	{value: 0x0010, lo: 0x88, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0x8d},
-	{value: 0x0010, lo: 0x8f, hi: 0x9d},
-	{value: 0x0010, lo: 0x9f, hi: 0xa8},
-	{value: 0x0010, lo: 0xb0, hi: 0xbf},
-	// Block 0xcb, offset 0x451
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0014, lo: 0x9f, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa2},
-	{value: 0x0014, lo: 0xa3, hi: 0xa8},
-	{value: 0x0034, lo: 0xa9, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xcc, offset 0x457
-	{value: 0x0014, lo: 0x80, hi: 0x81},
-	{value: 0x0010, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x8c},
-	{value: 0x0010, lo: 0x8f, hi: 0x90},
-	{value: 0x0010, lo: 0x93, hi: 0xa8},
-	{value: 0x0010, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb5, hi: 0xb9},
-	{value: 0x0034, lo: 0xbc, hi: 0xbc},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xcd, offset 0x461
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x84},
-	{value: 0x0010, lo: 0x87, hi: 0x88},
-	{value: 0x0010, lo: 0x8b, hi: 0x8c},
-	{value: 0x0030, lo: 0x8d, hi: 0x8d},
-	{value: 0x0010, lo: 0x90, hi: 0x90},
-	{value: 0x0010, lo: 0x97, hi: 0x97},
-	{value: 0x0010, lo: 0x9d, hi: 0xa3},
-	{value: 0x0024, lo: 0xa6, hi: 0xac},
-	{value: 0x0024, lo: 0xb0, hi: 0xb4},
-	// Block 0xce, offset 0x46b
-	{value: 0x0010, lo: 0x80, hi: 0xb7},
-	{value: 0x0014, lo: 0xb8, hi: 0xbf},
-	// Block 0xcf, offset 0x46d
-	{value: 0x0010, lo: 0x80, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x82},
-	{value: 0x0014, lo: 0x83, hi: 0x84},
-	{value: 0x0010, lo: 0x85, hi: 0x85},
-	{value: 0x0034, lo: 0x86, hi: 0x86},
-	{value: 0x0010, lo: 0x87, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd0, offset 0x474
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xb8},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0014, lo: 0xba, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbe},
-	{value: 0x0014, lo: 0xbf, hi: 0xbf},
-	// Block 0xd1, offset 0x47a
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x81, hi: 0x81},
-	{value: 0x0034, lo: 0x82, hi: 0x83},
-	{value: 0x0010, lo: 0x84, hi: 0x85},
-	{value: 0x0010, lo: 0x87, hi: 0x87},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd2, offset 0x480
-	{value: 0x0010, lo: 0x80, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb5},
-	{value: 0x0010, lo: 0xb8, hi: 0xbb},
-	{value: 0x0014, lo: 0xbc, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd3, offset 0x486
-	{value: 0x0034, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x98, hi: 0x9b},
-	{value: 0x0014, lo: 0x9c, hi: 0x9d},
-	// Block 0xd4, offset 0x489
-	{value: 0x0010, lo: 0x80, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0010, lo: 0xbb, hi: 0xbc},
-	{value: 0x0014, lo: 0xbd, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xd5, offset 0x48f
-	{value: 0x0014, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x84, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0xd6, offset 0x492
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0014, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xac, hi: 0xac},
-	{value: 0x0014, lo: 0xad, hi: 0xad},
-	{value: 0x0010, lo: 0xae, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb5},
-	{value: 0x0030, lo: 0xb6, hi: 0xb6},
-	{value: 0x0034, lo: 0xb7, hi: 0xb7},
-	// Block 0xd7, offset 0x49a
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	// Block 0xd8, offset 0x49b
-	{value: 0x0014, lo: 0x9d, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa1},
-	{value: 0x0014, lo: 0xa2, hi: 0xa5},
-	{value: 0x0010, lo: 0xa6, hi: 0xa6},
-	{value: 0x0014, lo: 0xa7, hi: 0xaa},
-	{value: 0x0034, lo: 0xab, hi: 0xab},
-	{value: 0x0010, lo: 0xb0, hi: 0xb9},
-	// Block 0xd9, offset 0x4a2
-	{value: 0x5f53, lo: 0xa0, hi: 0xbf},
-	// Block 0xda, offset 0x4a3
-	{value: 0x5f52, lo: 0x80, hi: 0x9f},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	{value: 0x0010, lo: 0xbf, hi: 0xbf},
-	// Block 0xdb, offset 0x4a6
-	{value: 0x0010, lo: 0x80, hi: 0xb8},
-	// Block 0xdc, offset 0x4a7
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x8a, hi: 0xaf},
-	{value: 0x0014, lo: 0xb0, hi: 0xb6},
-	{value: 0x0014, lo: 0xb8, hi: 0xbd},
-	{value: 0x0010, lo: 0xbe, hi: 0xbe},
-	{value: 0x0034, lo: 0xbf, hi: 0xbf},
-	// Block 0xdd, offset 0x4ad
-	{value: 0x0010, lo: 0x80, hi: 0x80},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xb2, hi: 0xbf},
-	// Block 0xde, offset 0x4b0
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	{value: 0x0014, lo: 0x92, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xa9},
-	{value: 0x0014, lo: 0xaa, hi: 0xb0},
-	{value: 0x0010, lo: 0xb1, hi: 0xb1},
-	{value: 0x0014, lo: 0xb2, hi: 0xb3},
-	{value: 0x0010, lo: 0xb4, hi: 0xb4},
-	{value: 0x0014, lo: 0xb5, hi: 0xb6},
-	// Block 0xdf, offset 0x4b8
-	{value: 0x0010, lo: 0x80, hi: 0x99},
-	// Block 0xe0, offset 0x4b9
-	{value: 0x0010, lo: 0x80, hi: 0xae},
-	// Block 0xe1, offset 0x4ba
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	// Block 0xe2, offset 0x4bb
-	{value: 0x0010, lo: 0x80, hi: 0x86},
-	// Block 0xe3, offset 0x4bc
-	{value: 0x0010, lo: 0x80, hi: 0x9e},
-	{value: 0x0010, lo: 0xa0, hi: 0xa9},
-	// Block 0xe4, offset 0x4be
-	{value: 0x0010, lo: 0x90, hi: 0xad},
-	{value: 0x0034, lo: 0xb0, hi: 0xb4},
-	// Block 0xe5, offset 0x4c0
-	{value: 0x0010, lo: 0x80, hi: 0xaf},
-	{value: 0x0024, lo: 0xb0, hi: 0xb6},
-	// Block 0xe6, offset 0x4c2
-	{value: 0x0014, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0010, lo: 0xa3, hi: 0xb7},
-	{value: 0x0010, lo: 0xbd, hi: 0xbf},
-	// Block 0xe7, offset 0x4c6
-	{value: 0x0010, lo: 0x80, hi: 0x8f},
-	// Block 0xe8, offset 0x4c7
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0010, lo: 0x90, hi: 0xbe},
-	// Block 0xe9, offset 0x4c9
-	{value: 0x0014, lo: 0x8f, hi: 0x9f},
-	// Block 0xea, offset 0x4ca
-	{value: 0x0014, lo: 0xa0, hi: 0xa0},
-	// Block 0xeb, offset 0x4cb
-	{value: 0x0010, lo: 0x80, hi: 0xaa},
-	{value: 0x0010, lo: 0xb0, hi: 0xbc},
-	// Block 0xec, offset 0x4cd
-	{value: 0x0010, lo: 0x80, hi: 0x88},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	{value: 0x0014, lo: 0x9d, hi: 0x9d},
-	{value: 0x0034, lo: 0x9e, hi: 0x9e},
-	{value: 0x0014, lo: 0xa0, hi: 0xa3},
-	// Block 0xed, offset 0x4d2
-	{value: 0x0030, lo: 0xa5, hi: 0xa6},
-	{value: 0x0034, lo: 0xa7, hi: 0xa9},
-	{value: 0x0030, lo: 0xad, hi: 0xb2},
-	{value: 0x0014, lo: 0xb3, hi: 0xba},
-	{value: 0x0034, lo: 0xbb, hi: 0xbf},
-	// Block 0xee, offset 0x4d7
-	{value: 0x0034, lo: 0x80, hi: 0x82},
-	{value: 0x0024, lo: 0x85, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8b},
-	{value: 0x0024, lo: 0xaa, hi: 0xad},
-	// Block 0xef, offset 0x4db
-	{value: 0x0024, lo: 0x82, hi: 0x84},
-	// Block 0xf0, offset 0x4dc
-	{value: 0x0013, lo: 0x80, hi: 0x99},
-	{value: 0x0012, lo: 0x9a, hi: 0xb3},
-	{value: 0x0013, lo: 0xb4, hi: 0xbf},
-	// Block 0xf1, offset 0x4df
-	{value: 0x0013, lo: 0x80, hi: 0x8d},
-	{value: 0x0012, lo: 0x8e, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0xa7},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0xf2, offset 0x4e3
-	{value: 0x0013, lo: 0x80, hi: 0x81},
-	{value: 0x0012, lo: 0x82, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0x9c},
-	{value: 0x0013, lo: 0x9e, hi: 0x9f},
-	{value: 0x0013, lo: 0xa2, hi: 0xa2},
-	{value: 0x0013, lo: 0xa5, hi: 0xa6},
-	{value: 0x0013, lo: 0xa9, hi: 0xac},
-	{value: 0x0013, lo: 0xae, hi: 0xb5},
-	{value: 0x0012, lo: 0xb6, hi: 0xb9},
-	{value: 0x0012, lo: 0xbb, hi: 0xbb},
-	{value: 0x0012, lo: 0xbd, hi: 0xbf},
-	// Block 0xf3, offset 0x4ee
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0012, lo: 0x85, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0xf4, offset 0x4f2
-	{value: 0x0012, lo: 0x80, hi: 0x83},
-	{value: 0x0013, lo: 0x84, hi: 0x85},
-	{value: 0x0013, lo: 0x87, hi: 0x8a},
-	{value: 0x0013, lo: 0x8d, hi: 0x94},
-	{value: 0x0013, lo: 0x96, hi: 0x9c},
-	{value: 0x0012, lo: 0x9e, hi: 0xb7},
-	{value: 0x0013, lo: 0xb8, hi: 0xb9},
-	{value: 0x0013, lo: 0xbb, hi: 0xbe},
-	// Block 0xf5, offset 0x4fa
-	{value: 0x0013, lo: 0x80, hi: 0x84},
-	{value: 0x0013, lo: 0x86, hi: 0x86},
-	{value: 0x0013, lo: 0x8a, hi: 0x90},
-	{value: 0x0012, lo: 0x92, hi: 0xab},
-	{value: 0x0013, lo: 0xac, hi: 0xbf},
-	// Block 0xf6, offset 0x4ff
-	{value: 0x0013, lo: 0x80, hi: 0x85},
-	{value: 0x0012, lo: 0x86, hi: 0x9f},
-	{value: 0x0013, lo: 0xa0, hi: 0xb9},
-	{value: 0x0012, lo: 0xba, hi: 0xbf},
-	// Block 0xf7, offset 0x503
-	{value: 0x0012, lo: 0x80, hi: 0x93},
-	{value: 0x0013, lo: 0x94, hi: 0xad},
-	{value: 0x0012, lo: 0xae, hi: 0xbf},
-	// Block 0xf8, offset 0x506
-	{value: 0x0012, lo: 0x80, hi: 0x87},
-	{value: 0x0013, lo: 0x88, hi: 0xa1},
-	{value: 0x0012, lo: 0xa2, hi: 0xbb},
-	{value: 0x0013, lo: 0xbc, hi: 0xbf},
-	// Block 0xf9, offset 0x50a
-	{value: 0x0013, lo: 0x80, hi: 0x95},
-	{value: 0x0012, lo: 0x96, hi: 0xaf},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0xfa, offset 0x50d
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0012, lo: 0x8a, hi: 0xa5},
-	{value: 0x0013, lo: 0xa8, hi: 0xbf},
-	// Block 0xfb, offset 0x510
-	{value: 0x0013, lo: 0x80, hi: 0x80},
-	{value: 0x0012, lo: 0x82, hi: 0x9a},
-	{value: 0x0012, lo: 0x9c, hi: 0xa1},
-	{value: 0x0013, lo: 0xa2, hi: 0xba},
-	{value: 0x0012, lo: 0xbc, hi: 0xbf},
-	// Block 0xfc, offset 0x515
-	{value: 0x0012, lo: 0x80, hi: 0x94},
-	{value: 0x0012, lo: 0x96, hi: 0x9b},
-	{value: 0x0013, lo: 0x9c, hi: 0xb4},
-	{value: 0x0012, lo: 0xb6, hi: 0xbf},
-	// Block 0xfd, offset 0x519
-	{value: 0x0012, lo: 0x80, hi: 0x8e},
-	{value: 0x0012, lo: 0x90, hi: 0x95},
-	{value: 0x0013, lo: 0x96, hi: 0xae},
-	{value: 0x0012, lo: 0xb0, hi: 0xbf},
-	// Block 0xfe, offset 0x51d
-	{value: 0x0012, lo: 0x80, hi: 0x88},
-	{value: 0x0012, lo: 0x8a, hi: 0x8f},
-	{value: 0x0013, lo: 0x90, hi: 0xa8},
-	{value: 0x0012, lo: 0xaa, hi: 0xbf},
-	// Block 0xff, offset 0x521
-	{value: 0x0012, lo: 0x80, hi: 0x82},
-	{value: 0x0012, lo: 0x84, hi: 0x89},
-	{value: 0x0017, lo: 0x8a, hi: 0x8b},
-	{value: 0x0010, lo: 0x8e, hi: 0xbf},
-	// Block 0x100, offset 0x525
-	{value: 0x0014, lo: 0x80, hi: 0xb6},
-	{value: 0x0014, lo: 0xbb, hi: 0xbf},
-	// Block 0x101, offset 0x527
-	{value: 0x0014, lo: 0x80, hi: 0xac},
-	{value: 0x0014, lo: 0xb5, hi: 0xb5},
-	// Block 0x102, offset 0x529
-	{value: 0x0014, lo: 0x84, hi: 0x84},
-	{value: 0x0014, lo: 0x9b, hi: 0x9f},
-	{value: 0x0014, lo: 0xa1, hi: 0xaf},
-	// Block 0x103, offset 0x52c
-	{value: 0x0024, lo: 0x80, hi: 0x86},
-	{value: 0x0024, lo: 0x88, hi: 0x98},
-	{value: 0x0024, lo: 0x9b, hi: 0xa1},
-	{value: 0x0024, lo: 0xa3, hi: 0xa4},
-	{value: 0x0024, lo: 0xa6, hi: 0xaa},
-	// Block 0x104, offset 0x531
-	{value: 0x0010, lo: 0x80, hi: 0x84},
-	{value: 0x0034, lo: 0x90, hi: 0x96},
-	// Block 0x105, offset 0x533
-	{value: 0xb552, lo: 0x80, hi: 0x81},
-	{value: 0xb852, lo: 0x82, hi: 0x83},
-	{value: 0x0024, lo: 0x84, hi: 0x89},
-	{value: 0x0034, lo: 0x8a, hi: 0x8a},
-	{value: 0x0010, lo: 0x90, hi: 0x99},
-	// Block 0x106, offset 0x538
-	{value: 0x0010, lo: 0x80, hi: 0x83},
-	{value: 0x0010, lo: 0x85, hi: 0x9f},
-	{value: 0x0010, lo: 0xa1, hi: 0xa2},
-	{value: 0x0010, lo: 0xa4, hi: 0xa4},
-	{value: 0x0010, lo: 0xa7, hi: 0xa7},
-	{value: 0x0010, lo: 0xa9, hi: 0xb2},
-	{value: 0x0010, lo: 0xb4, hi: 0xb7},
-	{value: 0x0010, lo: 0xb9, hi: 0xb9},
-	{value: 0x0010, lo: 0xbb, hi: 0xbb},
-	// Block 0x107, offset 0x541
-	{value: 0x0010, lo: 0x80, hi: 0x89},
-	{value: 0x0010, lo: 0x8b, hi: 0x9b},
-	{value: 0x0010, lo: 0xa1, hi: 0xa3},
-	{value: 0x0010, lo: 0xa5, hi: 0xa9},
-	{value: 0x0010, lo: 0xab, hi: 0xbb},
-	// Block 0x108, offset 0x546
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x109, offset 0x547
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	{value: 0x0013, lo: 0x90, hi: 0xa9},
-	{value: 0x0013, lo: 0xb0, hi: 0xbf},
-	// Block 0x10a, offset 0x54a
-	{value: 0x0013, lo: 0x80, hi: 0x89},
-	// Block 0x10b, offset 0x54b
-	{value: 0x0004, lo: 0xbb, hi: 0xbf},
-	// Block 0x10c, offset 0x54c
-	{value: 0x0014, lo: 0x81, hi: 0x81},
-	{value: 0x0014, lo: 0xa0, hi: 0xbf},
-	// Block 0x10d, offset 0x54e
-	{value: 0x0014, lo: 0x80, hi: 0xbf},
-	// Block 0x10e, offset 0x54f
-	{value: 0x0014, lo: 0x80, hi: 0xaf},
-}
-
-// Total table size 14027 bytes (13KiB); checksum: F17D40E8
diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go
deleted file mode 100644
index 99e0396288..0000000000
--- a/vendor/golang.org/x/text/cases/trieval.go
+++ /dev/null
@@ -1,214 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package cases
-
-// This file contains definitions for interpreting the trie value of the case
-// trie generated by "go run gen*.go". It is shared by both the generator
-// program and the resultant package. Sharing is achieved by the generator
-// copying gen_trieval.go to trieval.go and changing what's above this comment.
-
-// info holds case information for a single rune. It is the value returned
-// by a trie lookup. Most mapping information can be stored in a single 16-bit
-// value. If not, for example when a rune is mapped to multiple runes, the value
-// stores some basic case data and an index into an array with additional data.
-//
-// The per-rune values have the following format:
-//
-//   if (exception) {
-//     15..4  unsigned exception index
-//   } else {
-//     15..8  XOR pattern or index to XOR pattern for case mapping
-//            Only 13..8 are used for XOR patterns.
-//         7  inverseFold (fold to upper, not to lower)
-//         6  index: interpret the XOR pattern as an index
-//            or isMid if case mode is cIgnorableUncased.
-//      5..4  CCC: zero (normal or break), above or other
-//   }
-//      3  exception: interpret this value as an exception index
-//         (TODO: is this bit necessary? Probably implied from case mode.)
-//   2..0  case mode
-//
-// For the non-exceptional cases, a rune must be either uncased, lowercase or
-// uppercase. If the rune is cased, the XOR pattern maps either a lowercase
-// rune to uppercase or an uppercase rune to lowercase (applied to the 10
-// least-significant bits of the rune).
-//
-// See the definitions below for a more detailed description of the various
-// bits.
-type info uint16
-
-const (
-	casedMask      = 0x0003
-	fullCasedMask  = 0x0007
-	ignorableMask  = 0x0006
-	ignorableValue = 0x0004
-
-	inverseFoldBit = 1 << 7
-	isMidBit       = 1 << 6
-
-	exceptionBit     = 1 << 3
-	exceptionShift   = 4
-	numExceptionBits = 12
-
-	xorIndexBit = 1 << 6
-	xorShift    = 8
-
-	// There is no mapping if all xor bits and the exception bit are zero.
-	hasMappingMask = 0xff80 | exceptionBit
-)
-
-// The case mode bits encodes the case type of a rune. This includes uncased,
-// title, upper and lower case and case ignorable. (For a definition of these
-// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare
-// cases, a rune can be both cased and case-ignorable. This is encoded by
-// cIgnorableCased. A rune of this type is always lower case. Some runes are
-// cased while not having a mapping.
-//
-// A common pattern for scripts in the Unicode standard is for upper and lower
-// case runes to alternate for increasing rune values (e.g. the accented Latin
-// ranges starting from U+0100 and U+1E00 among others and some Cyrillic
-// characters). We use this property by defining a cXORCase mode, where the case
-// mode (always upper or lower case) is derived from the rune value. As the XOR
-// pattern for case mappings is often identical for successive runes, using
-// cXORCase can result in large series of identical trie values. This, in turn,
-// allows us to better compress the trie blocks.
-const (
-	cUncased          info = iota // 000
-	cTitle                        // 001
-	cLower                        // 010
-	cUpper                        // 011
-	cIgnorableUncased             // 100
-	cIgnorableCased               // 101 // lower case if mappings exist
-	cXORCase                      // 11x // case is cLower | ((rune&1) ^ x)
-
-	maxCaseMode = cUpper
-)
-
-func (c info) isCased() bool {
-	return c&casedMask != 0
-}
-
-func (c info) isCaseIgnorable() bool {
-	return c&ignorableMask == ignorableValue
-}
-
-func (c info) isNotCasedAndNotCaseIgnorable() bool {
-	return c&fullCasedMask == 0
-}
-
-func (c info) isCaseIgnorableAndNotCased() bool {
-	return c&fullCasedMask == cIgnorableUncased
-}
-
-func (c info) isMid() bool {
-	return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased
-}
-
-// The case mapping implementation will need to know about various Canonical
-// Combining Class (CCC) values. We encode two of these in the trie value:
-// cccZero (0) and cccAbove (230). If the value is cccOther, it means that
-// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that
-// the rune also has the break category Break (see below).
-const (
-	cccBreak info = iota << 4
-	cccZero
-	cccAbove
-	cccOther
-
-	cccMask = cccBreak | cccZero | cccAbove | cccOther
-)
-
-const (
-	starter       = 0
-	above         = 230
-	iotaSubscript = 240
-)
-
-// The exceptions slice holds data that does not fit in a normal info entry.
-// The entry is pointed to by the exception index in an entry. It has the
-// following format:
-//
-// Header
-// byte 0:
-//  7..6  unused
-//  5..4  CCC type (same bits as entry)
-//     3  unused
-//  2..0  length of fold
-//
-// byte 1:
-//   7..6  unused
-//   5..3  length of 1st mapping of case type
-//   2..0  length of 2nd mapping of case type
-//
-//   case     1st    2nd
-//   lower -> upper, title
-//   upper -> lower, title
-//   title -> lower, upper
-//
-// Lengths with the value 0x7 indicate no value and implies no change.
-// A length of 0 indicates a mapping to zero-length string.
-//
-// Body bytes:
-//   case folding bytes
-//   lowercase mapping bytes
-//   uppercase mapping bytes
-//   titlecase mapping bytes
-//   closure mapping bytes (for NFKC_Casefold). (TODO)
-//
-// Fallbacks:
-//   missing fold  -> lower
-//   missing title -> upper
-//   all missing   -> original rune
-//
-// exceptions starts with a dummy byte to enforce that there is no zero index
-// value.
-const (
-	lengthMask = 0x07
-	lengthBits = 3
-	noChange   = 0
-)
-
-// References to generated trie.
-
-var trie = newCaseTrie(0)
-
-var sparse = sparseBlocks{
-	values:  sparseValues[:],
-	offsets: sparseOffsets[:],
-}
-
-// Sparse block lookup code.
-
-// valueRange is an entry in a sparse block.
-type valueRange struct {
-	value  uint16
-	lo, hi byte
-}
-
-type sparseBlocks struct {
-	values  []valueRange
-	offsets []uint16
-}
-
-// lookup returns the value from values block n for byte b using binary search.
-func (s *sparseBlocks) lookup(n uint32, b byte) uint16 {
-	lo := s.offsets[n]
-	hi := s.offsets[n+1]
-	for lo < hi {
-		m := lo + (hi-lo)/2
-		r := s.values[m]
-		if r.lo <= b && b <= r.hi {
-			return r.value
-		}
-		if b < r.lo {
-			hi = m
-		} else {
-			lo = m + 1
-		}
-	}
-	return 0
-}
-
-// lastRuneForTesting is the last rune used for testing. Everything after this
-// is boring.
-const lastRuneForTesting = rune(0x1FFFF)
diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go
deleted file mode 100644
index 3cddbbdda8..0000000000
--- a/vendor/golang.org/x/text/internal/internal.go
+++ /dev/null
@@ -1,49 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package internal contains non-exported functionality that are used by
-// packages in the text repository.
-package internal // import "golang.org/x/text/internal"
-
-import (
-	"sort"
-
-	"golang.org/x/text/language"
-)
-
-// SortTags sorts tags in place.
-func SortTags(tags []language.Tag) {
-	sort.Sort(sorter(tags))
-}
-
-type sorter []language.Tag
-
-func (s sorter) Len() int {
-	return len(s)
-}
-
-func (s sorter) Swap(i, j int) {
-	s[i], s[j] = s[j], s[i]
-}
-
-func (s sorter) Less(i, j int) bool {
-	return s[i].String() < s[j].String()
-}
-
-// UniqueTags sorts and filters duplicate tags in place and returns a slice with
-// only unique tags.
-func UniqueTags(tags []language.Tag) []language.Tag {
-	if len(tags) <= 1 {
-		return tags
-	}
-	SortTags(tags)
-	k := 0
-	for i := 1; i < len(tags); i++ {
-		if tags[k].String() < tags[i].String() {
-			k++
-			tags[k] = tags[i]
-		}
-	}
-	return tags[:k+1]
-}
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
deleted file mode 100644
index cdfdb74971..0000000000
--- a/vendor/golang.org/x/text/internal/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// AliasType is the type of an alias in AliasMap.
-type AliasType int8
-
-const (
-	Deprecated AliasType = iota
-	Macro
-	Legacy
-
-	AliasTypeUnknown AliasType = -1
-)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
deleted file mode 100644
index 46a0015074..0000000000
--- a/vendor/golang.org/x/text/internal/language/compact.go
+++ /dev/null
@@ -1,29 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-// CompactCoreInfo is a compact integer with the three core tags encoded.
-type CompactCoreInfo uint32
-
-// GetCompactCore generates a uint32 value that is guaranteed to be unique for
-// different language, region, and script values.
-func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
-	if t.LangID > langNoIndexOffset {
-		return 0, false
-	}
-	cci |= CompactCoreInfo(t.LangID) << (8 + 12)
-	cci |= CompactCoreInfo(t.ScriptID) << 12
-	cci |= CompactCoreInfo(t.RegionID)
-	return cci, true
-}
-
-// Tag generates a tag from c.
-func (c CompactCoreInfo) Tag() Tag {
-	return Tag{
-		LangID:   Language(c >> 20),
-		RegionID: Region(c & 0x3ff),
-		ScriptID: Script(c>>12) & 0xff,
-	}
-}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
deleted file mode 100644
index 1b36935ef7..0000000000
--- a/vendor/golang.org/x/text/internal/language/compact/compact.go
+++ /dev/null
@@ -1,61 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package compact defines a compact representation of language tags.
-//
-// Common language tags (at least all for which locale information is defined
-// in CLDR) are assigned a unique index. Each Tag is associated with such an
-// ID for selecting language-related resources (such as translations) as well
-// as one for selecting regional defaults (currency, number formatting, etc.)
-//
-// It may want to export this functionality at some point, but at this point
-// this is only available for use within x/text.
-package compact // import "golang.org/x/text/internal/language/compact"
-
-import (
-	"sort"
-	"strings"
-
-	"golang.org/x/text/internal/language"
-)
-
-// ID is an integer identifying a single tag.
-type ID uint16
-
-func getCoreIndex(t language.Tag) (id ID, ok bool) {
-	cci, ok := language.GetCompactCore(t)
-	if !ok {
-		return 0, false
-	}
-	i := sort.Search(len(coreTags), func(i int) bool {
-		return cci <= coreTags[i]
-	})
-	if i == len(coreTags) || coreTags[i] != cci {
-		return 0, false
-	}
-	return ID(i), true
-}
-
-// Parent returns the ID of the parent or the root ID if id is already the root.
-func (id ID) Parent() ID {
-	return parents[id]
-}
-
-// Tag converts id to an internal language Tag.
-func (id ID) Tag() language.Tag {
-	if int(id) >= len(coreTags) {
-		return specialTags[int(id)-len(coreTags)]
-	}
-	return coreTags[id].Tag()
-}
-
-var specialTags []language.Tag
-
-func init() {
-	tags := strings.Split(specialTagsStr, " ")
-	specialTags = make([]language.Tag, len(tags))
-	for i, t := range tags {
-		specialTags[i] = language.MustParse(t)
-	}
-}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
deleted file mode 100644
index 83816a72a8..0000000000
--- a/vendor/golang.org/x/text/internal/language/compact/language.go
+++ /dev/null
@@ -1,260 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:generate go run gen.go gen_index.go -output tables.go
-//go:generate go run gen_parents.go
-
-package compact
-
-// TODO: Remove above NOTE after:
-// - verifying that tables are dropped correctly (most notably matcher tables).
-
-import (
-	"strings"
-
-	"golang.org/x/text/internal/language"
-)
-
-// Tag represents a BCP 47 language tag. It is used to specify an instance of a
-// specific language or locale. All language tag values are guaranteed to be
-// well-formed.
-type Tag struct {
-	// NOTE: exported tags will become part of the public API.
-	language ID
-	locale   ID
-	full     fullTag // always a language.Tag for now.
-}
-
-const _und = 0
-
-type fullTag interface {
-	IsRoot() bool
-	Parent() language.Tag
-}
-
-// Make a compact Tag from a fully specified internal language Tag.
-func Make(t language.Tag) (tag Tag) {
-	if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
-		if r, err := language.ParseRegion(region[:2]); err == nil {
-			tFull := t
-			t, _ = t.SetTypeForKey("rg", "")
-			// TODO: should we not consider "va" for the language tag?
-			var exact1, exact2 bool
-			tag.language, exact1 = FromTag(t)
-			t.RegionID = r
-			tag.locale, exact2 = FromTag(t)
-			if !exact1 || !exact2 {
-				tag.full = tFull
-			}
-			return tag
-		}
-	}
-	lang, ok := FromTag(t)
-	tag.language = lang
-	tag.locale = lang
-	if !ok {
-		tag.full = t
-	}
-	return tag
-}
-
-// Tag returns an internal language Tag version of this tag.
-func (t Tag) Tag() language.Tag {
-	if t.full != nil {
-		return t.full.(language.Tag)
-	}
-	tag := t.language.Tag()
-	if t.language != t.locale {
-		loc := t.locale.Tag()
-		tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
-	}
-	return tag
-}
-
-// IsCompact reports whether this tag is fully defined in terms of ID.
-func (t *Tag) IsCompact() bool {
-	return t.full == nil
-}
-
-// MayHaveVariants reports whether a tag may have variants. If it returns false
-// it is guaranteed the tag does not have variants.
-func (t Tag) MayHaveVariants() bool {
-	return t.full != nil || int(t.language) >= len(coreTags)
-}
-
-// MayHaveExtensions reports whether a tag may have extensions. If it returns
-// false it is guaranteed the tag does not have them.
-func (t Tag) MayHaveExtensions() bool {
-	return t.full != nil ||
-		int(t.language) >= len(coreTags) ||
-		t.language != t.locale
-}
-
-// IsRoot returns true if t is equal to language "und".
-func (t Tag) IsRoot() bool {
-	if t.full != nil {
-		return t.full.IsRoot()
-	}
-	return t.language == _und
-}
-
-// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
-// specific language are substituted with fields from the parent language.
-// The parent for a language may change for newer versions of CLDR.
-func (t Tag) Parent() Tag {
-	if t.full != nil {
-		return Make(t.full.Parent())
-	}
-	if t.language != t.locale {
-		// Simulate stripping -u-rg-xxxxxx
-		return Tag{language: t.language, locale: t.language}
-	}
-	// TODO: use parent lookup table once cycle from internal package is
-	// removed. Probably by internalizing the table and declaring this fast
-	// enough.
-	// lang := compactID(internal.Parent(uint16(t.language)))
-	lang, _ := FromTag(t.language.Tag().Parent())
-	return Tag{language: lang, locale: lang}
-}
-
-// returns token t and the rest of the string.
-func nextToken(s string) (t, tail string) {
-	p := strings.Index(s[1:], "-")
-	if p == -1 {
-		return s[1:], ""
-	}
-	p++
-	return s[1:p], s[p:]
-}
-
-// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository.The index will change over time
-// and should not be stored in persistent storage. If t does not match a compact
-// index, exact will be false and the compact index will be returned for the
-// first match after repeatedly taking the Parent of t.
-func LanguageID(t Tag) (id ID, exact bool) {
-	return t.language, t.full == nil
-}
-
-// RegionalID returns the ID for the regional variant of this tag. This index is
-// used to indicate region-specific overrides, such as default currency, default
-// calendar and week data, default time cycle, and default measurement system
-// and unit preferences.
-//
-// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
-// settings for currency, number formatting, etc. The CompactIndex for this tag
-// will be that for en-GB, while the RegionalID will be the one corresponding to
-// en-US.
-func RegionalID(t Tag) (id ID, exact bool) {
-	return t.locale, t.full == nil
-}
-
-// LanguageTag returns t stripped of regional variant indicators.
-//
-// At the moment this means it is stripped of a regional and variant subtag "rg"
-// and "va" in the "u" extension.
-func (t Tag) LanguageTag() Tag {
-	if t.full == nil {
-		return Tag{language: t.language, locale: t.language}
-	}
-	tt := t.Tag()
-	tt.SetTypeForKey("rg", "")
-	tt.SetTypeForKey("va", "")
-	return Make(tt)
-}
-
-// RegionalTag returns the regional variant of the tag.
-//
-// At the moment this means that the region is set from the regional subtag
-// "rg" in the "u" extension.
-func (t Tag) RegionalTag() Tag {
-	rt := Tag{language: t.locale, locale: t.locale}
-	if t.full == nil {
-		return rt
-	}
-	b := language.Builder{}
-	tag := t.Tag()
-	// tag, _ = tag.SetTypeForKey("rg", "")
-	b.SetTag(t.locale.Tag())
-	if v := tag.Variants(); v != "" {
-		for _, v := range strings.Split(v, "-") {
-			b.AddVariant(v)
-		}
-	}
-	for _, e := range tag.Extensions() {
-		b.AddExt(e)
-	}
-	return t
-}
-
-// FromTag reports closest matching ID for an internal language Tag.
-func FromTag(t language.Tag) (id ID, exact bool) {
-	// TODO: perhaps give more frequent tags a lower index.
-	// TODO: we could make the indexes stable. This will excluded some
-	//       possibilities for optimization, so don't do this quite yet.
-	exact = true
-
-	b, s, r := t.Raw()
-	if t.HasString() {
-		if t.IsPrivateUse() {
-			// We have no entries for user-defined tags.
-			return 0, false
-		}
-		hasExtra := false
-		if t.HasVariants() {
-			if t.HasExtensions() {
-				build := language.Builder{}
-				build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
-				build.AddVariant(t.Variants())
-				exact = false
-				t = build.Make()
-			}
-			hasExtra = true
-		} else if _, ok := t.Extension('u'); ok {
-			// TODO: va may mean something else. Consider not considering it.
-			// Strip all but the 'va' entry.
-			old := t
-			variant := t.TypeForKey("va")
-			t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
-			if variant != "" {
-				t, _ = t.SetTypeForKey("va", variant)
-				hasExtra = true
-			}
-			exact = old == t
-		} else {
-			exact = false
-		}
-		if hasExtra {
-			// We have some variants.
-			for i, s := range specialTags {
-				if s == t {
-					return ID(i + len(coreTags)), exact
-				}
-			}
-			exact = false
-		}
-	}
-	if x, ok := getCoreIndex(t); ok {
-		return x, exact
-	}
-	exact = false
-	if r != 0 && s == 0 {
-		// Deal with cases where an extra script is inserted for the region.
-		t, _ := t.Maximize()
-		if x, ok := getCoreIndex(t); ok {
-			return x, exact
-		}
-	}
-	for t = t.Parent(); t != root; t = t.Parent() {
-		// No variants specified: just compare core components.
-		// The key has the form lllssrrr, where l, s, and r are nibbles for
-		// respectively the langID, scriptID, and regionID.
-		if x, ok := getCoreIndex(t); ok {
-			return x, exact
-		}
-	}
-	return 0, exact
-}
-
-var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
deleted file mode 100644
index 8d810723c7..0000000000
--- a/vendor/golang.org/x/text/internal/language/compact/parents.go
+++ /dev/null
@@ -1,120 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package compact
-
-// parents maps a compact index of a tag to the compact index of the parent of
-// this tag.
-var parents = []ID{ // 775 elements
-	// Entry 0 - 3F
-	0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
-	0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
-	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
-	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
-	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
-	0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
-	0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
-	0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
-	// Entry 40 - 7F
-	0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
-	0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
-	0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
-	0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
-	0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
-	0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
-	0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
-	0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
-	// Entry 80 - BF
-	0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
-	0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
-	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
-	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
-	// Entry C0 - FF
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
-	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
-	0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
-	0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
-	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
-	// Entry 100 - 13F
-	0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
-	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
-	0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
-	0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
-	0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	// Entry 140 - 17F
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
-	0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
-	0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
-	0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
-	0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
-	0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
-	// Entry 180 - 1BF
-	0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
-	0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
-	0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
-	0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
-	0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
-	0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
-	0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
-	0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
-	// Entry 1C0 - 1FF
-	0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
-	0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
-	0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
-	0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
-	0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
-	0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
-	0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
-	0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
-	// Entry 200 - 23F
-	0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
-	0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
-	0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
-	0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
-	0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
-	0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
-	0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
-	// Entry 240 - 27F
-	0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
-	0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
-	0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
-	0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
-	0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
-	0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
-	0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
-	0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
-	// Entry 280 - 2BF
-	0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
-	0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
-	0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
-	0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
-	0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
-	0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
-	0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
-	0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
-	// Entry 2C0 - 2FF
-	0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
-	0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
-	0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
-	0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
-	0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
-	0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
-	0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
-	0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
-	// Entry 300 - 33F
-	0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
-} // Size: 1574 bytes
-
-// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
deleted file mode 100644
index fe7ad9ea7c..0000000000
--- a/vendor/golang.org/x/text/internal/language/compact/tables.go
+++ /dev/null
@@ -1,1015 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package compact
-
-import "golang.org/x/text/internal/language"
-
-// CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "32"
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 775
-const (
-	undIndex          ID = 0
-	afIndex           ID = 1
-	afNAIndex         ID = 2
-	afZAIndex         ID = 3
-	agqIndex          ID = 4
-	agqCMIndex        ID = 5
-	akIndex           ID = 6
-	akGHIndex         ID = 7
-	amIndex           ID = 8
-	amETIndex         ID = 9
-	arIndex           ID = 10
-	ar001Index        ID = 11
-	arAEIndex         ID = 12
-	arBHIndex         ID = 13
-	arDJIndex         ID = 14
-	arDZIndex         ID = 15
-	arEGIndex         ID = 16
-	arEHIndex         ID = 17
-	arERIndex         ID = 18
-	arILIndex         ID = 19
-	arIQIndex         ID = 20
-	arJOIndex         ID = 21
-	arKMIndex         ID = 22
-	arKWIndex         ID = 23
-	arLBIndex         ID = 24
-	arLYIndex         ID = 25
-	arMAIndex         ID = 26
-	arMRIndex         ID = 27
-	arOMIndex         ID = 28
-	arPSIndex         ID = 29
-	arQAIndex         ID = 30
-	arSAIndex         ID = 31
-	arSDIndex         ID = 32
-	arSOIndex         ID = 33
-	arSSIndex         ID = 34
-	arSYIndex         ID = 35
-	arTDIndex         ID = 36
-	arTNIndex         ID = 37
-	arYEIndex         ID = 38
-	arsIndex          ID = 39
-	asIndex           ID = 40
-	asINIndex         ID = 41
-	asaIndex          ID = 42
-	asaTZIndex        ID = 43
-	astIndex          ID = 44
-	astESIndex        ID = 45
-	azIndex           ID = 46
-	azCyrlIndex       ID = 47
-	azCyrlAZIndex     ID = 48
-	azLatnIndex       ID = 49
-	azLatnAZIndex     ID = 50
-	basIndex          ID = 51
-	basCMIndex        ID = 52
-	beIndex           ID = 53
-	beBYIndex         ID = 54
-	bemIndex          ID = 55
-	bemZMIndex        ID = 56
-	bezIndex          ID = 57
-	bezTZIndex        ID = 58
-	bgIndex           ID = 59
-	bgBGIndex         ID = 60
-	bhIndex           ID = 61
-	bmIndex           ID = 62
-	bmMLIndex         ID = 63
-	bnIndex           ID = 64
-	bnBDIndex         ID = 65
-	bnINIndex         ID = 66
-	boIndex           ID = 67
-	boCNIndex         ID = 68
-	boINIndex         ID = 69
-	brIndex           ID = 70
-	brFRIndex         ID = 71
-	brxIndex          ID = 72
-	brxINIndex        ID = 73
-	bsIndex           ID = 74
-	bsCyrlIndex       ID = 75
-	bsCyrlBAIndex     ID = 76
-	bsLatnIndex       ID = 77
-	bsLatnBAIndex     ID = 78
-	caIndex           ID = 79
-	caADIndex         ID = 80
-	caESIndex         ID = 81
-	caFRIndex         ID = 82
-	caITIndex         ID = 83
-	ccpIndex          ID = 84
-	ccpBDIndex        ID = 85
-	ccpINIndex        ID = 86
-	ceIndex           ID = 87
-	ceRUIndex         ID = 88
-	cggIndex          ID = 89
-	cggUGIndex        ID = 90
-	chrIndex          ID = 91
-	chrUSIndex        ID = 92
-	ckbIndex          ID = 93
-	ckbIQIndex        ID = 94
-	ckbIRIndex        ID = 95
-	csIndex           ID = 96
-	csCZIndex         ID = 97
-	cuIndex           ID = 98
-	cuRUIndex         ID = 99
-	cyIndex           ID = 100
-	cyGBIndex         ID = 101
-	daIndex           ID = 102
-	daDKIndex         ID = 103
-	daGLIndex         ID = 104
-	davIndex          ID = 105
-	davKEIndex        ID = 106
-	deIndex           ID = 107
-	deATIndex         ID = 108
-	deBEIndex         ID = 109
-	deCHIndex         ID = 110
-	deDEIndex         ID = 111
-	deITIndex         ID = 112
-	deLIIndex         ID = 113
-	deLUIndex         ID = 114
-	djeIndex          ID = 115
-	djeNEIndex        ID = 116
-	dsbIndex          ID = 117
-	dsbDEIndex        ID = 118
-	duaIndex          ID = 119
-	duaCMIndex        ID = 120
-	dvIndex           ID = 121
-	dyoIndex          ID = 122
-	dyoSNIndex        ID = 123
-	dzIndex           ID = 124
-	dzBTIndex         ID = 125
-	ebuIndex          ID = 126
-	ebuKEIndex        ID = 127
-	eeIndex           ID = 128
-	eeGHIndex         ID = 129
-	eeTGIndex         ID = 130
-	elIndex           ID = 131
-	elCYIndex         ID = 132
-	elGRIndex         ID = 133
-	enIndex           ID = 134
-	en001Index        ID = 135
-	en150Index        ID = 136
-	enAGIndex         ID = 137
-	enAIIndex         ID = 138
-	enASIndex         ID = 139
-	enATIndex         ID = 140
-	enAUIndex         ID = 141
-	enBBIndex         ID = 142
-	enBEIndex         ID = 143
-	enBIIndex         ID = 144
-	enBMIndex         ID = 145
-	enBSIndex         ID = 146
-	enBWIndex         ID = 147
-	enBZIndex         ID = 148
-	enCAIndex         ID = 149
-	enCCIndex         ID = 150
-	enCHIndex         ID = 151
-	enCKIndex         ID = 152
-	enCMIndex         ID = 153
-	enCXIndex         ID = 154
-	enCYIndex         ID = 155
-	enDEIndex         ID = 156
-	enDGIndex         ID = 157
-	enDKIndex         ID = 158
-	enDMIndex         ID = 159
-	enERIndex         ID = 160
-	enFIIndex         ID = 161
-	enFJIndex         ID = 162
-	enFKIndex         ID = 163
-	enFMIndex         ID = 164
-	enGBIndex         ID = 165
-	enGDIndex         ID = 166
-	enGGIndex         ID = 167
-	enGHIndex         ID = 168
-	enGIIndex         ID = 169
-	enGMIndex         ID = 170
-	enGUIndex         ID = 171
-	enGYIndex         ID = 172
-	enHKIndex         ID = 173
-	enIEIndex         ID = 174
-	enILIndex         ID = 175
-	enIMIndex         ID = 176
-	enINIndex         ID = 177
-	enIOIndex         ID = 178
-	enJEIndex         ID = 179
-	enJMIndex         ID = 180
-	enKEIndex         ID = 181
-	enKIIndex         ID = 182
-	enKNIndex         ID = 183
-	enKYIndex         ID = 184
-	enLCIndex         ID = 185
-	enLRIndex         ID = 186
-	enLSIndex         ID = 187
-	enMGIndex         ID = 188
-	enMHIndex         ID = 189
-	enMOIndex         ID = 190
-	enMPIndex         ID = 191
-	enMSIndex         ID = 192
-	enMTIndex         ID = 193
-	enMUIndex         ID = 194
-	enMWIndex         ID = 195
-	enMYIndex         ID = 196
-	enNAIndex         ID = 197
-	enNFIndex         ID = 198
-	enNGIndex         ID = 199
-	enNLIndex         ID = 200
-	enNRIndex         ID = 201
-	enNUIndex         ID = 202
-	enNZIndex         ID = 203
-	enPGIndex         ID = 204
-	enPHIndex         ID = 205
-	enPKIndex         ID = 206
-	enPNIndex         ID = 207
-	enPRIndex         ID = 208
-	enPWIndex         ID = 209
-	enRWIndex         ID = 210
-	enSBIndex         ID = 211
-	enSCIndex         ID = 212
-	enSDIndex         ID = 213
-	enSEIndex         ID = 214
-	enSGIndex         ID = 215
-	enSHIndex         ID = 216
-	enSIIndex         ID = 217
-	enSLIndex         ID = 218
-	enSSIndex         ID = 219
-	enSXIndex         ID = 220
-	enSZIndex         ID = 221
-	enTCIndex         ID = 222
-	enTKIndex         ID = 223
-	enTOIndex         ID = 224
-	enTTIndex         ID = 225
-	enTVIndex         ID = 226
-	enTZIndex         ID = 227
-	enUGIndex         ID = 228
-	enUMIndex         ID = 229
-	enUSIndex         ID = 230
-	enVCIndex         ID = 231
-	enVGIndex         ID = 232
-	enVIIndex         ID = 233
-	enVUIndex         ID = 234
-	enWSIndex         ID = 235
-	enZAIndex         ID = 236
-	enZMIndex         ID = 237
-	enZWIndex         ID = 238
-	eoIndex           ID = 239
-	eo001Index        ID = 240
-	esIndex           ID = 241
-	es419Index        ID = 242
-	esARIndex         ID = 243
-	esBOIndex         ID = 244
-	esBRIndex         ID = 245
-	esBZIndex         ID = 246
-	esCLIndex         ID = 247
-	esCOIndex         ID = 248
-	esCRIndex         ID = 249
-	esCUIndex         ID = 250
-	esDOIndex         ID = 251
-	esEAIndex         ID = 252
-	esECIndex         ID = 253
-	esESIndex         ID = 254
-	esGQIndex         ID = 255
-	esGTIndex         ID = 256
-	esHNIndex         ID = 257
-	esICIndex         ID = 258
-	esMXIndex         ID = 259
-	esNIIndex         ID = 260
-	esPAIndex         ID = 261
-	esPEIndex         ID = 262
-	esPHIndex         ID = 263
-	esPRIndex         ID = 264
-	esPYIndex         ID = 265
-	esSVIndex         ID = 266
-	esUSIndex         ID = 267
-	esUYIndex         ID = 268
-	esVEIndex         ID = 269
-	etIndex           ID = 270
-	etEEIndex         ID = 271
-	euIndex           ID = 272
-	euESIndex         ID = 273
-	ewoIndex          ID = 274
-	ewoCMIndex        ID = 275
-	faIndex           ID = 276
-	faAFIndex         ID = 277
-	faIRIndex         ID = 278
-	ffIndex           ID = 279
-	ffCMIndex         ID = 280
-	ffGNIndex         ID = 281
-	ffMRIndex         ID = 282
-	ffSNIndex         ID = 283
-	fiIndex           ID = 284
-	fiFIIndex         ID = 285
-	filIndex          ID = 286
-	filPHIndex        ID = 287
-	foIndex           ID = 288
-	foDKIndex         ID = 289
-	foFOIndex         ID = 290
-	frIndex           ID = 291
-	frBEIndex         ID = 292
-	frBFIndex         ID = 293
-	frBIIndex         ID = 294
-	frBJIndex         ID = 295
-	frBLIndex         ID = 296
-	frCAIndex         ID = 297
-	frCDIndex         ID = 298
-	frCFIndex         ID = 299
-	frCGIndex         ID = 300
-	frCHIndex         ID = 301
-	frCIIndex         ID = 302
-	frCMIndex         ID = 303
-	frDJIndex         ID = 304
-	frDZIndex         ID = 305
-	frFRIndex         ID = 306
-	frGAIndex         ID = 307
-	frGFIndex         ID = 308
-	frGNIndex         ID = 309
-	frGPIndex         ID = 310
-	frGQIndex         ID = 311
-	frHTIndex         ID = 312
-	frKMIndex         ID = 313
-	frLUIndex         ID = 314
-	frMAIndex         ID = 315
-	frMCIndex         ID = 316
-	frMFIndex         ID = 317
-	frMGIndex         ID = 318
-	frMLIndex         ID = 319
-	frMQIndex         ID = 320
-	frMRIndex         ID = 321
-	frMUIndex         ID = 322
-	frNCIndex         ID = 323
-	frNEIndex         ID = 324
-	frPFIndex         ID = 325
-	frPMIndex         ID = 326
-	frREIndex         ID = 327
-	frRWIndex         ID = 328
-	frSCIndex         ID = 329
-	frSNIndex         ID = 330
-	frSYIndex         ID = 331
-	frTDIndex         ID = 332
-	frTGIndex         ID = 333
-	frTNIndex         ID = 334
-	frVUIndex         ID = 335
-	frWFIndex         ID = 336
-	frYTIndex         ID = 337
-	furIndex          ID = 338
-	furITIndex        ID = 339
-	fyIndex           ID = 340
-	fyNLIndex         ID = 341
-	gaIndex           ID = 342
-	gaIEIndex         ID = 343
-	gdIndex           ID = 344
-	gdGBIndex         ID = 345
-	glIndex           ID = 346
-	glESIndex         ID = 347
-	gswIndex          ID = 348
-	gswCHIndex        ID = 349
-	gswFRIndex        ID = 350
-	gswLIIndex        ID = 351
-	guIndex           ID = 352
-	guINIndex         ID = 353
-	guwIndex          ID = 354
-	guzIndex          ID = 355
-	guzKEIndex        ID = 356
-	gvIndex           ID = 357
-	gvIMIndex         ID = 358
-	haIndex           ID = 359
-	haGHIndex         ID = 360
-	haNEIndex         ID = 361
-	haNGIndex         ID = 362
-	hawIndex          ID = 363
-	hawUSIndex        ID = 364
-	heIndex           ID = 365
-	heILIndex         ID = 366
-	hiIndex           ID = 367
-	hiINIndex         ID = 368
-	hrIndex           ID = 369
-	hrBAIndex         ID = 370
-	hrHRIndex         ID = 371
-	hsbIndex          ID = 372
-	hsbDEIndex        ID = 373
-	huIndex           ID = 374
-	huHUIndex         ID = 375
-	hyIndex           ID = 376
-	hyAMIndex         ID = 377
-	idIndex           ID = 378
-	idIDIndex         ID = 379
-	igIndex           ID = 380
-	igNGIndex         ID = 381
-	iiIndex           ID = 382
-	iiCNIndex         ID = 383
-	inIndex           ID = 384
-	ioIndex           ID = 385
-	isIndex           ID = 386
-	isISIndex         ID = 387
-	itIndex           ID = 388
-	itCHIndex         ID = 389
-	itITIndex         ID = 390
-	itSMIndex         ID = 391
-	itVAIndex         ID = 392
-	iuIndex           ID = 393
-	iwIndex           ID = 394
-	jaIndex           ID = 395
-	jaJPIndex         ID = 396
-	jboIndex          ID = 397
-	jgoIndex          ID = 398
-	jgoCMIndex        ID = 399
-	jiIndex           ID = 400
-	jmcIndex          ID = 401
-	jmcTZIndex        ID = 402
-	jvIndex           ID = 403
-	jwIndex           ID = 404
-	kaIndex           ID = 405
-	kaGEIndex         ID = 406
-	kabIndex          ID = 407
-	kabDZIndex        ID = 408
-	kajIndex          ID = 409
-	kamIndex          ID = 410
-	kamKEIndex        ID = 411
-	kcgIndex          ID = 412
-	kdeIndex          ID = 413
-	kdeTZIndex        ID = 414
-	keaIndex          ID = 415
-	keaCVIndex        ID = 416
-	khqIndex          ID = 417
-	khqMLIndex        ID = 418
-	kiIndex           ID = 419
-	kiKEIndex         ID = 420
-	kkIndex           ID = 421
-	kkKZIndex         ID = 422
-	kkjIndex          ID = 423
-	kkjCMIndex        ID = 424
-	klIndex           ID = 425
-	klGLIndex         ID = 426
-	klnIndex          ID = 427
-	klnKEIndex        ID = 428
-	kmIndex           ID = 429
-	kmKHIndex         ID = 430
-	knIndex           ID = 431
-	knINIndex         ID = 432
-	koIndex           ID = 433
-	koKPIndex         ID = 434
-	koKRIndex         ID = 435
-	kokIndex          ID = 436
-	kokINIndex        ID = 437
-	ksIndex           ID = 438
-	ksINIndex         ID = 439
-	ksbIndex          ID = 440
-	ksbTZIndex        ID = 441
-	ksfIndex          ID = 442
-	ksfCMIndex        ID = 443
-	kshIndex          ID = 444
-	kshDEIndex        ID = 445
-	kuIndex           ID = 446
-	kwIndex           ID = 447
-	kwGBIndex         ID = 448
-	kyIndex           ID = 449
-	kyKGIndex         ID = 450
-	lagIndex          ID = 451
-	lagTZIndex        ID = 452
-	lbIndex           ID = 453
-	lbLUIndex         ID = 454
-	lgIndex           ID = 455
-	lgUGIndex         ID = 456
-	lktIndex          ID = 457
-	lktUSIndex        ID = 458
-	lnIndex           ID = 459
-	lnAOIndex         ID = 460
-	lnCDIndex         ID = 461
-	lnCFIndex         ID = 462
-	lnCGIndex         ID = 463
-	loIndex           ID = 464
-	loLAIndex         ID = 465
-	lrcIndex          ID = 466
-	lrcIQIndex        ID = 467
-	lrcIRIndex        ID = 468
-	ltIndex           ID = 469
-	ltLTIndex         ID = 470
-	luIndex           ID = 471
-	luCDIndex         ID = 472
-	luoIndex          ID = 473
-	luoKEIndex        ID = 474
-	luyIndex          ID = 475
-	luyKEIndex        ID = 476
-	lvIndex           ID = 477
-	lvLVIndex         ID = 478
-	masIndex          ID = 479
-	masKEIndex        ID = 480
-	masTZIndex        ID = 481
-	merIndex          ID = 482
-	merKEIndex        ID = 483
-	mfeIndex          ID = 484
-	mfeMUIndex        ID = 485
-	mgIndex           ID = 486
-	mgMGIndex         ID = 487
-	mghIndex          ID = 488
-	mghMZIndex        ID = 489
-	mgoIndex          ID = 490
-	mgoCMIndex        ID = 491
-	mkIndex           ID = 492
-	mkMKIndex         ID = 493
-	mlIndex           ID = 494
-	mlINIndex         ID = 495
-	mnIndex           ID = 496
-	mnMNIndex         ID = 497
-	moIndex           ID = 498
-	mrIndex           ID = 499
-	mrINIndex         ID = 500
-	msIndex           ID = 501
-	msBNIndex         ID = 502
-	msMYIndex         ID = 503
-	msSGIndex         ID = 504
-	mtIndex           ID = 505
-	mtMTIndex         ID = 506
-	muaIndex          ID = 507
-	muaCMIndex        ID = 508
-	myIndex           ID = 509
-	myMMIndex         ID = 510
-	mznIndex          ID = 511
-	mznIRIndex        ID = 512
-	nahIndex          ID = 513
-	naqIndex          ID = 514
-	naqNAIndex        ID = 515
-	nbIndex           ID = 516
-	nbNOIndex         ID = 517
-	nbSJIndex         ID = 518
-	ndIndex           ID = 519
-	ndZWIndex         ID = 520
-	ndsIndex          ID = 521
-	ndsDEIndex        ID = 522
-	ndsNLIndex        ID = 523
-	neIndex           ID = 524
-	neINIndex         ID = 525
-	neNPIndex         ID = 526
-	nlIndex           ID = 527
-	nlAWIndex         ID = 528
-	nlBEIndex         ID = 529
-	nlBQIndex         ID = 530
-	nlCWIndex         ID = 531
-	nlNLIndex         ID = 532
-	nlSRIndex         ID = 533
-	nlSXIndex         ID = 534
-	nmgIndex          ID = 535
-	nmgCMIndex        ID = 536
-	nnIndex           ID = 537
-	nnNOIndex         ID = 538
-	nnhIndex          ID = 539
-	nnhCMIndex        ID = 540
-	noIndex           ID = 541
-	nqoIndex          ID = 542
-	nrIndex           ID = 543
-	nsoIndex          ID = 544
-	nusIndex          ID = 545
-	nusSSIndex        ID = 546
-	nyIndex           ID = 547
-	nynIndex          ID = 548
-	nynUGIndex        ID = 549
-	omIndex           ID = 550
-	omETIndex         ID = 551
-	omKEIndex         ID = 552
-	orIndex           ID = 553
-	orINIndex         ID = 554
-	osIndex           ID = 555
-	osGEIndex         ID = 556
-	osRUIndex         ID = 557
-	paIndex           ID = 558
-	paArabIndex       ID = 559
-	paArabPKIndex     ID = 560
-	paGuruIndex       ID = 561
-	paGuruINIndex     ID = 562
-	papIndex          ID = 563
-	plIndex           ID = 564
-	plPLIndex         ID = 565
-	prgIndex          ID = 566
-	prg001Index       ID = 567
-	psIndex           ID = 568
-	psAFIndex         ID = 569
-	ptIndex           ID = 570
-	ptAOIndex         ID = 571
-	ptBRIndex         ID = 572
-	ptCHIndex         ID = 573
-	ptCVIndex         ID = 574
-	ptGQIndex         ID = 575
-	ptGWIndex         ID = 576
-	ptLUIndex         ID = 577
-	ptMOIndex         ID = 578
-	ptMZIndex         ID = 579
-	ptPTIndex         ID = 580
-	ptSTIndex         ID = 581
-	ptTLIndex         ID = 582
-	quIndex           ID = 583
-	quBOIndex         ID = 584
-	quECIndex         ID = 585
-	quPEIndex         ID = 586
-	rmIndex           ID = 587
-	rmCHIndex         ID = 588
-	rnIndex           ID = 589
-	rnBIIndex         ID = 590
-	roIndex           ID = 591
-	roMDIndex         ID = 592
-	roROIndex         ID = 593
-	rofIndex          ID = 594
-	rofTZIndex        ID = 595
-	ruIndex           ID = 596
-	ruBYIndex         ID = 597
-	ruKGIndex         ID = 598
-	ruKZIndex         ID = 599
-	ruMDIndex         ID = 600
-	ruRUIndex         ID = 601
-	ruUAIndex         ID = 602
-	rwIndex           ID = 603
-	rwRWIndex         ID = 604
-	rwkIndex          ID = 605
-	rwkTZIndex        ID = 606
-	sahIndex          ID = 607
-	sahRUIndex        ID = 608
-	saqIndex          ID = 609
-	saqKEIndex        ID = 610
-	sbpIndex          ID = 611
-	sbpTZIndex        ID = 612
-	sdIndex           ID = 613
-	sdPKIndex         ID = 614
-	sdhIndex          ID = 615
-	seIndex           ID = 616
-	seFIIndex         ID = 617
-	seNOIndex         ID = 618
-	seSEIndex         ID = 619
-	sehIndex          ID = 620
-	sehMZIndex        ID = 621
-	sesIndex          ID = 622
-	sesMLIndex        ID = 623
-	sgIndex           ID = 624
-	sgCFIndex         ID = 625
-	shIndex           ID = 626
-	shiIndex          ID = 627
-	shiLatnIndex      ID = 628
-	shiLatnMAIndex    ID = 629
-	shiTfngIndex      ID = 630
-	shiTfngMAIndex    ID = 631
-	siIndex           ID = 632
-	siLKIndex         ID = 633
-	skIndex           ID = 634
-	skSKIndex         ID = 635
-	slIndex           ID = 636
-	slSIIndex         ID = 637
-	smaIndex          ID = 638
-	smiIndex          ID = 639
-	smjIndex          ID = 640
-	smnIndex          ID = 641
-	smnFIIndex        ID = 642
-	smsIndex          ID = 643
-	snIndex           ID = 644
-	snZWIndex         ID = 645
-	soIndex           ID = 646
-	soDJIndex         ID = 647
-	soETIndex         ID = 648
-	soKEIndex         ID = 649
-	soSOIndex         ID = 650
-	sqIndex           ID = 651
-	sqALIndex         ID = 652
-	sqMKIndex         ID = 653
-	sqXKIndex         ID = 654
-	srIndex           ID = 655
-	srCyrlIndex       ID = 656
-	srCyrlBAIndex     ID = 657
-	srCyrlMEIndex     ID = 658
-	srCyrlRSIndex     ID = 659
-	srCyrlXKIndex     ID = 660
-	srLatnIndex       ID = 661
-	srLatnBAIndex     ID = 662
-	srLatnMEIndex     ID = 663
-	srLatnRSIndex     ID = 664
-	srLatnXKIndex     ID = 665
-	ssIndex           ID = 666
-	ssyIndex          ID = 667
-	stIndex           ID = 668
-	svIndex           ID = 669
-	svAXIndex         ID = 670
-	svFIIndex         ID = 671
-	svSEIndex         ID = 672
-	swIndex           ID = 673
-	swCDIndex         ID = 674
-	swKEIndex         ID = 675
-	swTZIndex         ID = 676
-	swUGIndex         ID = 677
-	syrIndex          ID = 678
-	taIndex           ID = 679
-	taINIndex         ID = 680
-	taLKIndex         ID = 681
-	taMYIndex         ID = 682
-	taSGIndex         ID = 683
-	teIndex           ID = 684
-	teINIndex         ID = 685
-	teoIndex          ID = 686
-	teoKEIndex        ID = 687
-	teoUGIndex        ID = 688
-	tgIndex           ID = 689
-	tgTJIndex         ID = 690
-	thIndex           ID = 691
-	thTHIndex         ID = 692
-	tiIndex           ID = 693
-	tiERIndex         ID = 694
-	tiETIndex         ID = 695
-	tigIndex          ID = 696
-	tkIndex           ID = 697
-	tkTMIndex         ID = 698
-	tlIndex           ID = 699
-	tnIndex           ID = 700
-	toIndex           ID = 701
-	toTOIndex         ID = 702
-	trIndex           ID = 703
-	trCYIndex         ID = 704
-	trTRIndex         ID = 705
-	tsIndex           ID = 706
-	ttIndex           ID = 707
-	ttRUIndex         ID = 708
-	twqIndex          ID = 709
-	twqNEIndex        ID = 710
-	tzmIndex          ID = 711
-	tzmMAIndex        ID = 712
-	ugIndex           ID = 713
-	ugCNIndex         ID = 714
-	ukIndex           ID = 715
-	ukUAIndex         ID = 716
-	urIndex           ID = 717
-	urINIndex         ID = 718
-	urPKIndex         ID = 719
-	uzIndex           ID = 720
-	uzArabIndex       ID = 721
-	uzArabAFIndex     ID = 722
-	uzCyrlIndex       ID = 723
-	uzCyrlUZIndex     ID = 724
-	uzLatnIndex       ID = 725
-	uzLatnUZIndex     ID = 726
-	vaiIndex          ID = 727
-	vaiLatnIndex      ID = 728
-	vaiLatnLRIndex    ID = 729
-	vaiVaiiIndex      ID = 730
-	vaiVaiiLRIndex    ID = 731
-	veIndex           ID = 732
-	viIndex           ID = 733
-	viVNIndex         ID = 734
-	voIndex           ID = 735
-	vo001Index        ID = 736
-	vunIndex          ID = 737
-	vunTZIndex        ID = 738
-	waIndex           ID = 739
-	waeIndex          ID = 740
-	waeCHIndex        ID = 741
-	woIndex           ID = 742
-	woSNIndex         ID = 743
-	xhIndex           ID = 744
-	xogIndex          ID = 745
-	xogUGIndex        ID = 746
-	yavIndex          ID = 747
-	yavCMIndex        ID = 748
-	yiIndex           ID = 749
-	yi001Index        ID = 750
-	yoIndex           ID = 751
-	yoBJIndex         ID = 752
-	yoNGIndex         ID = 753
-	yueIndex          ID = 754
-	yueHansIndex      ID = 755
-	yueHansCNIndex    ID = 756
-	yueHantIndex      ID = 757
-	yueHantHKIndex    ID = 758
-	zghIndex          ID = 759
-	zghMAIndex        ID = 760
-	zhIndex           ID = 761
-	zhHansIndex       ID = 762
-	zhHansCNIndex     ID = 763
-	zhHansHKIndex     ID = 764
-	zhHansMOIndex     ID = 765
-	zhHansSGIndex     ID = 766
-	zhHantIndex       ID = 767
-	zhHantHKIndex     ID = 768
-	zhHantMOIndex     ID = 769
-	zhHantTWIndex     ID = 770
-	zuIndex           ID = 771
-	zuZAIndex         ID = 772
-	caESvalenciaIndex ID = 773
-	enUSuvaposixIndex ID = 774
-)
-
-var coreTags = []language.CompactCoreInfo{ // 773 elements
-	// Entry 0 - 1F
-	0x00000000, 0x01600000, 0x016000d2, 0x01600161,
-	0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
-	0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
-	0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
-	0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
-	0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
-	0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
-	0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
-	// Entry 20 - 3F
-	0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
-	0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
-	0x04300000, 0x04300099, 0x04400000, 0x0440012f,
-	0x04800000, 0x0480006e, 0x05800000, 0x05820000,
-	0x05820032, 0x0585a000, 0x0585a032, 0x05e00000,
-	0x05e00052, 0x07100000, 0x07100047, 0x07500000,
-	0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
-	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
-	// Entry 40 - 5F
-	0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
-	0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
-	0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000,
-	0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000,
-	0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
-	0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
-	0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
-	0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
-	// Entry 60 - 7F
-	0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
-	0x10000000, 0x1000007b, 0x10100000, 0x10100063,
-	0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
-	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
-	0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
-	0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
-	0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
-	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
-	// Entry 80 - 9F
-	0x13000000, 0x13000080, 0x13000122, 0x13600000,
-	0x1360005d, 0x13600087, 0x13900000, 0x13900001,
-	0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
-	0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
-	0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
-	0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
-	0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
-	0x13900060, 0x13900061, 0x13900063, 0x13900064,
-	// Entry A0 - BF
-	0x1390006d, 0x13900072, 0x13900073, 0x13900074,
-	0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
-	0x13900080, 0x13900081, 0x13900083, 0x1390008a,
-	0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
-	0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
-	0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
-	0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
-	0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
-	// Entry C0 - DF
-	0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
-	0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
-	0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
-	0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
-	0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
-	0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
-	0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
-	0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
-	// Entry E0 - FF
-	0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
-	0x13900131, 0x13900133, 0x13900135, 0x13900139,
-	0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
-	0x13900161, 0x13900162, 0x13900164, 0x13c00000,
-	0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
-	0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
-	0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
-	0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
-	// Entry 100 - 11F
-	0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
-	0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
-	0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
-	0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
-	0x14500000, 0x1450006e, 0x14600000, 0x14600052,
-	0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
-	0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
-	0x15100000, 0x15100072, 0x15300000, 0x153000e7,
-	// Entry 120 - 13F
-	0x15800000, 0x15800063, 0x15800076, 0x15e00000,
-	0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
-	0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
-	0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
-	0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
-	0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
-	0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
-	0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
-	// Entry 140 - 15F
-	0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
-	0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
-	0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
-	0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
-	0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
-	0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
-	0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
-	0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
-	// Entry 160 - 17F
-	0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
-	0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
-	0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
-	0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
-	0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
-	0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
-	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
-	0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
-	// Entry 180 - 19F
-	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
-	0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
-	0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
-	0x200000a2, 0x20300000, 0x20700000, 0x20700052,
-	0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
-	0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
-	0x21200067, 0x21600000, 0x21700000, 0x217000a4,
-	0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
-	// Entry 1A0 - 1BF
-	0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
-	0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
-	0x24400052, 0x24500000, 0x24500082, 0x24600000,
-	0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
-	0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
-	0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
-	0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
-	0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
-	// Entry 1C0 - 1DF
-	0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
-	0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
-	0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
-	0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
-	0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
-	0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
-	0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
-	0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
-	// Entry 1E0 - 1FF
-	0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
-	0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
-	0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
-	0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
-	0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
-	0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
-	0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
-	0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
-	// Entry 200 - 21F
-	0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
-	0x34700000, 0x347000da, 0x34700110, 0x34e00000,
-	0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
-	0x35100000, 0x35100099, 0x351000db, 0x36700000,
-	0x36700030, 0x36700036, 0x36700040, 0x3670005b,
-	0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
-	0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
-	0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
-	// Entry 220 - 23F
-	0x37a00000, 0x38000000, 0x38000117, 0x38700000,
-	0x38900000, 0x38900131, 0x39000000, 0x3900006f,
-	0x390000a4, 0x39500000, 0x39500099, 0x39800000,
-	0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
-	0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000,
-	0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
-	0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
-	0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
-	// Entry 240 - 25F
-	0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
-	0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
-	0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
-	0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
-	0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
-	0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
-	0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
-	0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
-	// Entry 260 - 27F
-	0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
-	0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
-	0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
-	0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
-	0x40200000, 0x4020004c, 0x40700000, 0x40800000,
-	0x4085a000, 0x4085a0ba, 0x408e3000, 0x408e30ba,
-	0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
-	0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
-	// Entry 280 - 29F
-	0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
-	0x42300000, 0x42300164, 0x42900000, 0x42900062,
-	0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
-	0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
-	0x43220000, 0x43220033, 0x432200bd, 0x43220105,
-	0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd,
-	0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000,
-	0x43b00000, 0x44400000, 0x44400031, 0x44400072,
-	// Entry 2A0 - 2BF
-	0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
-	0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
-	0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
-	0x46100000, 0x46100099, 0x46400000, 0x464000a4,
-	0x46400131, 0x46700000, 0x46700124, 0x46b00000,
-	0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
-	0x47100000, 0x47600000, 0x47600127, 0x47a00000,
-	0x48000000, 0x48200000, 0x48200129, 0x48a00000,
-	// Entry 2C0 - 2DF
-	0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
-	0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
-	0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
-	0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
-	0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000,
-	0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000,
-	0x4be5a000, 0x4be5a0b4, 0x4beeb000, 0x4beeb0b4,
-	0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
-	// Entry 2E0 - 2FF
-	0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
-	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
-	0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
-	0x50900052, 0x51200000, 0x51200001, 0x51800000,
-	0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000,
-	0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000,
-	0x528000ba, 0x52900000, 0x5293b000, 0x5293b053,
-	0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000,
-	// Entry 300 - 31F
-	0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000,
-	0x52f00161,
-} // Size: 3116 bytes
-
-const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
-
-// Total table size 3147 bytes (3KiB); checksum: BE816D44
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
deleted file mode 100644
index ca135d295a..0000000000
--- a/vendor/golang.org/x/text/internal/language/compact/tags.go
+++ /dev/null
@@ -1,91 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package compact
-
-var (
-	und = Tag{}
-
-	Und Tag = Tag{}
-
-	Afrikaans            Tag = Tag{language: afIndex, locale: afIndex}
-	Amharic              Tag = Tag{language: amIndex, locale: amIndex}
-	Arabic               Tag = Tag{language: arIndex, locale: arIndex}
-	ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
-	Azerbaijani          Tag = Tag{language: azIndex, locale: azIndex}
-	Bulgarian            Tag = Tag{language: bgIndex, locale: bgIndex}
-	Bengali              Tag = Tag{language: bnIndex, locale: bnIndex}
-	Catalan              Tag = Tag{language: caIndex, locale: caIndex}
-	Czech                Tag = Tag{language: csIndex, locale: csIndex}
-	Danish               Tag = Tag{language: daIndex, locale: daIndex}
-	German               Tag = Tag{language: deIndex, locale: deIndex}
-	Greek                Tag = Tag{language: elIndex, locale: elIndex}
-	English              Tag = Tag{language: enIndex, locale: enIndex}
-	AmericanEnglish      Tag = Tag{language: enUSIndex, locale: enUSIndex}
-	BritishEnglish       Tag = Tag{language: enGBIndex, locale: enGBIndex}
-	Spanish              Tag = Tag{language: esIndex, locale: esIndex}
-	EuropeanSpanish      Tag = Tag{language: esESIndex, locale: esESIndex}
-	LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
-	Estonian             Tag = Tag{language: etIndex, locale: etIndex}
-	Persian              Tag = Tag{language: faIndex, locale: faIndex}
-	Finnish              Tag = Tag{language: fiIndex, locale: fiIndex}
-	Filipino             Tag = Tag{language: filIndex, locale: filIndex}
-	French               Tag = Tag{language: frIndex, locale: frIndex}
-	CanadianFrench       Tag = Tag{language: frCAIndex, locale: frCAIndex}
-	Gujarati             Tag = Tag{language: guIndex, locale: guIndex}
-	Hebrew               Tag = Tag{language: heIndex, locale: heIndex}
-	Hindi                Tag = Tag{language: hiIndex, locale: hiIndex}
-	Croatian             Tag = Tag{language: hrIndex, locale: hrIndex}
-	Hungarian            Tag = Tag{language: huIndex, locale: huIndex}
-	Armenian             Tag = Tag{language: hyIndex, locale: hyIndex}
-	Indonesian           Tag = Tag{language: idIndex, locale: idIndex}
-	Icelandic            Tag = Tag{language: isIndex, locale: isIndex}
-	Italian              Tag = Tag{language: itIndex, locale: itIndex}
-	Japanese             Tag = Tag{language: jaIndex, locale: jaIndex}
-	Georgian             Tag = Tag{language: kaIndex, locale: kaIndex}
-	Kazakh               Tag = Tag{language: kkIndex, locale: kkIndex}
-	Khmer                Tag = Tag{language: kmIndex, locale: kmIndex}
-	Kannada              Tag = Tag{language: knIndex, locale: knIndex}
-	Korean               Tag = Tag{language: koIndex, locale: koIndex}
-	Kirghiz              Tag = Tag{language: kyIndex, locale: kyIndex}
-	Lao                  Tag = Tag{language: loIndex, locale: loIndex}
-	Lithuanian           Tag = Tag{language: ltIndex, locale: ltIndex}
-	Latvian              Tag = Tag{language: lvIndex, locale: lvIndex}
-	Macedonian           Tag = Tag{language: mkIndex, locale: mkIndex}
-	Malayalam            Tag = Tag{language: mlIndex, locale: mlIndex}
-	Mongolian            Tag = Tag{language: mnIndex, locale: mnIndex}
-	Marathi              Tag = Tag{language: mrIndex, locale: mrIndex}
-	Malay                Tag = Tag{language: msIndex, locale: msIndex}
-	Burmese              Tag = Tag{language: myIndex, locale: myIndex}
-	Nepali               Tag = Tag{language: neIndex, locale: neIndex}
-	Dutch                Tag = Tag{language: nlIndex, locale: nlIndex}
-	Norwegian            Tag = Tag{language: noIndex, locale: noIndex}
-	Punjabi              Tag = Tag{language: paIndex, locale: paIndex}
-	Polish               Tag = Tag{language: plIndex, locale: plIndex}
-	Portuguese           Tag = Tag{language: ptIndex, locale: ptIndex}
-	BrazilianPortuguese  Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
-	EuropeanPortuguese   Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
-	Romanian             Tag = Tag{language: roIndex, locale: roIndex}
-	Russian              Tag = Tag{language: ruIndex, locale: ruIndex}
-	Sinhala              Tag = Tag{language: siIndex, locale: siIndex}
-	Slovak               Tag = Tag{language: skIndex, locale: skIndex}
-	Slovenian            Tag = Tag{language: slIndex, locale: slIndex}
-	Albanian             Tag = Tag{language: sqIndex, locale: sqIndex}
-	Serbian              Tag = Tag{language: srIndex, locale: srIndex}
-	SerbianLatin         Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
-	Swedish              Tag = Tag{language: svIndex, locale: svIndex}
-	Swahili              Tag = Tag{language: swIndex, locale: swIndex}
-	Tamil                Tag = Tag{language: taIndex, locale: taIndex}
-	Telugu               Tag = Tag{language: teIndex, locale: teIndex}
-	Thai                 Tag = Tag{language: thIndex, locale: thIndex}
-	Turkish              Tag = Tag{language: trIndex, locale: trIndex}
-	Ukrainian            Tag = Tag{language: ukIndex, locale: ukIndex}
-	Urdu                 Tag = Tag{language: urIndex, locale: urIndex}
-	Uzbek                Tag = Tag{language: uzIndex, locale: uzIndex}
-	Vietnamese           Tag = Tag{language: viIndex, locale: viIndex}
-	Chinese              Tag = Tag{language: zhIndex, locale: zhIndex}
-	SimplifiedChinese    Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
-	TraditionalChinese   Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
-	Zulu                 Tag = Tag{language: zuIndex, locale: zuIndex}
-)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
deleted file mode 100644
index 4ae78e0fa5..0000000000
--- a/vendor/golang.org/x/text/internal/language/compose.go
+++ /dev/null
@@ -1,167 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"sort"
-	"strings"
-)
-
-// A Builder allows constructing a Tag from individual components.
-// Its main user is Compose in the top-level language package.
-type Builder struct {
-	Tag Tag
-
-	private    string // the x extension
-	variants   []string
-	extensions []string
-}
-
-// Make returns a new Tag from the current settings.
-func (b *Builder) Make() Tag {
-	t := b.Tag
-
-	if len(b.extensions) > 0 || len(b.variants) > 0 {
-		sort.Sort(sortVariants(b.variants))
-		sort.Strings(b.extensions)
-
-		if b.private != "" {
-			b.extensions = append(b.extensions, b.private)
-		}
-		n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
-		buf := make([]byte, n)
-		p := t.genCoreBytes(buf)
-		t.pVariant = byte(p)
-		p += appendTokens(buf[p:], b.variants...)
-		t.pExt = uint16(p)
-		p += appendTokens(buf[p:], b.extensions...)
-		t.str = string(buf[:p])
-		// We may not always need to remake the string, but when or when not
-		// to do so is rather tricky.
-		scan := makeScanner(buf[:p])
-		t, _ = parse(&scan, "")
-		return t
-
-	} else if b.private != "" {
-		t.str = b.private
-		t.RemakeString()
-	}
-	return t
-}
-
-// SetTag copies all the settings from a given Tag. Any previously set values
-// are discarded.
-func (b *Builder) SetTag(t Tag) {
-	b.Tag.LangID = t.LangID
-	b.Tag.RegionID = t.RegionID
-	b.Tag.ScriptID = t.ScriptID
-	// TODO: optimize
-	b.variants = b.variants[:0]
-	if variants := t.Variants(); variants != "" {
-		for _, vr := range strings.Split(variants[1:], "-") {
-			b.variants = append(b.variants, vr)
-		}
-	}
-	b.extensions, b.private = b.extensions[:0], ""
-	for _, e := range t.Extensions() {
-		b.AddExt(e)
-	}
-}
-
-// AddExt adds extension e to the tag. e must be a valid extension as returned
-// by Tag.Extension. If the extension already exists, it will be discarded,
-// except for a -u extension, where non-existing key-type pairs will added.
-func (b *Builder) AddExt(e string) {
-	if e[0] == 'x' {
-		if b.private == "" {
-			b.private = e
-		}
-		return
-	}
-	for i, s := range b.extensions {
-		if s[0] == e[0] {
-			if e[0] == 'u' {
-				b.extensions[i] += e[1:]
-			}
-			return
-		}
-	}
-	b.extensions = append(b.extensions, e)
-}
-
-// SetExt sets the extension e to the tag. e must be a valid extension as
-// returned by Tag.Extension. If the extension already exists, it will be
-// overwritten, except for a -u extension, where the individual key-type pairs
-// will be set.
-func (b *Builder) SetExt(e string) {
-	if e[0] == 'x' {
-		b.private = e
-		return
-	}
-	for i, s := range b.extensions {
-		if s[0] == e[0] {
-			if e[0] == 'u' {
-				b.extensions[i] = e + s[1:]
-			} else {
-				b.extensions[i] = e
-			}
-			return
-		}
-	}
-	b.extensions = append(b.extensions, e)
-}
-
-// AddVariant adds any number of variants.
-func (b *Builder) AddVariant(v ...string) {
-	for _, v := range v {
-		if v != "" {
-			b.variants = append(b.variants, v)
-		}
-	}
-}
-
-// ClearVariants removes any variants previously added, including those
-// copied from a Tag in SetTag.
-func (b *Builder) ClearVariants() {
-	b.variants = b.variants[:0]
-}
-
-// ClearExtensions removes any extensions previously added, including those
-// copied from a Tag in SetTag.
-func (b *Builder) ClearExtensions() {
-	b.private = ""
-	b.extensions = b.extensions[:0]
-}
-
-func tokenLen(token ...string) (n int) {
-	for _, t := range token {
-		n += len(t) + 1
-	}
-	return
-}
-
-func appendTokens(b []byte, token ...string) int {
-	p := 0
-	for _, t := range token {
-		b[p] = '-'
-		copy(b[p+1:], t)
-		p += 1 + len(t)
-	}
-	return p
-}
-
-type sortVariants []string
-
-func (s sortVariants) Len() int {
-	return len(s)
-}
-
-func (s sortVariants) Swap(i, j int) {
-	s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariants) Less(i, j int) bool {
-	return variantIndex[s[i]] < variantIndex[s[j]]
-}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
deleted file mode 100644
index 9b20b88feb..0000000000
--- a/vendor/golang.org/x/text/internal/language/coverage.go
+++ /dev/null
@@ -1,28 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-// BaseLanguages returns the list of all supported base languages. It generates
-// the list by traversing the internal structures.
-func BaseLanguages() []Language {
-	base := make([]Language, 0, NumLanguages)
-	for i := 0; i < langNoIndexOffset; i++ {
-		// We included "und" already for the value 0.
-		if i != nonCanonicalUnd {
-			base = append(base, Language(i))
-		}
-	}
-	i := langNoIndexOffset
-	for _, v := range langNoIndex {
-		for k := 0; k < 8; k++ {
-			if v&1 == 1 {
-				base = append(base, Language(i))
-			}
-			v >>= 1
-			i++
-		}
-	}
-	return base
-}
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
deleted file mode 100644
index 6105bc7fad..0000000000
--- a/vendor/golang.org/x/text/internal/language/language.go
+++ /dev/null
@@ -1,627 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:generate go run gen.go gen_common.go -output tables.go
-
-package language // import "golang.org/x/text/internal/language"
-
-// TODO: Remove above NOTE after:
-// - verifying that tables are dropped correctly (most notably matcher tables).
-
-import (
-	"errors"
-	"fmt"
-	"strings"
-)
-
-const (
-	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
-	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
-	maxCoreSize = 12
-
-	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
-	// is large enough to hold at least 99% of the BCP 47 tags.
-	max99thPercentileSize = 32
-
-	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
-	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
-	maxSimpleUExtensionSize = 14
-)
-
-// Tag represents a BCP 47 language tag. It is used to specify an instance of a
-// specific language or locale. All language tag values are guaranteed to be
-// well-formed. The zero value of Tag is Und.
-type Tag struct {
-	// TODO: the following fields have the form TagTypeID. This name is chosen
-	// to allow refactoring the public package without conflicting with its
-	// Base, Script, and Region methods. Once the transition is fully completed
-	// the ID can be stripped from the name.
-
-	LangID   Language
-	RegionID Region
-	// TODO: we will soon run out of positions for ScriptID. Idea: instead of
-	// storing lang, region, and ScriptID codes, store only the compact index and
-	// have a lookup table from this code to its expansion. This greatly speeds
-	// up table lookup, speed up common variant cases.
-	// This will also immediately free up 3 extra bytes. Also, the pVariant
-	// field can now be moved to the lookup table, as the compact index uniquely
-	// determines the offset of a possible variant.
-	ScriptID Script
-	pVariant byte   // offset in str, includes preceding '-'
-	pExt     uint16 // offset of first extension, includes preceding '-'
-
-	// str is the string representation of the Tag. It will only be used if the
-	// tag has variants or extensions.
-	str string
-}
-
-// Make is a convenience wrapper for Parse that omits the error.
-// In case of an error, a sensible default is returned.
-func Make(s string) Tag {
-	t, _ := Parse(s)
-	return t
-}
-
-// Raw returns the raw base language, script and region, without making an
-// attempt to infer their values.
-// TODO: consider removing
-func (t Tag) Raw() (b Language, s Script, r Region) {
-	return t.LangID, t.ScriptID, t.RegionID
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
-	return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
-}
-
-// IsRoot returns true if t is equal to language "und".
-func (t Tag) IsRoot() bool {
-	if int(t.pVariant) < len(t.str) {
-		return false
-	}
-	return t.equalTags(Und)
-}
-
-// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
-// tag.
-func (t Tag) IsPrivateUse() bool {
-	return t.str != "" && t.pVariant == 0
-}
-
-// RemakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) RemakeString() {
-	if t.str == "" {
-		return
-	}
-	extra := t.str[t.pVariant:]
-	if t.pVariant > 0 {
-		extra = extra[1:]
-	}
-	if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
-		t.str = extra
-		t.pVariant = 0
-		t.pExt = 0
-		return
-	}
-	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
-	b := buf[:t.genCoreBytes(buf[:])]
-	if extra != "" {
-		diff := len(b) - int(t.pVariant)
-		b = append(b, '-')
-		b = append(b, extra...)
-		t.pVariant = uint8(int(t.pVariant) + diff)
-		t.pExt = uint16(int(t.pExt) + diff)
-	} else {
-		t.pVariant = uint8(len(b))
-		t.pExt = uint16(len(b))
-	}
-	t.str = string(b)
-}
-
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
-	n := t.LangID.StringToBuf(buf[:])
-	if t.ScriptID != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.ScriptID.String())
-	}
-	if t.RegionID != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.RegionID.String())
-	}
-	return n
-}
-
-// String returns the canonical string representation of the language tag.
-func (t Tag) String() string {
-	if t.str != "" {
-		return t.str
-	}
-	if t.ScriptID == 0 && t.RegionID == 0 {
-		return t.LangID.String()
-	}
-	buf := [maxCoreSize]byte{}
-	return string(buf[:t.genCoreBytes(buf[:])])
-}
-
-// MarshalText implements encoding.TextMarshaler.
-func (t Tag) MarshalText() (text []byte, err error) {
-	if t.str != "" {
-		text = append(text, t.str...)
-	} else if t.ScriptID == 0 && t.RegionID == 0 {
-		text = append(text, t.LangID.String()...)
-	} else {
-		buf := [maxCoreSize]byte{}
-		text = buf[:t.genCoreBytes(buf[:])]
-	}
-	return text, nil
-}
-
-// UnmarshalText implements encoding.TextUnmarshaler.
-func (t *Tag) UnmarshalText(text []byte) error {
-	tag, err := Parse(string(text))
-	*t = tag
-	return err
-}
-
-// Variants returns the part of the tag holding all variants or the empty string
-// if there are no variants defined.
-func (t Tag) Variants() string {
-	if t.pVariant == 0 {
-		return ""
-	}
-	return t.str[t.pVariant:t.pExt]
-}
-
-// VariantOrPrivateUseTags returns variants or private use tags.
-func (t Tag) VariantOrPrivateUseTags() string {
-	if t.pExt > 0 {
-		return t.str[t.pVariant:t.pExt]
-	}
-	return t.str[t.pVariant:]
-}
-
-// HasString reports whether this tag defines more than just the raw
-// components.
-func (t Tag) HasString() bool {
-	return t.str != ""
-}
-
-// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
-// specific language are substituted with fields from the parent language.
-// The parent for a language may change for newer versions of CLDR.
-func (t Tag) Parent() Tag {
-	if t.str != "" {
-		// Strip the variants and extensions.
-		b, s, r := t.Raw()
-		t = Tag{LangID: b, ScriptID: s, RegionID: r}
-		if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
-			base, _ := addTags(Tag{LangID: t.LangID})
-			if base.ScriptID == t.ScriptID {
-				return Tag{LangID: t.LangID}
-			}
-		}
-		return t
-	}
-	if t.LangID != 0 {
-		if t.RegionID != 0 {
-			maxScript := t.ScriptID
-			if maxScript == 0 {
-				max, _ := addTags(t)
-				maxScript = max.ScriptID
-			}
-
-			for i := range parents {
-				if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
-					for _, r := range parents[i].fromRegion {
-						if Region(r) == t.RegionID {
-							return Tag{
-								LangID:   t.LangID,
-								ScriptID: Script(parents[i].script),
-								RegionID: Region(parents[i].toRegion),
-							}
-						}
-					}
-				}
-			}
-
-			// Strip the script if it is the default one.
-			base, _ := addTags(Tag{LangID: t.LangID})
-			if base.ScriptID != maxScript {
-				return Tag{LangID: t.LangID, ScriptID: maxScript}
-			}
-			return Tag{LangID: t.LangID}
-		} else if t.ScriptID != 0 {
-			// The parent for an base-script pair with a non-default script is
-			// "und" instead of the base language.
-			base, _ := addTags(Tag{LangID: t.LangID})
-			if base.ScriptID != t.ScriptID {
-				return Und
-			}
-			return Tag{LangID: t.LangID}
-		}
-	}
-	return Und
-}
-
-// ParseExtension parses s as an extension and returns it on success.
-func ParseExtension(s string) (ext string, err error) {
-	defer func() {
-		if recover() != nil {
-			ext = ""
-			err = ErrSyntax
-		}
-	}()
-
-	scan := makeScannerString(s)
-	var end int
-	if n := len(scan.token); n != 1 {
-		return "", ErrSyntax
-	}
-	scan.toLower(0, len(scan.b))
-	end = parseExtension(&scan)
-	if end != len(s) {
-		return "", ErrSyntax
-	}
-	return string(scan.b), nil
-}
-
-// HasVariants reports whether t has variants.
-func (t Tag) HasVariants() bool {
-	return uint16(t.pVariant) < t.pExt
-}
-
-// HasExtensions reports whether t has extensions.
-func (t Tag) HasExtensions() bool {
-	return int(t.pExt) < len(t.str)
-}
-
-// Extension returns the extension of type x for tag t. It will return
-// false for ok if t does not have the requested extension. The returned
-// extension will be invalid in this case.
-func (t Tag) Extension(x byte) (ext string, ok bool) {
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		if ext[0] == x {
-			return ext, true
-		}
-	}
-	return "", false
-}
-
-// Extensions returns all extensions of t.
-func (t Tag) Extensions() []string {
-	e := []string{}
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		e = append(e, ext)
-	}
-	return e
-}
-
-// TypeForKey returns the type associated with the given key, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// TypeForKey will traverse the inheritance chain to get the correct value.
-//
-// If there are multiple types associated with a key, only the first will be
-// returned. If there is no type associated with a key, it returns the empty
-// string.
-func (t Tag) TypeForKey(key string) string {
-	if _, start, end, _ := t.findTypeForKey(key); end != start {
-		s := t.str[start:end]
-		if p := strings.IndexByte(s, '-'); p >= 0 {
-			s = s[:p]
-		}
-		return s
-	}
-	return ""
-}
-
-var (
-	errPrivateUse       = errors.New("cannot set a key on a private use tag")
-	errInvalidArguments = errors.New("invalid key or type")
-)
-
-// SetTypeForKey returns a new Tag with the key set to type, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// An empty value removes an existing pair with the same key.
-func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	if t.IsPrivateUse() {
-		return t, errPrivateUse
-	}
-	if len(key) != 2 {
-		return t, errInvalidArguments
-	}
-
-	// Remove the setting if value is "".
-	if value == "" {
-		start, sep, end, _ := t.findTypeForKey(key)
-		if start != sep {
-			// Remove a possible empty extension.
-			switch {
-			case t.str[start-2] != '-': // has previous elements.
-			case end == len(t.str), // end of string
-				end+2 < len(t.str) && t.str[end+2] == '-': // end of extension
-				start -= 2
-			}
-			if start == int(t.pVariant) && end == len(t.str) {
-				t.str = ""
-				t.pVariant, t.pExt = 0, 0
-			} else {
-				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
-			}
-		}
-		return t, nil
-	}
-
-	if len(value) < 3 || len(value) > 8 {
-		return t, errInvalidArguments
-	}
-
-	var (
-		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
-		uStart int // start of the -u extension.
-	)
-
-	// Generate the tag string if needed.
-	if t.str == "" {
-		uStart = t.genCoreBytes(buf[:])
-		buf[uStart] = '-'
-		uStart++
-	}
-
-	// Create new key-type pair and parse it to verify.
-	b := buf[uStart:]
-	copy(b, "u-")
-	copy(b[2:], key)
-	b[4] = '-'
-	b = b[:5+copy(b[5:], value)]
-	scan := makeScanner(b)
-	if parseExtensions(&scan); scan.err != nil {
-		return t, scan.err
-	}
-
-	// Assemble the replacement string.
-	if t.str == "" {
-		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
-		t.str = string(buf[:uStart+len(b)])
-	} else {
-		s := t.str
-		start, sep, end, hasExt := t.findTypeForKey(key)
-		if start == sep {
-			if hasExt {
-				b = b[2:]
-			}
-			t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:])
-		} else {
-			t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:])
-		}
-	}
-	return t, nil
-}
-
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) {
-	p := int(t.pExt)
-	if len(key) != 2 || p == len(t.str) || p == 0 {
-		return p, p, p, false
-	}
-	s := t.str
-
-	// Find the correct extension.
-	for p++; s[p] != 'u'; p++ {
-		if s[p] > 'u' {
-			p--
-			return p, p, p, false
-		}
-		if p = nextExtension(s, p); p == len(s) {
-			return len(s), len(s), len(s), false
-		}
-	}
-	// Proceed to the hyphen following the extension name.
-	p++
-
-	// curKey is the key currently being processed.
-	curKey := ""
-
-	// Iterate over keys until we get the end of a section.
-	for {
-		end = p
-		for p++; p < len(s) && s[p] != '-'; p++ {
-		}
-		n := p - end - 1
-		if n <= 2 && curKey == key {
-			if sep < end {
-				sep++
-			}
-			return start, sep, end, true
-		}
-		switch n {
-		case 0, // invalid string
-			1: // next extension
-			return end, end, end, true
-		case 2:
-			// next key
-			curKey = s[end+1 : p]
-			if curKey > key {
-				return end, end, end, true
-			}
-			start = end
-			sep = p
-		}
-	}
-}
-
-// ParseBase parses a 2- or 3-letter ISO 639 code.
-// It returns a ValueError if s is a well-formed but unknown language identifier
-// or another error if another error occurred.
-func ParseBase(s string) (l Language, err error) {
-	defer func() {
-		if recover() != nil {
-			l = 0
-			err = ErrSyntax
-		}
-	}()
-
-	if n := len(s); n < 2 || 3 < n {
-		return 0, ErrSyntax
-	}
-	var buf [3]byte
-	return getLangID(buf[:copy(buf[:], s)])
-}
-
-// ParseScript parses a 4-letter ISO 15924 code.
-// It returns a ValueError if s is a well-formed but unknown script identifier
-// or another error if another error occurred.
-func ParseScript(s string) (scr Script, err error) {
-	defer func() {
-		if recover() != nil {
-			scr = 0
-			err = ErrSyntax
-		}
-	}()
-
-	if len(s) != 4 {
-		return 0, ErrSyntax
-	}
-	var buf [4]byte
-	return getScriptID(script, buf[:copy(buf[:], s)])
-}
-
-// EncodeM49 returns the Region for the given UN M.49 code.
-// It returns an error if r is not a valid code.
-func EncodeM49(r int) (Region, error) {
-	return getRegionM49(r)
-}
-
-// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
-// It returns a ValueError if s is a well-formed but unknown region identifier
-// or another error if another error occurred.
-func ParseRegion(s string) (r Region, err error) {
-	defer func() {
-		if recover() != nil {
-			r = 0
-			err = ErrSyntax
-		}
-	}()
-
-	if n := len(s); n < 2 || 3 < n {
-		return 0, ErrSyntax
-	}
-	var buf [3]byte
-	return getRegionID(buf[:copy(buf[:], s)])
-}
-
-// IsCountry returns whether this region is a country or autonomous area. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsCountry() bool {
-	if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
-		return false
-	}
-	return true
-}
-
-// IsGroup returns whether this region defines a collection of regions. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsGroup() bool {
-	if r == 0 {
-		return false
-	}
-	return int(regionInclusion[r]) < len(regionContainment)
-}
-
-// Contains returns whether Region c is contained by Region r. It returns true
-// if c == r.
-func (r Region) Contains(c Region) bool {
-	if r == c {
-		return true
-	}
-	g := regionInclusion[r]
-	if g >= nRegionGroups {
-		return false
-	}
-	m := regionContainment[g]
-
-	d := regionInclusion[c]
-	b := regionInclusionBits[d]
-
-	// A contained country may belong to multiple disjoint groups. Matching any
-	// of these indicates containment. If the contained region is a group, it
-	// must strictly be a subset.
-	if d >= nRegionGroups {
-		return b&m != 0
-	}
-	return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
-// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
-// In all other cases it returns either the region itself or an error.
-//
-// This method may return an error for a region for which there exists a
-// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
-// region will already be canonicalized it was obtained from a Tag that was
-// obtained using any of the default methods.
-func (r Region) TLD() (Region, error) {
-	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
-	// difference between ISO 3166-1 and IANA ccTLD.
-	if r == _GB {
-		r = _UK
-	}
-	if (r.typ() & ccTLD) == 0 {
-		return 0, errNoTLD
-	}
-	return r, nil
-}
-
-// Canonicalize returns the region or a possible replacement if the region is
-// deprecated. It will not return a replacement for deprecated regions that
-// are split into multiple regions.
-func (r Region) Canonicalize() Region {
-	if cr := normRegion(r); cr != 0 {
-		return cr
-	}
-	return r
-}
-
-// Variant represents a registered variant of a language as defined by BCP 47.
-type Variant struct {
-	ID  uint8
-	str string
-}
-
-// ParseVariant parses and returns a Variant. An error is returned if s is not
-// a valid variant.
-func ParseVariant(s string) (v Variant, err error) {
-	defer func() {
-		if recover() != nil {
-			v = Variant{}
-			err = ErrSyntax
-		}
-	}()
-
-	s = strings.ToLower(s)
-	if id, ok := variantIndex[s]; ok {
-		return Variant{id, s}, nil
-	}
-	return Variant{}, NewValueError([]byte(s))
-}
-
-// String returns the string representation of the variant.
-func (v Variant) String() string {
-	return v.str
-}
diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
deleted file mode 100644
index 6294b81524..0000000000
--- a/vendor/golang.org/x/text/internal/language/lookup.go
+++ /dev/null
@@ -1,412 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"bytes"
-	"fmt"
-	"sort"
-	"strconv"
-
-	"golang.org/x/text/internal/tag"
-)
-
-// findIndex tries to find the given tag in idx and returns a standardized error
-// if it could not be found.
-func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
-	if !tag.FixCase(form, key) {
-		return 0, ErrSyntax
-	}
-	i := idx.Index(key)
-	if i == -1 {
-		return 0, NewValueError(key)
-	}
-	return i, nil
-}
-
-func searchUint(imap []uint16, key uint16) int {
-	return sort.Search(len(imap), func(i int) bool {
-		return imap[i] >= key
-	})
-}
-
-type Language uint16
-
-// getLangID returns the langID of s if s is a canonical subtag
-// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (Language, error) {
-	if len(s) == 2 {
-		return getLangISO2(s)
-	}
-	return getLangISO3(s)
-}
-
-// TODO language normalization as well as the AliasMaps could be moved to the
-// higher level package, but it is a bit tricky to separate the generation.
-
-func (id Language) Canonicalize() (Language, AliasType) {
-	return normLang(id)
-}
-
-// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id Language) (Language, AliasType) {
-	k := sort.Search(len(AliasMap), func(i int) bool {
-		return AliasMap[i].From >= uint16(id)
-	})
-	if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
-		return Language(AliasMap[k].To), AliasTypes[k]
-	}
-	return id, AliasTypeUnknown
-}
-
-// getLangISO2 returns the langID for the given 2-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (Language, error) {
-	if !tag.FixCase("zz", s) {
-		return 0, ErrSyntax
-	}
-	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
-		return Language(i), nil
-	}
-	return 0, NewValueError(s)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s []byte) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-// getLangISO3 returns the langID for the given 3-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (Language, error) {
-	if tag.FixCase("und", s) {
-		// first try to match canonical 3-letter entries
-		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
-			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
-				// We treat "und" as special and always translate it to "unspecified".
-				// Note that ZZ and Zzzz are private use and are not treated as
-				// unspecified by default.
-				id := Language(i)
-				if id == nonCanonicalUnd {
-					return 0, nil
-				}
-				return id, nil
-			}
-		}
-		if i := altLangISO3.Index(s); i != -1 {
-			return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
-		}
-		n := strToInt(s)
-		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
-			return Language(n) + langNoIndexOffset, nil
-		}
-		// Check for non-canonical uses of ISO3.
-		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
-			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return Language(i), nil
-			}
-		}
-		return 0, NewValueError(s)
-	}
-	return 0, ErrSyntax
-}
-
-// StringToBuf writes the string to b and returns the number of bytes
-// written.  cap(b) must be >= 3.
-func (id Language) StringToBuf(b []byte) int {
-	if id >= langNoIndexOffset {
-		intToStr(uint(id)-langNoIndexOffset, b[:3])
-		return 3
-	} else if id == 0 {
-		return copy(b, "und")
-	}
-	l := lang[id<<2:]
-	if l[3] == 0 {
-		return copy(b, l[:3])
-	}
-	return copy(b, l[:2])
-}
-
-// String returns the BCP 47 representation of the langID.
-// Use b as variable name, instead of id, to ensure the variable
-// used is consistent with that of Base in which this type is embedded.
-func (b Language) String() string {
-	if b == 0 {
-		return "und"
-	} else if b >= langNoIndexOffset {
-		b -= langNoIndexOffset
-		buf := [3]byte{}
-		intToStr(uint(b), buf[:])
-		return string(buf[:])
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	}
-	return l[:2]
-}
-
-// ISO3 returns the ISO 639-3 language code.
-func (b Language) ISO3() string {
-	if b == 0 || b >= langNoIndexOffset {
-		return b.String()
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	} else if l[2] == 0 {
-		return altLangISO3.Elem(int(l[3]))[:3]
-	}
-	// This allocation will only happen for 3-letter ISO codes
-	// that are non-canonical BCP 47 language identifiers.
-	return l[0:1] + l[2:4]
-}
-
-// IsPrivateUse reports whether this language code is reserved for private use.
-func (b Language) IsPrivateUse() bool {
-	return langPrivateStart <= b && b <= langPrivateEnd
-}
-
-// SuppressScript returns the script marked as SuppressScript in the IANA
-// language tag repository, or 0 if there is no such script.
-func (b Language) SuppressScript() Script {
-	if b < langNoIndexOffset {
-		return Script(suppressScript[b])
-	}
-	return 0
-}
-
-type Region uint16
-
-// getRegionID returns the region id for s if s is a valid 2-letter region code
-// or unknownRegion.
-func getRegionID(s []byte) (Region, error) {
-	if len(s) == 3 {
-		if isAlpha(s[0]) {
-			return getRegionISO3(s)
-		}
-		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
-			return getRegionM49(int(i))
-		}
-	}
-	return getRegionISO2(s)
-}
-
-// getRegionISO2 returns the regionID for the given 2-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (Region, error) {
-	i, err := findIndex(regionISO, s, "ZZ")
-	if err != nil {
-		return 0, err
-	}
-	return Region(i) + isoRegionOffset, nil
-}
-
-// getRegionISO3 returns the regionID for the given 3-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (Region, error) {
-	if tag.FixCase("ZZZ", s) {
-		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
-			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return Region(i) + isoRegionOffset, nil
-			}
-		}
-		for i := 0; i < len(altRegionISO3); i += 3 {
-			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
-				return Region(altRegionIDs[i/3]), nil
-			}
-		}
-		return 0, NewValueError(s)
-	}
-	return 0, ErrSyntax
-}
-
-func getRegionM49(n int) (Region, error) {
-	if 0 < n && n <= 999 {
-		const (
-			searchBits = 7
-			regionBits = 9
-			regionMask = 1<<regionBits - 1
-		)
-		idx := n >> searchBits
-		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
-		val := uint16(n) << regionBits // we rely on bits shifting out
-		i := sort.Search(len(buf), func(i int) bool {
-			return buf[i] >= val
-		})
-		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
-			return Region(r & regionMask), nil
-		}
-	}
-	var e ValueError
-	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
-	return 0, e
-}
-
-// normRegion returns a region if r is deprecated or 0 otherwise.
-// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
-// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r Region) Region {
-	m := regionOldMap
-	k := sort.Search(len(m), func(i int) bool {
-		return m[i].From >= uint16(r)
-	})
-	if k < len(m) && m[k].From == uint16(r) {
-		return Region(m[k].To)
-	}
-	return 0
-}
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func (r Region) typ() byte {
-	return regionTypes[r]
-}
-
-// String returns the BCP 47 representation for the region.
-// It returns "ZZ" for an unspecified region.
-func (r Region) String() string {
-	if r < isoRegionOffset {
-		if r == 0 {
-			return "ZZ"
-		}
-		return fmt.Sprintf("%03d", r.M49())
-	}
-	r -= isoRegionOffset
-	return regionISO.Elem(int(r))[:2]
-}
-
-// ISO3 returns the 3-letter ISO code of r.
-// Note that not all regions have a 3-letter ISO code.
-// In such cases this method returns "ZZZ".
-func (r Region) ISO3() string {
-	if r < isoRegionOffset {
-		return "ZZZ"
-	}
-	r -= isoRegionOffset
-	reg := regionISO.Elem(int(r))
-	switch reg[2] {
-	case 0:
-		return altRegionISO3[reg[3]:][:3]
-	case ' ':
-		return "ZZZ"
-	}
-	return reg[0:1] + reg[2:4]
-}
-
-// M49 returns the UN M.49 encoding of r, or 0 if this encoding
-// is not defined for r.
-func (r Region) M49() int {
-	return int(m49[r])
-}
-
-// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
-// may include private-use tags that are assigned by CLDR and used in this
-// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r Region) IsPrivateUse() bool {
-	return r.typ()&iso3166UserAssigned != 0
-}
-
-type Script uint8
-
-// getScriptID returns the script id for string s. It assumes that s
-// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (Script, error) {
-	i, err := findIndex(idx, s, "Zzzz")
-	return Script(i), err
-}
-
-// String returns the script code in title case.
-// It returns "Zzzz" for an unspecified script.
-func (s Script) String() string {
-	if s == 0 {
-		return "Zzzz"
-	}
-	return script.Elem(int(s))
-}
-
-// IsPrivateUse reports whether this script code is reserved for private use.
-func (s Script) IsPrivateUse() bool {
-	return _Qaaa <= s && s <= _Qabx
-}
-
-const (
-	maxAltTaglen = len("en-US-POSIX")
-	maxLen       = maxAltTaglen
-)
-
-var (
-	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
-	// their base language or index to more elaborate tag.
-	grandfatheredMap = map[[maxLen]byte]int16{
-		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
-		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
-		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
-		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
-		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
-		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
-		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
-		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
-		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
-		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
-		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
-		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
-		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
-		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
-		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
-		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
-		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
-
-		// Grandfathered tags with no modern replacement will be converted as
-		// follows:
-		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
-		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
-		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
-		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
-		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
-
-		// CLDR-specific tag.
-		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
-		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
-	}
-
-	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
-
-	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
-)
-
-func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
-	if v, ok := grandfatheredMap[s]; ok {
-		if v < 0 {
-			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
-		}
-		t.LangID = Language(v)
-		return t, true
-	}
-	return t, false
-}
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
deleted file mode 100644
index 75a2dbca76..0000000000
--- a/vendor/golang.org/x/text/internal/language/match.go
+++ /dev/null
@@ -1,226 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import "errors"
-
-type scriptRegionFlags uint8
-
-const (
-	isList = 1 << iota
-	scriptInFrom
-	regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id Language) {
-	if t.LangID == 0 {
-		t.LangID = id
-	}
-}
-
-func (t *Tag) setUndefinedScript(id Script) {
-	if t.ScriptID == 0 {
-		t.ScriptID = id
-	}
-}
-
-func (t *Tag) setUndefinedRegion(id Region) {
-	if t.RegionID == 0 || t.RegionID.Contains(id) {
-		t.RegionID = id
-	}
-}
-
-// ErrMissingLikelyTagsData indicates no information was available
-// to compute likely values of missing tags.
-var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
-	id, err := addTags(t)
-	if err != nil {
-		return t, err
-	} else if id.equalTags(t) {
-		return t, nil
-	}
-	id.RemakeString()
-	return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
-	if i := regionInclusion[t.RegionID]; i < nRegionGroups {
-		x := likelyRegionGroup[i]
-		if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
-			t.RegionID = Region(x.region)
-		}
-		return true
-	}
-	return false
-}
-
-// Maximize returns a new tag with missing tags filled in.
-func (t Tag) Maximize() (Tag, error) {
-	return addTags(t)
-}
-
-func addTags(t Tag) (Tag, error) {
-	// We leave private use identifiers alone.
-	if t.IsPrivateUse() {
-		return t, nil
-	}
-	if t.ScriptID != 0 && t.RegionID != 0 {
-		if t.LangID != 0 {
-			// already fully specified
-			specializeRegion(&t)
-			return t, nil
-		}
-		// Search matches for und-script-region. Note that for these cases
-		// region will never be a group so there is no need to check for this.
-		list := likelyRegion[t.RegionID : t.RegionID+1]
-		if x := list[0]; x.flags&isList != 0 {
-			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
-		}
-		for _, x := range list {
-			// Deviating from the spec. See match_test.go for details.
-			if Script(x.script) == t.ScriptID {
-				t.setUndefinedLang(Language(x.lang))
-				return t, nil
-			}
-		}
-	}
-	if t.LangID != 0 {
-		// Search matches for lang-script and lang-region, where lang != und.
-		if t.LangID < langNoIndexOffset {
-			x := likelyLang[t.LangID]
-			if x.flags&isList != 0 {
-				list := likelyLangList[x.region : x.region+uint16(x.script)]
-				if t.ScriptID != 0 {
-					for _, x := range list {
-						if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
-							t.setUndefinedRegion(Region(x.region))
-							return t, nil
-						}
-					}
-				} else if t.RegionID != 0 {
-					count := 0
-					goodScript := true
-					tt := t
-					for _, x := range list {
-						// We visit all entries for which the script was not
-						// defined, including the ones where the region was not
-						// defined. This allows for proper disambiguation within
-						// regions.
-						if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
-							tt.RegionID = Region(x.region)
-							tt.setUndefinedScript(Script(x.script))
-							goodScript = goodScript && tt.ScriptID == Script(x.script)
-							count++
-						}
-					}
-					if count == 1 {
-						return tt, nil
-					}
-					// Even if we fail to find a unique Region, we might have
-					// an unambiguous script.
-					if goodScript {
-						t.ScriptID = tt.ScriptID
-					}
-				}
-			}
-		}
-	} else {
-		// Search matches for und-script.
-		if t.ScriptID != 0 {
-			x := likelyScript[t.ScriptID]
-			if x.region != 0 {
-				t.setUndefinedRegion(Region(x.region))
-				t.setUndefinedLang(Language(x.lang))
-				return t, nil
-			}
-		}
-		// Search matches for und-region. If und-script-region exists, it would
-		// have been found earlier.
-		if t.RegionID != 0 {
-			if i := regionInclusion[t.RegionID]; i < nRegionGroups {
-				x := likelyRegionGroup[i]
-				if x.region != 0 {
-					t.setUndefinedLang(Language(x.lang))
-					t.setUndefinedScript(Script(x.script))
-					t.RegionID = Region(x.region)
-				}
-			} else {
-				x := likelyRegion[t.RegionID]
-				if x.flags&isList != 0 {
-					x = likelyRegionList[x.lang]
-				}
-				if x.script != 0 && x.flags != scriptInFrom {
-					t.setUndefinedLang(Language(x.lang))
-					t.setUndefinedScript(Script(x.script))
-					return t, nil
-				}
-			}
-		}
-	}
-
-	// Search matches for lang.
-	if t.LangID < langNoIndexOffset {
-		x := likelyLang[t.LangID]
-		if x.flags&isList != 0 {
-			x = likelyLangList[x.region]
-		}
-		if x.region != 0 {
-			t.setUndefinedScript(Script(x.script))
-			t.setUndefinedRegion(Region(x.region))
-		}
-		specializeRegion(&t)
-		if t.LangID == 0 {
-			t.LangID = _en // default language
-		}
-		return t, nil
-	}
-	return t, ErrMissingLikelyTagsData
-}
-
-func (t *Tag) setTagsFrom(id Tag) {
-	t.LangID = id.LangID
-	t.ScriptID = id.ScriptID
-	t.RegionID = id.RegionID
-}
-
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
-	t, err := minimizeTags(t)
-	if err != nil {
-		return t, err
-	}
-	t.RemakeString()
-	return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
-	if t.equalTags(Und) {
-		return t, nil
-	}
-	max, err := addTags(t)
-	if err != nil {
-		return t, err
-	}
-	for _, id := range [...]Tag{
-		{LangID: t.LangID},
-		{LangID: t.LangID, RegionID: t.RegionID},
-		{LangID: t.LangID, ScriptID: t.ScriptID},
-	} {
-		if x, err := addTags(id); err == nil && max.equalTags(x) {
-			t.setTagsFrom(id)
-			break
-		}
-	}
-	return t, nil
-}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
deleted file mode 100644
index 47ee0fed17..0000000000
--- a/vendor/golang.org/x/text/internal/language/parse.go
+++ /dev/null
@@ -1,604 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"bytes"
-	"errors"
-	"fmt"
-	"sort"
-
-	"golang.org/x/text/internal/tag"
-)
-
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
-	return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
-	for _, c := range s {
-		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
-			return false
-		}
-	}
-	return true
-}
-
-// ErrSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var ErrSyntax = errors.New("language: tag is not well-formed")
-
-// ErrDuplicateKey is returned when a tag contains the same key twice with
-// different values in the -u section.
-var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
-
-// ValueError is returned by any of the parsing functions when the
-// input is well-formed but the respective subtag is not recognized
-// as a valid value.
-type ValueError struct {
-	v [8]byte
-}
-
-// NewValueError creates a new ValueError.
-func NewValueError(tag []byte) ValueError {
-	var e ValueError
-	copy(e.v[:], tag)
-	return e
-}
-
-func (e ValueError) tag() []byte {
-	n := bytes.IndexByte(e.v[:], 0)
-	if n == -1 {
-		n = 8
-	}
-	return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
-	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
-	return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
-	b     []byte
-	bytes [max99thPercentileSize]byte
-	token []byte
-	start int // start position of the current token
-	end   int // end position of the current token
-	next  int // next point for scan
-	err   error
-	done  bool
-}
-
-func makeScannerString(s string) scanner {
-	scan := scanner{}
-	if len(s) <= len(scan.bytes) {
-		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
-	} else {
-		scan.b = []byte(s)
-	}
-	scan.init()
-	return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
-	scan := scanner{b: b}
-	scan.init()
-	return scan
-}
-
-func (s *scanner) init() {
-	for i, c := range s.b {
-		if c == '_' {
-			s.b[i] = '-'
-		}
-	}
-	s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
-	for i := start; i < end; i++ {
-		c := s.b[i]
-		if 'A' <= c && c <= 'Z' {
-			s.b[i] += 'a' - 'A'
-		}
-	}
-}
-
-func (s *scanner) setError(e error) {
-	if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
-		s.err = e
-	}
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
-	s.start = oldStart
-	if end := oldStart + newSize; end != oldEnd {
-		diff := end - oldEnd
-		var b []byte
-		if n := len(s.b) + diff; n > cap(s.b) {
-			b = make([]byte, n)
-			copy(b, s.b[:oldStart])
-		} else {
-			b = s.b[:n]
-		}
-		copy(b[end:], s.b[oldEnd:])
-		s.b = b
-		s.next = end + (s.next - s.end)
-		s.end = end
-	}
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
-	s.resizeRange(s.start, s.end, len(repl))
-	copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
-	s.setError(e)
-	if s.start == 0 {
-		s.b = s.b[:+copy(s.b, s.b[s.next:])]
-		s.end = 0
-	} else {
-		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
-		s.end = s.start - 1
-	}
-	s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
-	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
-	diff := end - start
-	s.next -= diff
-	s.start -= diff
-	s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string.  Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
-	end = s.end
-	s.token = nil
-	for s.start = s.next; s.next < len(s.b); {
-		i := bytes.IndexByte(s.b[s.next:], '-')
-		if i == -1 {
-			s.end = len(s.b)
-			s.next = len(s.b)
-			i = s.end - s.start
-		} else {
-			s.end = s.next + i
-			s.next = s.end + 1
-		}
-		token := s.b[s.start:s.end]
-		if i < 1 || i > 8 || !isAlphaNum(token) {
-			s.gobble(ErrSyntax)
-			continue
-		}
-		s.token = token
-		return end
-	}
-	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
-		s.setError(ErrSyntax)
-		s.b = s.b[:len(s.b)-1]
-	}
-	s.done = true
-	return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
-	end = s.end
-	s.scan()
-	for ; len(s.token) >= min; s.scan() {
-		end = s.end
-	}
-	return end
-}
-
-// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
-// failed it returns an error and any part of the tag that could be parsed.
-// If parsing succeeded but an unknown value was found, it returns
-// ValueError. The Tag returned in this case is just stripped of the unknown
-// value. All other values are preserved. It accepts tags in the BCP 47 format
-// and extensions to this standard defined in
-// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-func Parse(s string) (t Tag, err error) {
-	// TODO: consider supporting old-style locale key-value pairs.
-	if s == "" {
-		return Und, ErrSyntax
-	}
-	defer func() {
-		if recover() != nil {
-			t = Und
-			err = ErrSyntax
-			return
-		}
-	}()
-	if len(s) <= maxAltTaglen {
-		b := [maxAltTaglen]byte{}
-		for i, c := range s {
-			// Generating invalid UTF-8 is okay as it won't match.
-			if 'A' <= c && c <= 'Z' {
-				c += 'a' - 'A'
-			} else if c == '_' {
-				c = '-'
-			}
-			b[i] = byte(c)
-		}
-		if t, ok := grandfathered(b); ok {
-			return t, nil
-		}
-	}
-	scan := makeScannerString(s)
-	return parse(&scan, s)
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
-	t = Und
-	var end int
-	if n := len(scan.token); n <= 1 {
-		scan.toLower(0, len(scan.b))
-		if n == 0 || scan.token[0] != 'x' {
-			return t, ErrSyntax
-		}
-		end = parseExtensions(scan)
-	} else if n >= 4 {
-		return Und, ErrSyntax
-	} else { // the usual case
-		t, end = parseTag(scan)
-		if n := len(scan.token); n == 1 {
-			t.pExt = uint16(end)
-			end = parseExtensions(scan)
-		} else if end < len(scan.b) {
-			scan.setError(ErrSyntax)
-			scan.b = scan.b[:end]
-		}
-	}
-	if int(t.pVariant) < len(scan.b) {
-		if end < len(s) {
-			s = s[:end]
-		}
-		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
-			t.str = s
-		} else {
-			t.str = string(scan.b)
-		}
-	} else {
-		t.pVariant, t.pExt = 0, 0
-	}
-	return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
-	var e error
-	// TODO: set an error if an unknown lang, script or region is encountered.
-	t.LangID, e = getLangID(scan.token)
-	scan.setError(e)
-	scan.replace(t.LangID.String())
-	langStart := scan.start
-	end = scan.scan()
-	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
-		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
-		// to a tag of the form <extlang>.
-		lang, e := getLangID(scan.token)
-		if lang != 0 {
-			t.LangID = lang
-			copy(scan.b[langStart:], lang.String())
-			scan.b[langStart+3] = '-'
-			scan.start = langStart + 4
-		}
-		scan.gobble(e)
-		end = scan.scan()
-	}
-	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
-		t.ScriptID, e = getScriptID(script, scan.token)
-		if t.ScriptID == 0 {
-			scan.gobble(e)
-		}
-		end = scan.scan()
-	}
-	if n := len(scan.token); n >= 2 && n <= 3 {
-		t.RegionID, e = getRegionID(scan.token)
-		if t.RegionID == 0 {
-			scan.gobble(e)
-		} else {
-			scan.replace(t.RegionID.String())
-		}
-		end = scan.scan()
-	}
-	scan.toLower(scan.start, len(scan.b))
-	t.pVariant = byte(end)
-	end = parseVariants(scan, end, t)
-	t.pExt = uint16(end)
-	return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
-	start := scan.start
-	varIDBuf := [4]uint8{}
-	variantBuf := [4][]byte{}
-	varID := varIDBuf[:0]
-	variant := variantBuf[:0]
-	last := -1
-	needSort := false
-	for ; len(scan.token) >= 4; scan.scan() {
-		// TODO: measure the impact of needing this conversion and redesign
-		// the data structure if there is an issue.
-		v, ok := variantIndex[string(scan.token)]
-		if !ok {
-			// unknown variant
-			// TODO: allow user-defined variants?
-			scan.gobble(NewValueError(scan.token))
-			continue
-		}
-		varID = append(varID, v)
-		variant = append(variant, scan.token)
-		if !needSort {
-			if last < int(v) {
-				last = int(v)
-			} else {
-				needSort = true
-				// There is no legal combinations of more than 7 variants
-				// (and this is by no means a useful sequence).
-				const maxVariants = 8
-				if len(varID) > maxVariants {
-					break
-				}
-			}
-		}
-		end = scan.end
-	}
-	if needSort {
-		sort.Sort(variantsSort{varID, variant})
-		k, l := 0, -1
-		for i, v := range varID {
-			w := int(v)
-			if l == w {
-				// Remove duplicates.
-				continue
-			}
-			varID[k] = varID[i]
-			variant[k] = variant[i]
-			k++
-			l = w
-		}
-		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
-			end = start - 1
-		} else {
-			scan.resizeRange(start, end, len(str))
-			copy(scan.b[scan.start:], str)
-			end = scan.end
-		}
-	}
-	return end
-}
-
-type variantsSort struct {
-	i []uint8
-	v [][]byte
-}
-
-func (s variantsSort) Len() int {
-	return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
-	s.i[i], s.i[j] = s.i[j], s.i[i]
-	s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
-	return s.i[i] < s.i[j]
-}
-
-type bytesSort struct {
-	b [][]byte
-	n int // first n bytes to compare
-}
-
-func (b bytesSort) Len() int {
-	return len(b.b)
-}
-
-func (b bytesSort) Swap(i, j int) {
-	b.b[i], b.b[j] = b.b[j], b.b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
-	for k := 0; k < b.n; k++ {
-		if b.b[i][k] == b.b[j][k] {
-			continue
-		}
-		return b.b[i][k] < b.b[j][k]
-	}
-	return false
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
-	start := scan.start
-	exts := [][]byte{}
-	private := []byte{}
-	end := scan.end
-	for len(scan.token) == 1 {
-		extStart := scan.start
-		ext := scan.token[0]
-		end = parseExtension(scan)
-		extension := scan.b[extStart:end]
-		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
-			scan.setError(ErrSyntax)
-			end = extStart
-			continue
-		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
-			scan.b = scan.b[:end]
-			return end
-		} else if ext == 'x' {
-			private = extension
-			break
-		}
-		exts = append(exts, extension)
-	}
-	sort.Sort(bytesSort{exts, 1})
-	if len(private) > 0 {
-		exts = append(exts, private)
-	}
-	scan.b = scan.b[:start]
-	if len(exts) > 0 {
-		scan.b = append(scan.b, bytes.Join(exts, separator)...)
-	} else if start > 0 {
-		// Strip trailing '-'.
-		scan.b = scan.b[:start-1]
-	}
-	return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
-	start, end := scan.start, scan.end
-	switch scan.token[0] {
-	case 'u': // https://www.ietf.org/rfc/rfc6067.txt
-		attrStart := end
-		scan.scan()
-		for last := []byte{}; len(scan.token) > 2; scan.scan() {
-			if bytes.Compare(scan.token, last) != -1 {
-				// Attributes are unsorted. Start over from scratch.
-				p := attrStart + 1
-				scan.next = p
-				attrs := [][]byte{}
-				for scan.scan(); len(scan.token) > 2; scan.scan() {
-					attrs = append(attrs, scan.token)
-					end = scan.end
-				}
-				sort.Sort(bytesSort{attrs, 3})
-				copy(scan.b[p:], bytes.Join(attrs, separator))
-				break
-			}
-			last = scan.token
-			end = scan.end
-		}
-		// Scan key-type sequences. A key is of length 2 and may be followed
-		// by 0 or more "type" subtags from 3 to the maximum of 8 letters.
-		var last, key []byte
-		for attrEnd := end; len(scan.token) == 2; last = key {
-			key = scan.token
-			end = scan.end
-			for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
-				end = scan.end
-			}
-			// TODO: check key value validity
-			if bytes.Compare(key, last) != 1 || scan.err != nil {
-				// We have an invalid key or the keys are not sorted.
-				// Start scanning keys from scratch and reorder.
-				p := attrEnd + 1
-				scan.next = p
-				keys := [][]byte{}
-				for scan.scan(); len(scan.token) == 2; {
-					keyStart := scan.start
-					end = scan.end
-					for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
-						end = scan.end
-					}
-					keys = append(keys, scan.b[keyStart:end])
-				}
-				sort.Stable(bytesSort{keys, 2})
-				if n := len(keys); n > 0 {
-					k := 0
-					for i := 1; i < n; i++ {
-						if !bytes.Equal(keys[k][:2], keys[i][:2]) {
-							k++
-							keys[k] = keys[i]
-						} else if !bytes.Equal(keys[k], keys[i]) {
-							scan.setError(ErrDuplicateKey)
-						}
-					}
-					keys = keys[:k+1]
-				}
-				reordered := bytes.Join(keys, separator)
-				if e := p + len(reordered); e < end {
-					scan.deleteRange(e, end)
-					end = e
-				}
-				copy(scan.b[p:], reordered)
-				break
-			}
-		}
-	case 't': // https://www.ietf.org/rfc/rfc6497.txt
-		scan.scan()
-		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
-			_, end = parseTag(scan)
-			scan.toLower(start, end)
-		}
-		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
-			end = scan.acceptMinSize(3)
-		}
-	case 'x':
-		end = scan.acceptMinSize(1)
-	default:
-		end = scan.acceptMinSize(2)
-	}
-	return end
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
-	if s[p] == '-' {
-		p++
-	}
-	if s[p] == 'x' {
-		return len(s), s[p:]
-	}
-	end = nextExtension(s, p)
-	return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
-	for n := len(s) - 3; p < n; {
-		if s[p] == '-' {
-			if s[p+2] == '-' {
-				return p
-			}
-			p += 3
-		} else {
-			p++
-		}
-	}
-	return len(s)
-}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
deleted file mode 100644
index a19480c5ba..0000000000
--- a/vendor/golang.org/x/text/internal/language/tables.go
+++ /dev/null
@@ -1,3464 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-import "golang.org/x/text/internal/tag"
-
-// CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "32"
-
-const NumLanguages = 8717
-
-const NumScripts = 251
-
-const NumRegions = 357
-
-type FromTo struct {
-	From uint16
-	To   uint16
-}
-
-const nonCanonicalUnd = 1201
-const (
-	_af  = 22
-	_am  = 39
-	_ar  = 58
-	_az  = 88
-	_bg  = 126
-	_bn  = 165
-	_ca  = 215
-	_cs  = 250
-	_da  = 257
-	_de  = 269
-	_el  = 310
-	_en  = 313
-	_es  = 318
-	_et  = 320
-	_fa  = 328
-	_fi  = 337
-	_fil = 339
-	_fr  = 350
-	_gu  = 420
-	_he  = 444
-	_hi  = 446
-	_hr  = 465
-	_hu  = 469
-	_hy  = 471
-	_id  = 481
-	_is  = 504
-	_it  = 505
-	_ja  = 512
-	_ka  = 528
-	_kk  = 578
-	_km  = 586
-	_kn  = 593
-	_ko  = 596
-	_ky  = 650
-	_lo  = 696
-	_lt  = 704
-	_lv  = 711
-	_mk  = 767
-	_ml  = 772
-	_mn  = 779
-	_mo  = 784
-	_mr  = 795
-	_ms  = 799
-	_mul = 806
-	_my  = 817
-	_nb  = 839
-	_ne  = 849
-	_nl  = 871
-	_no  = 879
-	_pa  = 925
-	_pl  = 947
-	_pt  = 960
-	_ro  = 988
-	_ru  = 994
-	_sh  = 1031
-	_si  = 1036
-	_sk  = 1042
-	_sl  = 1046
-	_sq  = 1073
-	_sr  = 1074
-	_sv  = 1092
-	_sw  = 1093
-	_ta  = 1104
-	_te  = 1121
-	_th  = 1131
-	_tl  = 1146
-	_tn  = 1152
-	_tr  = 1162
-	_uk  = 1198
-	_ur  = 1204
-	_uz  = 1212
-	_vi  = 1219
-	_zh  = 1321
-	_zu  = 1327
-	_jbo = 515
-	_ami = 1650
-	_bnn = 2357
-	_hak = 438
-	_tlh = 14467
-	_lb  = 661
-	_nv  = 899
-	_pwn = 12055
-	_tao = 14188
-	_tay = 14198
-	_tsu = 14662
-	_nn  = 874
-	_sfb = 13629
-	_vgt = 15701
-	_sgg = 13660
-	_cmn = 3007
-	_nan = 835
-	_hsn = 467
-)
-
-const langPrivateStart = 0x2f72
-
-const langPrivateEnd = 0x3179
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-//     - if the first letter of the 2- and 3-letter ISO codes are the same:
-//       the second and third letter of the 3-letter ISO code.
-//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5324 bytes
-	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
-	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
-	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
-	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
-	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
-	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
-	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
-	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
-	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
-	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
-	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
-	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
-	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
-	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
-	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
-	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
-	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
-	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
-	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
-	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
-	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
-	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
-	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
-	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
-	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
-	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
-	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
-	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
-	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
-	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
-	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
-	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
-	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
-	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
-	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
-	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
-	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
-	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
-	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
-	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
-	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
-	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
-	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
-	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
-	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
-	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
-	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
-	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
-	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
-	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
-	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
-	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
-	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
-	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
-	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
-	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
-	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
-	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
-	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
-	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
-	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
-	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
-	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
-	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
-	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
-	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
-	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
-	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
-	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
-	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
-	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
-	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
-	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
-	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
-	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
-	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
-	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
-	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
-	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
-	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
-	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
-	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
-	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
-	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
-	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
-	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
-	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
-	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
-	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
-	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
-	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
-	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
-	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
-	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
-	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
-	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
-	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
-	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
-	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
-	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
-	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
-	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
-	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
-	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
-	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
-	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
-	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
-	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
-	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
-	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
-	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
-	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
-	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
-	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
-	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
-	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
-	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
-	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
-	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
-	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
-	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
-	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
-	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
-	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1330
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
-	// Entry 0 - 3F
-	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
-	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
-	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
-	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
-	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
-	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
-	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
-	// Entry 40 - 7F
-	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
-	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
-	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
-	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
-	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
-	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
-	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
-	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
-	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
-	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
-	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
-	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
-	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
-	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
-	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
-	0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
-	// Entry C0 - FF
-	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
-	0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56,
-	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef,
-	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
-	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x73, 0x35,
-	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
-	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
-	// Entry 100 - 13F
-	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
-	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
-	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
-	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
-	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f,
-	0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
-	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
-	// Entry 140 - 17F
-	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16,
-	0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
-	0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09,
-	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
-	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
-	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
-	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
-	// Entry 180 - 1BF
-	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
-	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
-	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
-	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
-	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
-	// Entry 200 - 23F
-	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
-	0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
-	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
-	0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x01, 0xe3,
-	0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
-	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
-	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
-	// Entry 240 - 27F
-	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
-	0x20, 0x7b, 0x78, 0x02, 0x05, 0x84, 0x00, 0xf0,
-	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
-	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
-	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
-	0x11, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
-	0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66,
-	// Entry 280 - 2BF
-	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
-	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
-	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
-	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
-	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
-	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
-	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
-	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
-	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
-	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
-	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
-	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
-	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
-	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
-	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
-	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
-	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
-	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
-	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
-	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
-	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
-	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
-	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
-	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
-	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
-	// Entry 380 - 3BF
-	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
-	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
-	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
-	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
-	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
-	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
-	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
-	// Entry 3C0 - 3FF
-	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
-	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xf9, 0x2e, 0x11,
-	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01,
-	0x05, 0xd1, 0x50, 0x5c, 0x00, 0x00, 0x00, 0x10,
-	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
-	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
-	// Entry 400 - 43F
-	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
-	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
-	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
-	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
-	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
-	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
-	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
-	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
-	// Entry 440 - 47F
-	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
-	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
-	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
-	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
-	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
-	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd,
-	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
-	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
-	// Entry 480 - 4BF
-	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb,
-	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05,
-	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
-	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
-	// Entry 4C0 - 4FF
-	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
-	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
-	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
-	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
-	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
-	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
-	0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
-	// Entry 500 - 53F
-	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
-	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
-	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7,
-	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
-	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
-	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
-	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
-	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	// Entry 580 - 5BF
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
-	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
-	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
-	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
-	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
-	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
-	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
-	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
-	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
-	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
-	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
-	0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe,
-	// Entry 600 - 63F
-	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
-	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
-	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
-	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
-	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
-	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
-	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
-	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
-	// Entry 640 - 67F
-	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c,
-	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
-	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98,
-	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
-	0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4,
-	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
-	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
-	// Entry 680 - 6BF
-	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda,
-	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
-	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
-	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
-	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
-	0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f,
-	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
-	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41,
-	0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
-	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
-	// Entry 700 - 73F
-	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
-	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
-	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
-	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 740 - 77F
-	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
-	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
-	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
-	0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75,
-	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
-	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
-	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
-	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
-	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
-	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
-	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
-	// Entry 7C0 - 7FF
-	0xdd, 0xbf, 0x72, 0x1d, 0xc7, 0x0c, 0xd5, 0x42,
-	0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56,
-	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
-	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
-	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
-	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
-	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
-	// Entry 800 - 83F
-	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
-	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
-	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
-	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
-	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
-	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
-	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
-	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x12, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
-	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
-	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
-	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
-	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
-	// Entry 880 - 8BF
-	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
-	0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
-	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
-}
-
-// AliasMap maps langIDs to their suggested replacements.
-// Size: 704 bytes, 176 elements
-var AliasMap = [176]FromTo{
-	0:   {From: 0x82, To: 0x88},
-	1:   {From: 0x187, To: 0x1ae},
-	2:   {From: 0x1f3, To: 0x1e1},
-	3:   {From: 0x1fb, To: 0x1bc},
-	4:   {From: 0x208, To: 0x512},
-	5:   {From: 0x20f, To: 0x20e},
-	6:   {From: 0x310, To: 0x3dc},
-	7:   {From: 0x347, To: 0x36f},
-	8:   {From: 0x407, To: 0x432},
-	9:   {From: 0x47a, To: 0x153},
-	10:  {From: 0x490, To: 0x451},
-	11:  {From: 0x4a2, To: 0x21},
-	12:  {From: 0x53e, To: 0x544},
-	13:  {From: 0x58f, To: 0x12d},
-	14:  {From: 0x630, To: 0x1eb1},
-	15:  {From: 0x651, To: 0x431},
-	16:  {From: 0x662, To: 0x431},
-	17:  {From: 0x6ed, To: 0x3a},
-	18:  {From: 0x6f8, To: 0x1d7},
-	19:  {From: 0x709, To: 0x3625},
-	20:  {From: 0x73e, To: 0x21a1},
-	21:  {From: 0x7b3, To: 0x56},
-	22:  {From: 0x7b9, To: 0x299b},
-	23:  {From: 0x7c5, To: 0x58},
-	24:  {From: 0x7e6, To: 0x145},
-	25:  {From: 0x80c, To: 0x5a},
-	26:  {From: 0x815, To: 0x8d},
-	27:  {From: 0x87e, To: 0x810},
-	28:  {From: 0x8c3, To: 0xee3},
-	29:  {From: 0x9ef, To: 0x331},
-	30:  {From: 0xa36, To: 0x2c5},
-	31:  {From: 0xa3d, To: 0xbf},
-	32:  {From: 0xabe, To: 0x3322},
-	33:  {From: 0xb38, To: 0x529},
-	34:  {From: 0xb75, To: 0x265a},
-	35:  {From: 0xb7e, To: 0xbc3},
-	36:  {From: 0xb9b, To: 0x44e},
-	37:  {From: 0xbbc, To: 0x4229},
-	38:  {From: 0xbbf, To: 0x529},
-	39:  {From: 0xbfe, To: 0x2da7},
-	40:  {From: 0xc2e, To: 0x3181},
-	41:  {From: 0xcb9, To: 0xf3},
-	42:  {From: 0xd08, To: 0xfa},
-	43:  {From: 0xdc8, To: 0x11a},
-	44:  {From: 0xdd7, To: 0x32d},
-	45:  {From: 0xdf8, To: 0xdfb},
-	46:  {From: 0xdfe, To: 0x531},
-	47:  {From: 0xe01, To: 0xdf3},
-	48:  {From: 0xedf, To: 0x205a},
-	49:  {From: 0xee9, To: 0x222e},
-	50:  {From: 0xeee, To: 0x2e9a},
-	51:  {From: 0xf39, To: 0x367},
-	52:  {From: 0x10d0, To: 0x140},
-	53:  {From: 0x1104, To: 0x2d0},
-	54:  {From: 0x11a0, To: 0x1ec},
-	55:  {From: 0x1279, To: 0x21},
-	56:  {From: 0x1424, To: 0x15e},
-	57:  {From: 0x1470, To: 0x14e},
-	58:  {From: 0x151f, To: 0xd9b},
-	59:  {From: 0x1523, To: 0x390},
-	60:  {From: 0x1532, To: 0x19f},
-	61:  {From: 0x1580, To: 0x210},
-	62:  {From: 0x1583, To: 0x10d},
-	63:  {From: 0x15a3, To: 0x3caf},
-	64:  {From: 0x1630, To: 0x222e},
-	65:  {From: 0x166a, To: 0x19b},
-	66:  {From: 0x16c8, To: 0x136},
-	67:  {From: 0x1700, To: 0x29f8},
-	68:  {From: 0x1718, To: 0x194},
-	69:  {From: 0x1727, To: 0xf3f},
-	70:  {From: 0x177a, To: 0x178},
-	71:  {From: 0x1809, To: 0x17b6},
-	72:  {From: 0x1816, To: 0x18f3},
-	73:  {From: 0x188a, To: 0x436},
-	74:  {From: 0x1979, To: 0x1d01},
-	75:  {From: 0x1a74, To: 0x2bb0},
-	76:  {From: 0x1a8a, To: 0x1f8},
-	77:  {From: 0x1b5a, To: 0x1fa},
-	78:  {From: 0x1b86, To: 0x1515},
-	79:  {From: 0x1d64, To: 0x2c9b},
-	80:  {From: 0x2038, To: 0x37b1},
-	81:  {From: 0x203d, To: 0x20dd},
-	82:  {From: 0x205a, To: 0x30b},
-	83:  {From: 0x20e3, To: 0x274},
-	84:  {From: 0x20ee, To: 0x263},
-	85:  {From: 0x20f2, To: 0x22d},
-	86:  {From: 0x20f9, To: 0x256},
-	87:  {From: 0x210f, To: 0x21eb},
-	88:  {From: 0x2135, To: 0x27d},
-	89:  {From: 0x2160, To: 0x913},
-	90:  {From: 0x2199, To: 0x121},
-	91:  {From: 0x21ce, To: 0x1561},
-	92:  {From: 0x21e6, To: 0x504},
-	93:  {From: 0x21f4, To: 0x49f},
-	94:  {From: 0x21fb, To: 0x269},
-	95:  {From: 0x222d, To: 0x121},
-	96:  {From: 0x2237, To: 0x121},
-	97:  {From: 0x2262, To: 0x92a},
-	98:  {From: 0x2316, To: 0x3226},
-	99:  {From: 0x236a, To: 0x2835},
-	100: {From: 0x2382, To: 0x3365},
-	101: {From: 0x2472, To: 0x2c7},
-	102: {From: 0x24e4, To: 0x2ff},
-	103: {From: 0x24f0, To: 0x2fa},
-	104: {From: 0x24fa, To: 0x31f},
-	105: {From: 0x2550, To: 0xb5b},
-	106: {From: 0x25a9, To: 0xe2},
-	107: {From: 0x263e, To: 0x2d0},
-	108: {From: 0x26c9, To: 0x26b4},
-	109: {From: 0x26f9, To: 0x3c8},
-	110: {From: 0x2727, To: 0x3caf},
-	111: {From: 0x2755, To: 0x6a4},
-	112: {From: 0x2765, To: 0x26b4},
-	113: {From: 0x2789, To: 0x4358},
-	114: {From: 0x27c9, To: 0x2001},
-	115: {From: 0x28ea, To: 0x27b1},
-	116: {From: 0x28ef, To: 0x2837},
-	117: {From: 0x2914, To: 0x351},
-	118: {From: 0x2986, To: 0x2da7},
-	119: {From: 0x29f0, To: 0x96b},
-	120: {From: 0x2b1a, To: 0x38d},
-	121: {From: 0x2bfc, To: 0x395},
-	122: {From: 0x2c3f, To: 0x3caf},
-	123: {From: 0x2cfc, To: 0x3be},
-	124: {From: 0x2d13, To: 0x597},
-	125: {From: 0x2d47, To: 0x148},
-	126: {From: 0x2d48, To: 0x148},
-	127: {From: 0x2dff, To: 0x2f1},
-	128: {From: 0x2e08, To: 0x19cc},
-	129: {From: 0x2e1a, To: 0x2d95},
-	130: {From: 0x2e21, To: 0x292},
-	131: {From: 0x2e54, To: 0x7d},
-	132: {From: 0x2e65, To: 0x2282},
-	133: {From: 0x2ea0, To: 0x2e9b},
-	134: {From: 0x2eef, To: 0x2ed7},
-	135: {From: 0x3193, To: 0x3c4},
-	136: {From: 0x3366, To: 0x338e},
-	137: {From: 0x342a, To: 0x3dc},
-	138: {From: 0x34ee, To: 0x18d0},
-	139: {From: 0x35c8, To: 0x2c9b},
-	140: {From: 0x35e6, To: 0x412},
-	141: {From: 0x3658, To: 0x246},
-	142: {From: 0x3676, To: 0x3f4},
-	143: {From: 0x36fd, To: 0x445},
-	144: {From: 0x37c0, To: 0x121},
-	145: {From: 0x3816, To: 0x38f2},
-	146: {From: 0x382a, To: 0x2b48},
-	147: {From: 0x382b, To: 0x2c9b},
-	148: {From: 0x382f, To: 0xa9},
-	149: {From: 0x3832, To: 0x3228},
-	150: {From: 0x386c, To: 0x39a6},
-	151: {From: 0x3892, To: 0x3fc0},
-	152: {From: 0x38a5, To: 0x39d7},
-	153: {From: 0x38b4, To: 0x1fa4},
-	154: {From: 0x38b5, To: 0x2e9a},
-	155: {From: 0x395c, To: 0x47e},
-	156: {From: 0x3b4e, To: 0xd91},
-	157: {From: 0x3b78, To: 0x137},
-	158: {From: 0x3c99, To: 0x4bc},
-	159: {From: 0x3fbd, To: 0x100},
-	160: {From: 0x4208, To: 0xa91},
-	161: {From: 0x42be, To: 0x573},
-	162: {From: 0x42f9, To: 0x3f60},
-	163: {From: 0x4378, To: 0x25a},
-	164: {From: 0x43b8, To: 0xe6c},
-	165: {From: 0x43cd, To: 0x10f},
-	166: {From: 0x44af, To: 0x3322},
-	167: {From: 0x44e3, To: 0x512},
-	168: {From: 0x45ca, To: 0x2409},
-	169: {From: 0x45dd, To: 0x26dc},
-	170: {From: 0x4610, To: 0x48ae},
-	171: {From: 0x46ae, To: 0x46a0},
-	172: {From: 0x473e, To: 0x4745},
-	173: {From: 0x4817, To: 0x3503},
-	174: {From: 0x4916, To: 0x31f},
-	175: {From: 0x49a7, To: 0x523},
-}
-
-// Size: 176 bytes, 176 elements
-var AliasTypes = [176]AliasType{
-	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1,
-	0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0,
-	0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0,
-	// Entry 40 - 7F
-	0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0,
-	0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0,
-	0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, 0, 0,
-	0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 1, 0, 2, 1, 1,
-	// Entry 80 - BF
-	0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, 1, 1, 1,
-	0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2,
-	0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
-}
-
-const (
-	_Latn = 90
-	_Hani = 57
-	_Hans = 59
-	_Hant = 60
-	_Qaaa = 143
-	_Qaai = 151
-	_Qabx = 192
-	_Zinh = 245
-	_Zyyy = 250
-	_Zzzz = 251
-)
-
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 1012 bytes
-	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
-	"BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" +
-	"DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" +
-	"GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" +
-	"JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" +
-	"LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" +
-	"MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" +
-	"OgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaa" +
-	"QaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaas" +
-	"QaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabk" +
-	"QablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRohgRoroRunrSamr" +
-	"SaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSoraSoyoSundSyloSyrcSyre" +
-	"SyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirhToto" +
-	"UgarVaiiVispWaraWchoWoleXpeoXsuxYeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz" +
-	"\xff\xff\xff\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists.  If a script is given, it should be suppressed from the language tag.
-// Size: 1330 bytes, 1330 elements
-var suppressScript = [1330]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 40 - 7F
-	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry C0 - FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xe5, 0x00, 0x00, 0x00, 0x00, 0xe7, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00,
-	// Entry 140 - 17F
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
-	// Entry 200 - 23F
-	0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 240 - 27F
-	0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 2C0 - 2FF
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20,
-	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
-	// Entry 3C0 - 3FF
-	0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 400 - 43F
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xcf, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xde, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xe1, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0xe6, 0x00, 0x00, 0x00, 0x2c,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	// Entry 480 - 4BF
-	0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 4C0 - 4FF
-	0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 500 - 53F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00,
-}
-
-const (
-	_001 = 1
-	_419 = 31
-	_BR  = 65
-	_CA  = 73
-	_ES  = 110
-	_GB  = 123
-	_MD  = 188
-	_PT  = 238
-	_UK  = 306
-	_US  = 309
-	_ZZ  = 357
-	_XA  = 323
-	_XC  = 325
-	_XK  = 333
-)
-
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 32
-
-// regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 40 - 7F
-	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 80 - BF
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry C0 - FF
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	// Entry 100 - 13F
-	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 140 - 17F
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
-//                 letters form the 3-letter ISO code.
-//     - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
-	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
-	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
-	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
-	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
-	0x0121, 0x015f, 0x00dc,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]FromTo{
-	0:  {From: 0x44, To: 0xc4},
-	1:  {From: 0x58, To: 0xa7},
-	2:  {From: 0x5f, To: 0x60},
-	3:  {From: 0x66, To: 0x3b},
-	4:  {From: 0x79, To: 0x78},
-	5:  {From: 0x93, To: 0x37},
-	6:  {From: 0xa3, To: 0x133},
-	7:  {From: 0xc1, To: 0x133},
-	8:  {From: 0xd7, To: 0x13f},
-	9:  {From: 0xdc, To: 0x2b},
-	10: {From: 0xef, To: 0x133},
-	11: {From: 0xf2, To: 0xe2},
-	12: {From: 0xfc, To: 0x70},
-	13: {From: 0x103, To: 0x164},
-	14: {From: 0x12a, To: 0x126},
-	15: {From: 0x132, To: 0x7b},
-	16: {From: 0x13a, To: 0x13e},
-	17: {From: 0x141, To: 0x133},
-	18: {From: 0x15d, To: 0x15e},
-	19: {From: 0x163, To: 0x4b},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
-	// Entry 0 - 3F
-	0, 1, 2, 3, 5, 9, 11, 13,
-	14, 15, 17, 18, 19, 21, 29, 30,
-	34, 35, 39, 53, 54, 57, 61, 142,
-	143, 145, 150, 151, 154, 155, 202, 419,
-	958, 0, 20, 784, 4, 28, 660, 8,
-	51, 530, 24, 10, 32, 16, 40, 36,
-	533, 248, 31, 70, 52, 50, 56, 854,
-	100, 48, 108, 204, 652, 60, 96, 68,
-	// Entry 40 - 7F
-	535, 76, 44, 64, 104, 74, 72, 112,
-	84, 124, 166, 180, 140, 178, 756, 384,
-	184, 152, 120, 156, 170, 0, 188, 891,
-	296, 192, 132, 531, 162, 196, 203, 278,
-	276, 0, 262, 208, 212, 214, 204, 12,
-	0, 218, 233, 818, 732, 232, 724, 231,
-	967, 0, 246, 242, 238, 583, 234, 0,
-	250, 249, 266, 826, 308, 268, 254, 831,
-	// Entry 80 - BF
-	288, 292, 304, 270, 324, 312, 226, 300,
-	239, 320, 316, 624, 328, 344, 334, 340,
-	191, 332, 348, 854, 0, 360, 372, 376,
-	833, 356, 86, 368, 364, 352, 380, 832,
-	388, 400, 392, 581, 404, 417, 116, 296,
-	174, 659, 408, 410, 414, 136, 398, 418,
-	422, 662, 438, 144, 430, 426, 440, 442,
-	428, 434, 504, 492, 498, 499, 663, 450,
-	// Entry C0 - FF
-	584, 581, 807, 466, 104, 496, 446, 580,
-	474, 478, 500, 470, 480, 462, 454, 484,
-	458, 508, 516, 540, 562, 574, 566, 548,
-	558, 528, 578, 524, 10, 520, 536, 570,
-	554, 512, 591, 0, 604, 258, 598, 608,
-	586, 616, 666, 612, 630, 275, 620, 581,
-	585, 600, 591, 634, 959, 960, 961, 962,
-	963, 964, 965, 966, 967, 968, 969, 970,
-	// Entry 100 - 13F
-	971, 972, 638, 716, 642, 688, 643, 646,
-	682, 90, 690, 729, 752, 702, 654, 705,
-	744, 703, 694, 674, 686, 706, 740, 728,
-	678, 810, 222, 534, 760, 748, 0, 796,
-	148, 260, 768, 764, 762, 772, 626, 795,
-	788, 776, 626, 792, 780, 798, 158, 834,
-	804, 800, 826, 581, 0, 840, 858, 860,
-	336, 670, 704, 862, 92, 850, 704, 548,
-	// Entry 140 - 17F
-	876, 581, 882, 973, 974, 975, 976, 977,
-	978, 979, 980, 981, 982, 983, 984, 985,
-	986, 987, 988, 989, 990, 991, 992, 993,
-	994, 995, 996, 997, 998, 720, 887, 175,
-	891, 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
-	0, 59, 108, 143, 181, 220, 259, 291,
-	333,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 666 bytes, 333 elements
-var fromM49 = [333]uint16{
-	// Entry 0 - 3F
-	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
-	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
-	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
-	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
-	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
-	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
-	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
-	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
-	// Entry 40 - 7F
-	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
-	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
-	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
-	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
-	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
-	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
-	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
-	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
-	// Entry 80 - BF
-	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
-	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
-	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
-	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
-	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
-	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
-	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
-	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
-	// Entry C0 - FF
-	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
-	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
-	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
-	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
-	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
-	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
-	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
-	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
-	// Entry 100 - 13F
-	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
-	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
-	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
-	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
-	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
-	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
-	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
-	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
-	// Entry 140 - 17F
-	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
-	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
-}
-
-// Size: 1995 bytes
-var variantIndex = map[string]uint8{
-	"1606nict": 0x0,
-	"1694acad": 0x1,
-	"1901":     0x2,
-	"1959acad": 0x3,
-	"1994":     0x60,
-	"1996":     0x4,
-	"abl1943":  0x5,
-	"akuapem":  0x6,
-	"alalc97":  0x62,
-	"aluku":    0x7,
-	"ao1990":   0x8,
-	"aranes":   0x9,
-	"arevela":  0xa,
-	"arevmda":  0xb,
-	"asante":   0xc,
-	"auvern":   0xd,
-	"baku1926": 0xe,
-	"balanka":  0xf,
-	"barla":    0x10,
-	"basiceng": 0x11,
-	"bauddha":  0x12,
-	"biscayan": 0x13,
-	"biske":    0x5b,
-	"bohoric":  0x14,
-	"boont":    0x15,
-	"bornholm": 0x16,
-	"cisaup":   0x17,
-	"colb1945": 0x18,
-	"cornu":    0x19,
-	"creiss":   0x1a,
-	"dajnko":   0x1b,
-	"ekavsk":   0x1c,
-	"emodeng":  0x1d,
-	"fonipa":   0x63,
-	"fonkirsh": 0x64,
-	"fonnapa":  0x65,
-	"fonupa":   0x66,
-	"fonxsamp": 0x67,
-	"gascon":   0x1e,
-	"grclass":  0x1f,
-	"grital":   0x20,
-	"grmistr":  0x21,
-	"hepburn":  0x22,
-	"heploc":   0x61,
-	"hognorsk": 0x23,
-	"hsistemo": 0x24,
-	"ijekavsk": 0x25,
-	"itihasa":  0x26,
-	"ivanchov": 0x27,
-	"jauer":    0x28,
-	"jyutping": 0x29,
-	"kkcor":    0x2a,
-	"kociewie": 0x2b,
-	"kscor":    0x2c,
-	"laukika":  0x2d,
-	"lemosin":  0x2e,
-	"lengadoc": 0x2f,
-	"lipaw":    0x5c,
-	"luna1918": 0x30,
-	"metelko":  0x31,
-	"monoton":  0x32,
-	"ndyuka":   0x33,
-	"nedis":    0x34,
-	"newfound": 0x35,
-	"nicard":   0x36,
-	"njiva":    0x5d,
-	"nulik":    0x37,
-	"osojs":    0x5e,
-	"oxendict": 0x38,
-	"pahawh2":  0x39,
-	"pahawh3":  0x3a,
-	"pahawh4":  0x3b,
-	"pamaka":   0x3c,
-	"peano":    0x3d,
-	"petr1708": 0x3e,
-	"pinyin":   0x3f,
-	"polyton":  0x40,
-	"provenc":  0x41,
-	"puter":    0x42,
-	"rigik":    0x43,
-	"rozaj":    0x44,
-	"rumgr":    0x45,
-	"scotland": 0x46,
-	"scouse":   0x47,
-	"simple":   0x68,
-	"solba":    0x5f,
-	"sotav":    0x48,
-	"spanglis": 0x49,
-	"surmiran": 0x4a,
-	"sursilv":  0x4b,
-	"sutsilv":  0x4c,
-	"tarask":   0x4d,
-	"tongyong": 0x4e,
-	"tunumiit": 0x4f,
-	"uccor":    0x50,
-	"ucrcor":   0x51,
-	"ulster":   0x52,
-	"unifon":   0x53,
-	"vaidika":  0x54,
-	"valencia": 0x55,
-	"vallader": 0x56,
-	"vecdruka": 0x57,
-	"vivaraup": 0x58,
-	"wadegile": 0x59,
-	"xsistemo": 0x5a,
-}
-
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 98
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 33
-
-type likelyLangRegion struct {
-	lang   uint16
-	region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 1012 bytes, 253 elements
-var likelyScript = [253]likelyLangRegion{
-	1:   {lang: 0x14e, region: 0x84},
-	3:   {lang: 0x2a2, region: 0x106},
-	4:   {lang: 0x1f, region: 0x99},
-	5:   {lang: 0x3a, region: 0x6b},
-	7:   {lang: 0x3b, region: 0x9c},
-	8:   {lang: 0x1d7, region: 0x28},
-	9:   {lang: 0x13, region: 0x9c},
-	10:  {lang: 0x5b, region: 0x95},
-	11:  {lang: 0x60, region: 0x52},
-	12:  {lang: 0xb9, region: 0xb4},
-	13:  {lang: 0x63, region: 0x95},
-	14:  {lang: 0xa5, region: 0x35},
-	15:  {lang: 0x3e9, region: 0x99},
-	17:  {lang: 0x529, region: 0x12e},
-	18:  {lang: 0x3b1, region: 0x99},
-	19:  {lang: 0x15e, region: 0x78},
-	20:  {lang: 0xc2, region: 0x95},
-	21:  {lang: 0x9d, region: 0xe7},
-	22:  {lang: 0xdb, region: 0x35},
-	23:  {lang: 0xf3, region: 0x49},
-	24:  {lang: 0x4f0, region: 0x12b},
-	25:  {lang: 0xe7, region: 0x13e},
-	26:  {lang: 0xe5, region: 0x135},
-	29:  {lang: 0xf1, region: 0x6b},
-	31:  {lang: 0x1a0, region: 0x5d},
-	32:  {lang: 0x3e2, region: 0x106},
-	34:  {lang: 0x1be, region: 0x99},
-	38:  {lang: 0x15e, region: 0x78},
-	41:  {lang: 0x133, region: 0x6b},
-	42:  {lang: 0x431, region: 0x27},
-	44:  {lang: 0x27, region: 0x6f},
-	46:  {lang: 0x210, region: 0x7d},
-	47:  {lang: 0xfe, region: 0x38},
-	49:  {lang: 0x19b, region: 0x99},
-	50:  {lang: 0x19e, region: 0x130},
-	51:  {lang: 0x3e9, region: 0x99},
-	52:  {lang: 0x136, region: 0x87},
-	53:  {lang: 0x1a4, region: 0x99},
-	54:  {lang: 0x39d, region: 0x99},
-	55:  {lang: 0x529, region: 0x12e},
-	56:  {lang: 0x254, region: 0xab},
-	57:  {lang: 0x529, region: 0x53},
-	58:  {lang: 0x1cb, region: 0xe7},
-	59:  {lang: 0x529, region: 0x53},
-	60:  {lang: 0x529, region: 0x12e},
-	61:  {lang: 0x2fd, region: 0x9b},
-	62:  {lang: 0x1bc, region: 0x97},
-	63:  {lang: 0x200, region: 0xa2},
-	64:  {lang: 0x1c5, region: 0x12b},
-	65:  {lang: 0x1ca, region: 0xaf},
-	68:  {lang: 0x1d5, region: 0x92},
-	70:  {lang: 0x142, region: 0x9e},
-	71:  {lang: 0x254, region: 0xab},
-	72:  {lang: 0x20e, region: 0x95},
-	73:  {lang: 0x200, region: 0xa2},
-	75:  {lang: 0x135, region: 0xc4},
-	76:  {lang: 0x200, region: 0xa2},
-	77:  {lang: 0x3bb, region: 0xe8},
-	78:  {lang: 0x24a, region: 0xa6},
-	79:  {lang: 0x3fa, region: 0x99},
-	82:  {lang: 0x251, region: 0x99},
-	83:  {lang: 0x254, region: 0xab},
-	85:  {lang: 0x88, region: 0x99},
-	86:  {lang: 0x370, region: 0x123},
-	87:  {lang: 0x2b8, region: 0xaf},
-	92:  {lang: 0x29f, region: 0x99},
-	93:  {lang: 0x2a8, region: 0x99},
-	94:  {lang: 0x28f, region: 0x87},
-	95:  {lang: 0x1a0, region: 0x87},
-	96:  {lang: 0x2ac, region: 0x53},
-	98:  {lang: 0x4f4, region: 0x12b},
-	99:  {lang: 0x4f5, region: 0x12b},
-	100: {lang: 0x1be, region: 0x99},
-	102: {lang: 0x337, region: 0x9c},
-	103: {lang: 0x4f7, region: 0x53},
-	104: {lang: 0xa9, region: 0x53},
-	107: {lang: 0x2e8, region: 0x112},
-	108: {lang: 0x4f8, region: 0x10b},
-	109: {lang: 0x4f8, region: 0x10b},
-	110: {lang: 0x304, region: 0x99},
-	111: {lang: 0x31b, region: 0x99},
-	112: {lang: 0x30b, region: 0x53},
-	114: {lang: 0x31e, region: 0x35},
-	115: {lang: 0x30e, region: 0x99},
-	116: {lang: 0x414, region: 0xe8},
-	117: {lang: 0x331, region: 0xc4},
-	119: {lang: 0x4f9, region: 0x108},
-	120: {lang: 0x3b, region: 0xa1},
-	121: {lang: 0x353, region: 0xdb},
-	124: {lang: 0x2d0, region: 0x84},
-	125: {lang: 0x52a, region: 0x53},
-	126: {lang: 0x403, region: 0x96},
-	127: {lang: 0x3ee, region: 0x99},
-	128: {lang: 0x39b, region: 0xc5},
-	129: {lang: 0x395, region: 0x99},
-	130: {lang: 0x399, region: 0x135},
-	131: {lang: 0x429, region: 0x115},
-	132: {lang: 0x3b, region: 0x11c},
-	133: {lang: 0xfd, region: 0xc4},
-	134: {lang: 0x27d, region: 0x106},
-	135: {lang: 0x2c9, region: 0x53},
-	136: {lang: 0x39f, region: 0x9c},
-	137: {lang: 0x39f, region: 0x53},
-	139: {lang: 0x3ad, region: 0xb0},
-	141: {lang: 0x1c6, region: 0x53},
-	142: {lang: 0x4fd, region: 0x9c},
-	193: {lang: 0x3cb, region: 0x95},
-	196: {lang: 0x372, region: 0x10c},
-	197: {lang: 0x420, region: 0x97},
-	199: {lang: 0x4ff, region: 0x15e},
-	200: {lang: 0x3f0, region: 0x99},
-	201: {lang: 0x45, region: 0x135},
-	202: {lang: 0x139, region: 0x7b},
-	203: {lang: 0x3e9, region: 0x99},
-	205: {lang: 0x3e9, region: 0x99},
-	206: {lang: 0x3fa, region: 0x99},
-	207: {lang: 0x40c, region: 0xb3},
-	210: {lang: 0x433, region: 0x99},
-	211: {lang: 0xef, region: 0xc5},
-	212: {lang: 0x43e, region: 0x95},
-	213: {lang: 0x44d, region: 0x35},
-	214: {lang: 0x44e, region: 0x9b},
-	218: {lang: 0x45a, region: 0xe7},
-	219: {lang: 0x11a, region: 0x99},
-	220: {lang: 0x45e, region: 0x53},
-	221: {lang: 0x232, region: 0x53},
-	222: {lang: 0x450, region: 0x99},
-	223: {lang: 0x4a5, region: 0x53},
-	224: {lang: 0x9f, region: 0x13e},
-	225: {lang: 0x461, region: 0x99},
-	227: {lang: 0x528, region: 0xba},
-	228: {lang: 0x153, region: 0xe7},
-	229: {lang: 0x128, region: 0xcd},
-	230: {lang: 0x46b, region: 0x123},
-	231: {lang: 0xa9, region: 0x53},
-	232: {lang: 0x2ce, region: 0x99},
-	234: {lang: 0x4ad, region: 0x11c},
-	235: {lang: 0x4be, region: 0xb4},
-	237: {lang: 0x1ce, region: 0x99},
-	240: {lang: 0x3a9, region: 0x9c},
-	241: {lang: 0x22, region: 0x9b},
-	243: {lang: 0x1ea, region: 0x53},
-	244: {lang: 0xef, region: 0xc5},
-}
-
-type likelyScriptRegion struct {
-	region uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5320 bytes, 1330 elements
-var likelyLang = [1330]likelyScriptRegion{
-	0:    {region: 0x135, script: 0x5a, flags: 0x0},
-	1:    {region: 0x6f, script: 0x5a, flags: 0x0},
-	2:    {region: 0x165, script: 0x5a, flags: 0x0},
-	3:    {region: 0x165, script: 0x5a, flags: 0x0},
-	4:    {region: 0x165, script: 0x5a, flags: 0x0},
-	5:    {region: 0x7d, script: 0x20, flags: 0x0},
-	6:    {region: 0x165, script: 0x5a, flags: 0x0},
-	7:    {region: 0x165, script: 0x20, flags: 0x0},
-	8:    {region: 0x80, script: 0x5a, flags: 0x0},
-	9:    {region: 0x165, script: 0x5a, flags: 0x0},
-	10:   {region: 0x165, script: 0x5a, flags: 0x0},
-	11:   {region: 0x165, script: 0x5a, flags: 0x0},
-	12:   {region: 0x95, script: 0x5a, flags: 0x0},
-	13:   {region: 0x131, script: 0x5a, flags: 0x0},
-	14:   {region: 0x80, script: 0x5a, flags: 0x0},
-	15:   {region: 0x165, script: 0x5a, flags: 0x0},
-	16:   {region: 0x165, script: 0x5a, flags: 0x0},
-	17:   {region: 0x106, script: 0x20, flags: 0x0},
-	18:   {region: 0x165, script: 0x5a, flags: 0x0},
-	19:   {region: 0x9c, script: 0x9, flags: 0x0},
-	20:   {region: 0x128, script: 0x5, flags: 0x0},
-	21:   {region: 0x165, script: 0x5a, flags: 0x0},
-	22:   {region: 0x161, script: 0x5a, flags: 0x0},
-	23:   {region: 0x165, script: 0x5a, flags: 0x0},
-	24:   {region: 0x165, script: 0x5a, flags: 0x0},
-	25:   {region: 0x165, script: 0x5a, flags: 0x0},
-	26:   {region: 0x165, script: 0x5a, flags: 0x0},
-	27:   {region: 0x165, script: 0x5a, flags: 0x0},
-	28:   {region: 0x52, script: 0x5a, flags: 0x0},
-	29:   {region: 0x165, script: 0x5a, flags: 0x0},
-	30:   {region: 0x165, script: 0x5a, flags: 0x0},
-	31:   {region: 0x99, script: 0x4, flags: 0x0},
-	32:   {region: 0x165, script: 0x5a, flags: 0x0},
-	33:   {region: 0x80, script: 0x5a, flags: 0x0},
-	34:   {region: 0x9b, script: 0xf1, flags: 0x0},
-	35:   {region: 0x165, script: 0x5a, flags: 0x0},
-	36:   {region: 0x165, script: 0x5a, flags: 0x0},
-	37:   {region: 0x14d, script: 0x5a, flags: 0x0},
-	38:   {region: 0x106, script: 0x20, flags: 0x0},
-	39:   {region: 0x6f, script: 0x2c, flags: 0x0},
-	40:   {region: 0x165, script: 0x5a, flags: 0x0},
-	41:   {region: 0x165, script: 0x5a, flags: 0x0},
-	42:   {region: 0xd6, script: 0x5a, flags: 0x0},
-	43:   {region: 0x165, script: 0x5a, flags: 0x0},
-	45:   {region: 0x165, script: 0x5a, flags: 0x0},
-	46:   {region: 0x165, script: 0x5a, flags: 0x0},
-	47:   {region: 0x165, script: 0x5a, flags: 0x0},
-	48:   {region: 0x165, script: 0x5a, flags: 0x0},
-	49:   {region: 0x165, script: 0x5a, flags: 0x0},
-	50:   {region: 0x165, script: 0x5a, flags: 0x0},
-	51:   {region: 0x95, script: 0x5a, flags: 0x0},
-	52:   {region: 0x165, script: 0x5, flags: 0x0},
-	53:   {region: 0x122, script: 0x5, flags: 0x0},
-	54:   {region: 0x165, script: 0x5a, flags: 0x0},
-	55:   {region: 0x165, script: 0x5a, flags: 0x0},
-	56:   {region: 0x165, script: 0x5a, flags: 0x0},
-	57:   {region: 0x165, script: 0x5a, flags: 0x0},
-	58:   {region: 0x6b, script: 0x5, flags: 0x0},
-	59:   {region: 0x0, script: 0x3, flags: 0x1},
-	60:   {region: 0x165, script: 0x5a, flags: 0x0},
-	61:   {region: 0x51, script: 0x5a, flags: 0x0},
-	62:   {region: 0x3f, script: 0x5a, flags: 0x0},
-	63:   {region: 0x67, script: 0x5, flags: 0x0},
-	65:   {region: 0xba, script: 0x5, flags: 0x0},
-	66:   {region: 0x6b, script: 0x5, flags: 0x0},
-	67:   {region: 0x99, script: 0xe, flags: 0x0},
-	68:   {region: 0x12f, script: 0x5a, flags: 0x0},
-	69:   {region: 0x135, script: 0xc9, flags: 0x0},
-	70:   {region: 0x165, script: 0x5a, flags: 0x0},
-	71:   {region: 0x165, script: 0x5a, flags: 0x0},
-	72:   {region: 0x6e, script: 0x5a, flags: 0x0},
-	73:   {region: 0x165, script: 0x5a, flags: 0x0},
-	74:   {region: 0x165, script: 0x5a, flags: 0x0},
-	75:   {region: 0x49, script: 0x5a, flags: 0x0},
-	76:   {region: 0x165, script: 0x5a, flags: 0x0},
-	77:   {region: 0x106, script: 0x20, flags: 0x0},
-	78:   {region: 0x165, script: 0x5, flags: 0x0},
-	79:   {region: 0x165, script: 0x5a, flags: 0x0},
-	80:   {region: 0x165, script: 0x5a, flags: 0x0},
-	81:   {region: 0x165, script: 0x5a, flags: 0x0},
-	82:   {region: 0x99, script: 0x22, flags: 0x0},
-	83:   {region: 0x165, script: 0x5a, flags: 0x0},
-	84:   {region: 0x165, script: 0x5a, flags: 0x0},
-	85:   {region: 0x165, script: 0x5a, flags: 0x0},
-	86:   {region: 0x3f, script: 0x5a, flags: 0x0},
-	87:   {region: 0x165, script: 0x5a, flags: 0x0},
-	88:   {region: 0x3, script: 0x5, flags: 0x1},
-	89:   {region: 0x106, script: 0x20, flags: 0x0},
-	90:   {region: 0xe8, script: 0x5, flags: 0x0},
-	91:   {region: 0x95, script: 0x5a, flags: 0x0},
-	92:   {region: 0xdb, script: 0x22, flags: 0x0},
-	93:   {region: 0x2e, script: 0x5a, flags: 0x0},
-	94:   {region: 0x52, script: 0x5a, flags: 0x0},
-	95:   {region: 0x165, script: 0x5a, flags: 0x0},
-	96:   {region: 0x52, script: 0xb, flags: 0x0},
-	97:   {region: 0x165, script: 0x5a, flags: 0x0},
-	98:   {region: 0x165, script: 0x5a, flags: 0x0},
-	99:   {region: 0x95, script: 0x5a, flags: 0x0},
-	100:  {region: 0x165, script: 0x5a, flags: 0x0},
-	101:  {region: 0x52, script: 0x5a, flags: 0x0},
-	102:  {region: 0x165, script: 0x5a, flags: 0x0},
-	103:  {region: 0x165, script: 0x5a, flags: 0x0},
-	104:  {region: 0x165, script: 0x5a, flags: 0x0},
-	105:  {region: 0x165, script: 0x5a, flags: 0x0},
-	106:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	107:  {region: 0x165, script: 0x5a, flags: 0x0},
-	108:  {region: 0x165, script: 0x5a, flags: 0x0},
-	109:  {region: 0x165, script: 0x5a, flags: 0x0},
-	110:  {region: 0x165, script: 0x2c, flags: 0x0},
-	111:  {region: 0x165, script: 0x5a, flags: 0x0},
-	112:  {region: 0x165, script: 0x5a, flags: 0x0},
-	113:  {region: 0x47, script: 0x20, flags: 0x0},
-	114:  {region: 0x165, script: 0x5a, flags: 0x0},
-	115:  {region: 0x165, script: 0x5a, flags: 0x0},
-	116:  {region: 0x10b, script: 0x5, flags: 0x0},
-	117:  {region: 0x162, script: 0x5a, flags: 0x0},
-	118:  {region: 0x165, script: 0x5a, flags: 0x0},
-	119:  {region: 0x95, script: 0x5a, flags: 0x0},
-	120:  {region: 0x165, script: 0x5a, flags: 0x0},
-	121:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	122:  {region: 0x52, script: 0x5a, flags: 0x0},
-	123:  {region: 0x99, script: 0xde, flags: 0x0},
-	124:  {region: 0xe8, script: 0x5, flags: 0x0},
-	125:  {region: 0x99, script: 0x22, flags: 0x0},
-	126:  {region: 0x38, script: 0x20, flags: 0x0},
-	127:  {region: 0x99, script: 0x22, flags: 0x0},
-	128:  {region: 0xe8, script: 0x5, flags: 0x0},
-	129:  {region: 0x12b, script: 0x34, flags: 0x0},
-	131:  {region: 0x99, script: 0x22, flags: 0x0},
-	132:  {region: 0x165, script: 0x5a, flags: 0x0},
-	133:  {region: 0x99, script: 0x22, flags: 0x0},
-	134:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	135:  {region: 0x165, script: 0x5a, flags: 0x0},
-	136:  {region: 0x99, script: 0x22, flags: 0x0},
-	137:  {region: 0x165, script: 0x5a, flags: 0x0},
-	138:  {region: 0x13f, script: 0x5a, flags: 0x0},
-	139:  {region: 0x165, script: 0x5a, flags: 0x0},
-	140:  {region: 0x165, script: 0x5a, flags: 0x0},
-	141:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	142:  {region: 0x165, script: 0x5a, flags: 0x0},
-	143:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	144:  {region: 0x165, script: 0x5a, flags: 0x0},
-	145:  {region: 0x165, script: 0x5a, flags: 0x0},
-	146:  {region: 0x165, script: 0x5a, flags: 0x0},
-	147:  {region: 0x165, script: 0x2c, flags: 0x0},
-	148:  {region: 0x99, script: 0x22, flags: 0x0},
-	149:  {region: 0x95, script: 0x5a, flags: 0x0},
-	150:  {region: 0x165, script: 0x5a, flags: 0x0},
-	151:  {region: 0x165, script: 0x5a, flags: 0x0},
-	152:  {region: 0x114, script: 0x5a, flags: 0x0},
-	153:  {region: 0x165, script: 0x5a, flags: 0x0},
-	154:  {region: 0x165, script: 0x5a, flags: 0x0},
-	155:  {region: 0x52, script: 0x5a, flags: 0x0},
-	156:  {region: 0x165, script: 0x5a, flags: 0x0},
-	157:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	158:  {region: 0x165, script: 0x5a, flags: 0x0},
-	159:  {region: 0x13e, script: 0xe0, flags: 0x0},
-	160:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	161:  {region: 0x165, script: 0x5a, flags: 0x0},
-	162:  {region: 0x165, script: 0x5a, flags: 0x0},
-	163:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	164:  {region: 0x165, script: 0x5a, flags: 0x0},
-	165:  {region: 0x35, script: 0xe, flags: 0x0},
-	166:  {region: 0x165, script: 0x5a, flags: 0x0},
-	167:  {region: 0x165, script: 0x5a, flags: 0x0},
-	168:  {region: 0x165, script: 0x5a, flags: 0x0},
-	169:  {region: 0x53, script: 0xe7, flags: 0x0},
-	170:  {region: 0x165, script: 0x5a, flags: 0x0},
-	171:  {region: 0x165, script: 0x5a, flags: 0x0},
-	172:  {region: 0x165, script: 0x5a, flags: 0x0},
-	173:  {region: 0x99, script: 0xe, flags: 0x0},
-	174:  {region: 0x165, script: 0x5a, flags: 0x0},
-	175:  {region: 0x9c, script: 0x5, flags: 0x0},
-	176:  {region: 0x165, script: 0x5a, flags: 0x0},
-	177:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	178:  {region: 0x78, script: 0x5a, flags: 0x0},
-	179:  {region: 0x99, script: 0x22, flags: 0x0},
-	180:  {region: 0xe8, script: 0x5, flags: 0x0},
-	181:  {region: 0x99, script: 0x22, flags: 0x0},
-	182:  {region: 0x165, script: 0x5a, flags: 0x0},
-	183:  {region: 0x33, script: 0x5a, flags: 0x0},
-	184:  {region: 0x165, script: 0x5a, flags: 0x0},
-	185:  {region: 0xb4, script: 0xc, flags: 0x0},
-	186:  {region: 0x52, script: 0x5a, flags: 0x0},
-	187:  {region: 0x165, script: 0x2c, flags: 0x0},
-	188:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	189:  {region: 0x165, script: 0x5a, flags: 0x0},
-	190:  {region: 0xe8, script: 0x22, flags: 0x0},
-	191:  {region: 0x106, script: 0x20, flags: 0x0},
-	192:  {region: 0x15f, script: 0x5a, flags: 0x0},
-	193:  {region: 0x165, script: 0x5a, flags: 0x0},
-	194:  {region: 0x95, script: 0x5a, flags: 0x0},
-	195:  {region: 0x165, script: 0x5a, flags: 0x0},
-	196:  {region: 0x52, script: 0x5a, flags: 0x0},
-	197:  {region: 0x165, script: 0x5a, flags: 0x0},
-	198:  {region: 0x165, script: 0x5a, flags: 0x0},
-	199:  {region: 0x165, script: 0x5a, flags: 0x0},
-	200:  {region: 0x86, script: 0x5a, flags: 0x0},
-	201:  {region: 0x165, script: 0x5a, flags: 0x0},
-	202:  {region: 0x165, script: 0x5a, flags: 0x0},
-	203:  {region: 0x165, script: 0x5a, flags: 0x0},
-	204:  {region: 0x165, script: 0x5a, flags: 0x0},
-	205:  {region: 0x6d, script: 0x2c, flags: 0x0},
-	206:  {region: 0x165, script: 0x5a, flags: 0x0},
-	207:  {region: 0x165, script: 0x5a, flags: 0x0},
-	208:  {region: 0x52, script: 0x5a, flags: 0x0},
-	209:  {region: 0x165, script: 0x5a, flags: 0x0},
-	210:  {region: 0x165, script: 0x5a, flags: 0x0},
-	211:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	212:  {region: 0x165, script: 0x5a, flags: 0x0},
-	213:  {region: 0x165, script: 0x5a, flags: 0x0},
-	214:  {region: 0x165, script: 0x5a, flags: 0x0},
-	215:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	216:  {region: 0x165, script: 0x5a, flags: 0x0},
-	217:  {region: 0x165, script: 0x5a, flags: 0x0},
-	218:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	219:  {region: 0x35, script: 0x16, flags: 0x0},
-	220:  {region: 0x106, script: 0x20, flags: 0x0},
-	221:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	222:  {region: 0x165, script: 0x5a, flags: 0x0},
-	223:  {region: 0x131, script: 0x5a, flags: 0x0},
-	224:  {region: 0x8a, script: 0x5a, flags: 0x0},
-	225:  {region: 0x75, script: 0x5a, flags: 0x0},
-	226:  {region: 0x106, script: 0x20, flags: 0x0},
-	227:  {region: 0x135, script: 0x5a, flags: 0x0},
-	228:  {region: 0x49, script: 0x5a, flags: 0x0},
-	229:  {region: 0x135, script: 0x1a, flags: 0x0},
-	230:  {region: 0xa6, script: 0x5, flags: 0x0},
-	231:  {region: 0x13e, script: 0x19, flags: 0x0},
-	232:  {region: 0x165, script: 0x5a, flags: 0x0},
-	233:  {region: 0x9b, script: 0x5, flags: 0x0},
-	234:  {region: 0x165, script: 0x5a, flags: 0x0},
-	235:  {region: 0x165, script: 0x5a, flags: 0x0},
-	236:  {region: 0x165, script: 0x5a, flags: 0x0},
-	237:  {region: 0x165, script: 0x5a, flags: 0x0},
-	238:  {region: 0x165, script: 0x5a, flags: 0x0},
-	239:  {region: 0xc5, script: 0xd3, flags: 0x0},
-	240:  {region: 0x78, script: 0x5a, flags: 0x0},
-	241:  {region: 0x6b, script: 0x1d, flags: 0x0},
-	242:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	243:  {region: 0x49, script: 0x17, flags: 0x0},
-	244:  {region: 0x130, script: 0x20, flags: 0x0},
-	245:  {region: 0x49, script: 0x17, flags: 0x0},
-	246:  {region: 0x49, script: 0x17, flags: 0x0},
-	247:  {region: 0x49, script: 0x17, flags: 0x0},
-	248:  {region: 0x49, script: 0x17, flags: 0x0},
-	249:  {region: 0x10a, script: 0x5a, flags: 0x0},
-	250:  {region: 0x5e, script: 0x5a, flags: 0x0},
-	251:  {region: 0xe9, script: 0x5a, flags: 0x0},
-	252:  {region: 0x49, script: 0x17, flags: 0x0},
-	253:  {region: 0xc4, script: 0x85, flags: 0x0},
-	254:  {region: 0x8, script: 0x2, flags: 0x1},
-	255:  {region: 0x106, script: 0x20, flags: 0x0},
-	256:  {region: 0x7b, script: 0x5a, flags: 0x0},
-	257:  {region: 0x63, script: 0x5a, flags: 0x0},
-	258:  {region: 0x165, script: 0x5a, flags: 0x0},
-	259:  {region: 0x165, script: 0x5a, flags: 0x0},
-	260:  {region: 0x165, script: 0x5a, flags: 0x0},
-	261:  {region: 0x165, script: 0x5a, flags: 0x0},
-	262:  {region: 0x135, script: 0x5a, flags: 0x0},
-	263:  {region: 0x106, script: 0x20, flags: 0x0},
-	264:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	265:  {region: 0x165, script: 0x5a, flags: 0x0},
-	266:  {region: 0x165, script: 0x5a, flags: 0x0},
-	267:  {region: 0x99, script: 0x5, flags: 0x0},
-	268:  {region: 0x165, script: 0x5a, flags: 0x0},
-	269:  {region: 0x60, script: 0x5a, flags: 0x0},
-	270:  {region: 0x165, script: 0x5a, flags: 0x0},
-	271:  {region: 0x49, script: 0x5a, flags: 0x0},
-	272:  {region: 0x165, script: 0x5a, flags: 0x0},
-	273:  {region: 0x165, script: 0x5a, flags: 0x0},
-	274:  {region: 0x165, script: 0x5a, flags: 0x0},
-	275:  {region: 0x165, script: 0x5, flags: 0x0},
-	276:  {region: 0x49, script: 0x5a, flags: 0x0},
-	277:  {region: 0x165, script: 0x5a, flags: 0x0},
-	278:  {region: 0x165, script: 0x5a, flags: 0x0},
-	279:  {region: 0xd4, script: 0x5a, flags: 0x0},
-	280:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	281:  {region: 0x165, script: 0x5a, flags: 0x0},
-	282:  {region: 0x99, script: 0x5, flags: 0x0},
-	283:  {region: 0x165, script: 0x5a, flags: 0x0},
-	284:  {region: 0x165, script: 0x5a, flags: 0x0},
-	285:  {region: 0x165, script: 0x5a, flags: 0x0},
-	286:  {region: 0x165, script: 0x2c, flags: 0x0},
-	287:  {region: 0x60, script: 0x5a, flags: 0x0},
-	288:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	289:  {region: 0xd0, script: 0x5a, flags: 0x0},
-	290:  {region: 0x165, script: 0x5a, flags: 0x0},
-	291:  {region: 0xdb, script: 0x22, flags: 0x0},
-	292:  {region: 0x52, script: 0x5a, flags: 0x0},
-	293:  {region: 0x165, script: 0x5a, flags: 0x0},
-	294:  {region: 0x165, script: 0x5a, flags: 0x0},
-	295:  {region: 0x165, script: 0x5a, flags: 0x0},
-	296:  {region: 0xcd, script: 0xe5, flags: 0x0},
-	297:  {region: 0x165, script: 0x5a, flags: 0x0},
-	298:  {region: 0x165, script: 0x5a, flags: 0x0},
-	299:  {region: 0x114, script: 0x5a, flags: 0x0},
-	300:  {region: 0x37, script: 0x5a, flags: 0x0},
-	301:  {region: 0x43, script: 0xe7, flags: 0x0},
-	302:  {region: 0x165, script: 0x5a, flags: 0x0},
-	303:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	304:  {region: 0x80, script: 0x5a, flags: 0x0},
-	305:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	306:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	307:  {region: 0x6b, script: 0x29, flags: 0x0},
-	308:  {region: 0x165, script: 0x5a, flags: 0x0},
-	309:  {region: 0xc4, script: 0x4b, flags: 0x0},
-	310:  {region: 0x87, script: 0x34, flags: 0x0},
-	311:  {region: 0x165, script: 0x5a, flags: 0x0},
-	312:  {region: 0x165, script: 0x5a, flags: 0x0},
-	313:  {region: 0xa, script: 0x2, flags: 0x1},
-	314:  {region: 0x165, script: 0x5a, flags: 0x0},
-	315:  {region: 0x165, script: 0x5a, flags: 0x0},
-	316:  {region: 0x1, script: 0x5a, flags: 0x0},
-	317:  {region: 0x165, script: 0x5a, flags: 0x0},
-	318:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	319:  {region: 0x135, script: 0x5a, flags: 0x0},
-	320:  {region: 0x6a, script: 0x5a, flags: 0x0},
-	321:  {region: 0x165, script: 0x5a, flags: 0x0},
-	322:  {region: 0x9e, script: 0x46, flags: 0x0},
-	323:  {region: 0x165, script: 0x5a, flags: 0x0},
-	324:  {region: 0x165, script: 0x5a, flags: 0x0},
-	325:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	326:  {region: 0x52, script: 0x5a, flags: 0x0},
-	327:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	328:  {region: 0x9c, script: 0x5, flags: 0x0},
-	329:  {region: 0x165, script: 0x5a, flags: 0x0},
-	330:  {region: 0x165, script: 0x5a, flags: 0x0},
-	331:  {region: 0x165, script: 0x5a, flags: 0x0},
-	332:  {region: 0x165, script: 0x5a, flags: 0x0},
-	333:  {region: 0x86, script: 0x5a, flags: 0x0},
-	334:  {region: 0xc, script: 0x2, flags: 0x1},
-	335:  {region: 0x165, script: 0x5a, flags: 0x0},
-	336:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	337:  {region: 0x72, script: 0x5a, flags: 0x0},
-	338:  {region: 0x10b, script: 0x5, flags: 0x0},
-	339:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	340:  {region: 0x10c, script: 0x5a, flags: 0x0},
-	341:  {region: 0x73, script: 0x5a, flags: 0x0},
-	342:  {region: 0x165, script: 0x5a, flags: 0x0},
-	343:  {region: 0x165, script: 0x5a, flags: 0x0},
-	344:  {region: 0x76, script: 0x5a, flags: 0x0},
-	345:  {region: 0x165, script: 0x5a, flags: 0x0},
-	346:  {region: 0x3b, script: 0x5a, flags: 0x0},
-	347:  {region: 0x165, script: 0x5a, flags: 0x0},
-	348:  {region: 0x165, script: 0x5a, flags: 0x0},
-	349:  {region: 0x165, script: 0x5a, flags: 0x0},
-	350:  {region: 0x78, script: 0x5a, flags: 0x0},
-	351:  {region: 0x135, script: 0x5a, flags: 0x0},
-	352:  {region: 0x78, script: 0x5a, flags: 0x0},
-	353:  {region: 0x60, script: 0x5a, flags: 0x0},
-	354:  {region: 0x60, script: 0x5a, flags: 0x0},
-	355:  {region: 0x52, script: 0x5, flags: 0x0},
-	356:  {region: 0x140, script: 0x5a, flags: 0x0},
-	357:  {region: 0x165, script: 0x5a, flags: 0x0},
-	358:  {region: 0x84, script: 0x5a, flags: 0x0},
-	359:  {region: 0x165, script: 0x5a, flags: 0x0},
-	360:  {region: 0xd4, script: 0x5a, flags: 0x0},
-	361:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	362:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	363:  {region: 0x165, script: 0x5a, flags: 0x0},
-	364:  {region: 0x10b, script: 0x5a, flags: 0x0},
-	365:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	366:  {region: 0x96, script: 0x5a, flags: 0x0},
-	367:  {region: 0x80, script: 0x5a, flags: 0x0},
-	368:  {region: 0x165, script: 0x5a, flags: 0x0},
-	369:  {region: 0xbc, script: 0x5a, flags: 0x0},
-	370:  {region: 0x165, script: 0x5a, flags: 0x0},
-	371:  {region: 0x165, script: 0x5a, flags: 0x0},
-	372:  {region: 0x165, script: 0x5a, flags: 0x0},
-	373:  {region: 0x53, script: 0x3b, flags: 0x0},
-	374:  {region: 0x165, script: 0x5a, flags: 0x0},
-	375:  {region: 0x95, script: 0x5a, flags: 0x0},
-	376:  {region: 0x165, script: 0x5a, flags: 0x0},
-	377:  {region: 0x165, script: 0x5a, flags: 0x0},
-	378:  {region: 0x99, script: 0x22, flags: 0x0},
-	379:  {region: 0x165, script: 0x5a, flags: 0x0},
-	380:  {region: 0x9c, script: 0x5, flags: 0x0},
-	381:  {region: 0x7e, script: 0x5a, flags: 0x0},
-	382:  {region: 0x7b, script: 0x5a, flags: 0x0},
-	383:  {region: 0x165, script: 0x5a, flags: 0x0},
-	384:  {region: 0x165, script: 0x5a, flags: 0x0},
-	385:  {region: 0x165, script: 0x5a, flags: 0x0},
-	386:  {region: 0x165, script: 0x5a, flags: 0x0},
-	387:  {region: 0x165, script: 0x5a, flags: 0x0},
-	388:  {region: 0x165, script: 0x5a, flags: 0x0},
-	389:  {region: 0x6f, script: 0x2c, flags: 0x0},
-	390:  {region: 0x165, script: 0x5a, flags: 0x0},
-	391:  {region: 0xdb, script: 0x22, flags: 0x0},
-	392:  {region: 0x165, script: 0x5a, flags: 0x0},
-	393:  {region: 0xa7, script: 0x5a, flags: 0x0},
-	394:  {region: 0x165, script: 0x5a, flags: 0x0},
-	395:  {region: 0xe8, script: 0x5, flags: 0x0},
-	396:  {region: 0x165, script: 0x5a, flags: 0x0},
-	397:  {region: 0xe8, script: 0x5, flags: 0x0},
-	398:  {region: 0x165, script: 0x5a, flags: 0x0},
-	399:  {region: 0x165, script: 0x5a, flags: 0x0},
-	400:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	401:  {region: 0x9c, script: 0x5, flags: 0x0},
-	402:  {region: 0x165, script: 0x5a, flags: 0x0},
-	403:  {region: 0x165, script: 0x2c, flags: 0x0},
-	404:  {region: 0xf1, script: 0x5a, flags: 0x0},
-	405:  {region: 0x165, script: 0x5a, flags: 0x0},
-	406:  {region: 0x165, script: 0x5a, flags: 0x0},
-	407:  {region: 0x165, script: 0x5a, flags: 0x0},
-	408:  {region: 0x165, script: 0x2c, flags: 0x0},
-	409:  {region: 0x165, script: 0x5a, flags: 0x0},
-	410:  {region: 0x99, script: 0x22, flags: 0x0},
-	411:  {region: 0x99, script: 0xe1, flags: 0x0},
-	412:  {region: 0x95, script: 0x5a, flags: 0x0},
-	413:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	414:  {region: 0x130, script: 0x32, flags: 0x0},
-	415:  {region: 0x165, script: 0x5a, flags: 0x0},
-	416:  {region: 0xe, script: 0x2, flags: 0x1},
-	417:  {region: 0x99, script: 0xe, flags: 0x0},
-	418:  {region: 0x165, script: 0x5a, flags: 0x0},
-	419:  {region: 0x4e, script: 0x5a, flags: 0x0},
-	420:  {region: 0x99, script: 0x35, flags: 0x0},
-	421:  {region: 0x41, script: 0x5a, flags: 0x0},
-	422:  {region: 0x54, script: 0x5a, flags: 0x0},
-	423:  {region: 0x165, script: 0x5a, flags: 0x0},
-	424:  {region: 0x80, script: 0x5a, flags: 0x0},
-	425:  {region: 0x165, script: 0x5a, flags: 0x0},
-	426:  {region: 0x165, script: 0x5a, flags: 0x0},
-	427:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	428:  {region: 0x98, script: 0x5a, flags: 0x0},
-	429:  {region: 0x165, script: 0x5a, flags: 0x0},
-	430:  {region: 0xdb, script: 0x22, flags: 0x0},
-	431:  {region: 0x165, script: 0x5a, flags: 0x0},
-	432:  {region: 0x165, script: 0x5, flags: 0x0},
-	433:  {region: 0x49, script: 0x5a, flags: 0x0},
-	434:  {region: 0x165, script: 0x5, flags: 0x0},
-	435:  {region: 0x165, script: 0x5a, flags: 0x0},
-	436:  {region: 0x10, script: 0x3, flags: 0x1},
-	437:  {region: 0x165, script: 0x5a, flags: 0x0},
-	438:  {region: 0x53, script: 0x3b, flags: 0x0},
-	439:  {region: 0x165, script: 0x5a, flags: 0x0},
-	440:  {region: 0x135, script: 0x5a, flags: 0x0},
-	441:  {region: 0x24, script: 0x5, flags: 0x0},
-	442:  {region: 0x165, script: 0x5a, flags: 0x0},
-	443:  {region: 0x165, script: 0x2c, flags: 0x0},
-	444:  {region: 0x97, script: 0x3e, flags: 0x0},
-	445:  {region: 0x165, script: 0x5a, flags: 0x0},
-	446:  {region: 0x99, script: 0x22, flags: 0x0},
-	447:  {region: 0x165, script: 0x5a, flags: 0x0},
-	448:  {region: 0x73, script: 0x5a, flags: 0x0},
-	449:  {region: 0x165, script: 0x5a, flags: 0x0},
-	450:  {region: 0x165, script: 0x5a, flags: 0x0},
-	451:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	452:  {region: 0x165, script: 0x5a, flags: 0x0},
-	453:  {region: 0x12b, script: 0x40, flags: 0x0},
-	454:  {region: 0x53, script: 0x8d, flags: 0x0},
-	455:  {region: 0x165, script: 0x5a, flags: 0x0},
-	456:  {region: 0xe8, script: 0x5, flags: 0x0},
-	457:  {region: 0x99, script: 0x22, flags: 0x0},
-	458:  {region: 0xaf, script: 0x41, flags: 0x0},
-	459:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	460:  {region: 0xe8, script: 0x5, flags: 0x0},
-	461:  {region: 0xe6, script: 0x5a, flags: 0x0},
-	462:  {region: 0x99, script: 0x22, flags: 0x0},
-	463:  {region: 0x99, script: 0x22, flags: 0x0},
-	464:  {region: 0x165, script: 0x5a, flags: 0x0},
-	465:  {region: 0x90, script: 0x5a, flags: 0x0},
-	466:  {region: 0x60, script: 0x5a, flags: 0x0},
-	467:  {region: 0x53, script: 0x3b, flags: 0x0},
-	468:  {region: 0x91, script: 0x5a, flags: 0x0},
-	469:  {region: 0x92, script: 0x5a, flags: 0x0},
-	470:  {region: 0x165, script: 0x5a, flags: 0x0},
-	471:  {region: 0x28, script: 0x8, flags: 0x0},
-	472:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	473:  {region: 0x78, script: 0x5a, flags: 0x0},
-	474:  {region: 0x165, script: 0x5a, flags: 0x0},
-	475:  {region: 0x165, script: 0x5a, flags: 0x0},
-	476:  {region: 0xd0, script: 0x5a, flags: 0x0},
-	477:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	478:  {region: 0x165, script: 0x5a, flags: 0x0},
-	479:  {region: 0x165, script: 0x5a, flags: 0x0},
-	480:  {region: 0x165, script: 0x5a, flags: 0x0},
-	481:  {region: 0x95, script: 0x5a, flags: 0x0},
-	482:  {region: 0x165, script: 0x5a, flags: 0x0},
-	483:  {region: 0x165, script: 0x5a, flags: 0x0},
-	484:  {region: 0x165, script: 0x5a, flags: 0x0},
-	486:  {region: 0x122, script: 0x5a, flags: 0x0},
-	487:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	488:  {region: 0x165, script: 0x5a, flags: 0x0},
-	489:  {region: 0x165, script: 0x5a, flags: 0x0},
-	490:  {region: 0x53, script: 0xf3, flags: 0x0},
-	491:  {region: 0x165, script: 0x5a, flags: 0x0},
-	492:  {region: 0x135, script: 0x5a, flags: 0x0},
-	493:  {region: 0x165, script: 0x5a, flags: 0x0},
-	494:  {region: 0x49, script: 0x5a, flags: 0x0},
-	495:  {region: 0x165, script: 0x5a, flags: 0x0},
-	496:  {region: 0x165, script: 0x5a, flags: 0x0},
-	497:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	498:  {region: 0x165, script: 0x5a, flags: 0x0},
-	499:  {region: 0x95, script: 0x5a, flags: 0x0},
-	500:  {region: 0x106, script: 0x20, flags: 0x0},
-	501:  {region: 0x1, script: 0x5a, flags: 0x0},
-	502:  {region: 0x165, script: 0x5a, flags: 0x0},
-	503:  {region: 0x165, script: 0x5a, flags: 0x0},
-	504:  {region: 0x9d, script: 0x5a, flags: 0x0},
-	505:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	506:  {region: 0x49, script: 0x17, flags: 0x0},
-	507:  {region: 0x97, script: 0x3e, flags: 0x0},
-	508:  {region: 0x165, script: 0x5a, flags: 0x0},
-	509:  {region: 0x165, script: 0x5a, flags: 0x0},
-	510:  {region: 0x106, script: 0x5a, flags: 0x0},
-	511:  {region: 0x165, script: 0x5a, flags: 0x0},
-	512:  {region: 0xa2, script: 0x49, flags: 0x0},
-	513:  {region: 0x165, script: 0x5a, flags: 0x0},
-	514:  {region: 0xa0, script: 0x5a, flags: 0x0},
-	515:  {region: 0x1, script: 0x5a, flags: 0x0},
-	516:  {region: 0x165, script: 0x5a, flags: 0x0},
-	517:  {region: 0x165, script: 0x5a, flags: 0x0},
-	518:  {region: 0x165, script: 0x5a, flags: 0x0},
-	519:  {region: 0x52, script: 0x5a, flags: 0x0},
-	520:  {region: 0x130, script: 0x3e, flags: 0x0},
-	521:  {region: 0x165, script: 0x5a, flags: 0x0},
-	522:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	523:  {region: 0xdb, script: 0x22, flags: 0x0},
-	524:  {region: 0x165, script: 0x5a, flags: 0x0},
-	525:  {region: 0x63, script: 0x5a, flags: 0x0},
-	526:  {region: 0x95, script: 0x5a, flags: 0x0},
-	527:  {region: 0x95, script: 0x5a, flags: 0x0},
-	528:  {region: 0x7d, script: 0x2e, flags: 0x0},
-	529:  {region: 0x137, script: 0x20, flags: 0x0},
-	530:  {region: 0x67, script: 0x5a, flags: 0x0},
-	531:  {region: 0xc4, script: 0x5a, flags: 0x0},
-	532:  {region: 0x165, script: 0x5a, flags: 0x0},
-	533:  {region: 0x165, script: 0x5a, flags: 0x0},
-	534:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	535:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	536:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	537:  {region: 0x106, script: 0x20, flags: 0x0},
-	538:  {region: 0x165, script: 0x5a, flags: 0x0},
-	539:  {region: 0x165, script: 0x5a, flags: 0x0},
-	540:  {region: 0x165, script: 0x5a, flags: 0x0},
-	541:  {region: 0x165, script: 0x5a, flags: 0x0},
-	542:  {region: 0xd4, script: 0x5, flags: 0x0},
-	543:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	544:  {region: 0x164, script: 0x5a, flags: 0x0},
-	545:  {region: 0x165, script: 0x5a, flags: 0x0},
-	546:  {region: 0x165, script: 0x5a, flags: 0x0},
-	547:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	548:  {region: 0x122, script: 0x5, flags: 0x0},
-	549:  {region: 0x165, script: 0x5a, flags: 0x0},
-	550:  {region: 0x123, script: 0xe6, flags: 0x0},
-	551:  {region: 0x5a, script: 0x5a, flags: 0x0},
-	552:  {region: 0x52, script: 0x5a, flags: 0x0},
-	553:  {region: 0x165, script: 0x5a, flags: 0x0},
-	554:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	555:  {region: 0x99, script: 0x22, flags: 0x0},
-	556:  {region: 0x99, script: 0x22, flags: 0x0},
-	557:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	558:  {region: 0x95, script: 0x5a, flags: 0x0},
-	559:  {region: 0x165, script: 0x5a, flags: 0x0},
-	560:  {region: 0x41, script: 0x5a, flags: 0x0},
-	561:  {region: 0x99, script: 0x5a, flags: 0x0},
-	562:  {region: 0x53, script: 0xdd, flags: 0x0},
-	563:  {region: 0x99, script: 0x22, flags: 0x0},
-	564:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	565:  {region: 0x165, script: 0x5a, flags: 0x0},
-	566:  {region: 0x99, script: 0x75, flags: 0x0},
-	567:  {region: 0xe8, script: 0x5, flags: 0x0},
-	568:  {region: 0x165, script: 0x5a, flags: 0x0},
-	569:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	570:  {region: 0x165, script: 0x5a, flags: 0x0},
-	571:  {region: 0x12b, script: 0x5a, flags: 0x0},
-	572:  {region: 0x165, script: 0x5a, flags: 0x0},
-	573:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	574:  {region: 0x165, script: 0x5a, flags: 0x0},
-	575:  {region: 0xaf, script: 0x57, flags: 0x0},
-	576:  {region: 0x165, script: 0x5a, flags: 0x0},
-	577:  {region: 0x165, script: 0x5a, flags: 0x0},
-	578:  {region: 0x13, script: 0x6, flags: 0x1},
-	579:  {region: 0x165, script: 0x5a, flags: 0x0},
-	580:  {region: 0x52, script: 0x5a, flags: 0x0},
-	581:  {region: 0x82, script: 0x5a, flags: 0x0},
-	582:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	583:  {region: 0x165, script: 0x5a, flags: 0x0},
-	584:  {region: 0x165, script: 0x5a, flags: 0x0},
-	585:  {region: 0x165, script: 0x5a, flags: 0x0},
-	586:  {region: 0xa6, script: 0x4e, flags: 0x0},
-	587:  {region: 0x2a, script: 0x5a, flags: 0x0},
-	588:  {region: 0x165, script: 0x5a, flags: 0x0},
-	589:  {region: 0x165, script: 0x5a, flags: 0x0},
-	590:  {region: 0x165, script: 0x5a, flags: 0x0},
-	591:  {region: 0x165, script: 0x5a, flags: 0x0},
-	592:  {region: 0x165, script: 0x5a, flags: 0x0},
-	593:  {region: 0x99, script: 0x52, flags: 0x0},
-	594:  {region: 0x8b, script: 0x5a, flags: 0x0},
-	595:  {region: 0x165, script: 0x5a, flags: 0x0},
-	596:  {region: 0xab, script: 0x53, flags: 0x0},
-	597:  {region: 0x106, script: 0x20, flags: 0x0},
-	598:  {region: 0x99, script: 0x22, flags: 0x0},
-	599:  {region: 0x165, script: 0x5a, flags: 0x0},
-	600:  {region: 0x75, script: 0x5a, flags: 0x0},
-	601:  {region: 0x165, script: 0x5a, flags: 0x0},
-	602:  {region: 0xb4, script: 0x5a, flags: 0x0},
-	603:  {region: 0x165, script: 0x5a, flags: 0x0},
-	604:  {region: 0x165, script: 0x5a, flags: 0x0},
-	605:  {region: 0x165, script: 0x5a, flags: 0x0},
-	606:  {region: 0x165, script: 0x5a, flags: 0x0},
-	607:  {region: 0x165, script: 0x5a, flags: 0x0},
-	608:  {region: 0x165, script: 0x5a, flags: 0x0},
-	609:  {region: 0x165, script: 0x5a, flags: 0x0},
-	610:  {region: 0x165, script: 0x2c, flags: 0x0},
-	611:  {region: 0x165, script: 0x5a, flags: 0x0},
-	612:  {region: 0x106, script: 0x20, flags: 0x0},
-	613:  {region: 0x112, script: 0x5a, flags: 0x0},
-	614:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	615:  {region: 0x106, script: 0x5a, flags: 0x0},
-	616:  {region: 0x165, script: 0x5a, flags: 0x0},
-	617:  {region: 0x99, script: 0x22, flags: 0x0},
-	618:  {region: 0x99, script: 0x5, flags: 0x0},
-	619:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	620:  {region: 0x165, script: 0x5a, flags: 0x0},
-	621:  {region: 0x52, script: 0x5a, flags: 0x0},
-	622:  {region: 0x60, script: 0x5a, flags: 0x0},
-	623:  {region: 0x165, script: 0x5a, flags: 0x0},
-	624:  {region: 0x165, script: 0x5a, flags: 0x0},
-	625:  {region: 0x165, script: 0x2c, flags: 0x0},
-	626:  {region: 0x165, script: 0x5a, flags: 0x0},
-	627:  {region: 0x165, script: 0x5a, flags: 0x0},
-	628:  {region: 0x19, script: 0x3, flags: 0x1},
-	629:  {region: 0x165, script: 0x5a, flags: 0x0},
-	630:  {region: 0x165, script: 0x5a, flags: 0x0},
-	631:  {region: 0x165, script: 0x5a, flags: 0x0},
-	632:  {region: 0x165, script: 0x5a, flags: 0x0},
-	633:  {region: 0x106, script: 0x20, flags: 0x0},
-	634:  {region: 0x165, script: 0x5a, flags: 0x0},
-	635:  {region: 0x165, script: 0x5a, flags: 0x0},
-	636:  {region: 0x165, script: 0x5a, flags: 0x0},
-	637:  {region: 0x106, script: 0x20, flags: 0x0},
-	638:  {region: 0x165, script: 0x5a, flags: 0x0},
-	639:  {region: 0x95, script: 0x5a, flags: 0x0},
-	640:  {region: 0xe8, script: 0x5, flags: 0x0},
-	641:  {region: 0x7b, script: 0x5a, flags: 0x0},
-	642:  {region: 0x165, script: 0x5a, flags: 0x0},
-	643:  {region: 0x165, script: 0x5a, flags: 0x0},
-	644:  {region: 0x165, script: 0x5a, flags: 0x0},
-	645:  {region: 0x165, script: 0x2c, flags: 0x0},
-	646:  {region: 0x123, script: 0xe6, flags: 0x0},
-	647:  {region: 0xe8, script: 0x5, flags: 0x0},
-	648:  {region: 0x165, script: 0x5a, flags: 0x0},
-	649:  {region: 0x165, script: 0x5a, flags: 0x0},
-	650:  {region: 0x1c, script: 0x5, flags: 0x1},
-	651:  {region: 0x165, script: 0x5a, flags: 0x0},
-	652:  {region: 0x165, script: 0x5a, flags: 0x0},
-	653:  {region: 0x165, script: 0x5a, flags: 0x0},
-	654:  {region: 0x138, script: 0x5a, flags: 0x0},
-	655:  {region: 0x87, script: 0x5e, flags: 0x0},
-	656:  {region: 0x97, script: 0x3e, flags: 0x0},
-	657:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	658:  {region: 0xe8, script: 0x5, flags: 0x0},
-	659:  {region: 0x131, script: 0x5a, flags: 0x0},
-	660:  {region: 0x165, script: 0x5a, flags: 0x0},
-	661:  {region: 0xb7, script: 0x5a, flags: 0x0},
-	662:  {region: 0x106, script: 0x20, flags: 0x0},
-	663:  {region: 0x165, script: 0x5a, flags: 0x0},
-	664:  {region: 0x95, script: 0x5a, flags: 0x0},
-	665:  {region: 0x165, script: 0x5a, flags: 0x0},
-	666:  {region: 0x53, script: 0xe6, flags: 0x0},
-	667:  {region: 0x165, script: 0x5a, flags: 0x0},
-	668:  {region: 0x165, script: 0x5a, flags: 0x0},
-	669:  {region: 0x165, script: 0x5a, flags: 0x0},
-	670:  {region: 0x165, script: 0x5a, flags: 0x0},
-	671:  {region: 0x99, script: 0x5c, flags: 0x0},
-	672:  {region: 0x165, script: 0x5a, flags: 0x0},
-	673:  {region: 0x165, script: 0x5a, flags: 0x0},
-	674:  {region: 0x106, script: 0x20, flags: 0x0},
-	675:  {region: 0x131, script: 0x5a, flags: 0x0},
-	676:  {region: 0x165, script: 0x5a, flags: 0x0},
-	677:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	678:  {region: 0x165, script: 0x5a, flags: 0x0},
-	679:  {region: 0x165, script: 0x5a, flags: 0x0},
-	680:  {region: 0x21, script: 0x2, flags: 0x1},
-	681:  {region: 0x165, script: 0x5a, flags: 0x0},
-	682:  {region: 0x165, script: 0x5a, flags: 0x0},
-	683:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	684:  {region: 0x53, script: 0x60, flags: 0x0},
-	685:  {region: 0x95, script: 0x5a, flags: 0x0},
-	686:  {region: 0x9c, script: 0x5, flags: 0x0},
-	687:  {region: 0x135, script: 0x5a, flags: 0x0},
-	688:  {region: 0x165, script: 0x5a, flags: 0x0},
-	689:  {region: 0x165, script: 0x5a, flags: 0x0},
-	690:  {region: 0x99, script: 0xe1, flags: 0x0},
-	691:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	692:  {region: 0x165, script: 0x5a, flags: 0x0},
-	693:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	694:  {region: 0x165, script: 0x5a, flags: 0x0},
-	695:  {region: 0x165, script: 0x5a, flags: 0x0},
-	696:  {region: 0xaf, script: 0x57, flags: 0x0},
-	697:  {region: 0x165, script: 0x5a, flags: 0x0},
-	698:  {region: 0x165, script: 0x5a, flags: 0x0},
-	699:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	700:  {region: 0x165, script: 0x5a, flags: 0x0},
-	701:  {region: 0x165, script: 0x5a, flags: 0x0},
-	702:  {region: 0x162, script: 0x5a, flags: 0x0},
-	703:  {region: 0x9c, script: 0x5, flags: 0x0},
-	704:  {region: 0xb6, script: 0x5a, flags: 0x0},
-	705:  {region: 0xb8, script: 0x5a, flags: 0x0},
-	706:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	707:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	708:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	709:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	710:  {region: 0x9c, script: 0x5, flags: 0x0},
-	711:  {region: 0xb8, script: 0x5a, flags: 0x0},
-	712:  {region: 0x123, script: 0xe6, flags: 0x0},
-	713:  {region: 0x53, script: 0x3b, flags: 0x0},
-	714:  {region: 0x12b, script: 0x5a, flags: 0x0},
-	715:  {region: 0x95, script: 0x5a, flags: 0x0},
-	716:  {region: 0x52, script: 0x5a, flags: 0x0},
-	717:  {region: 0x99, script: 0x22, flags: 0x0},
-	718:  {region: 0x99, script: 0x22, flags: 0x0},
-	719:  {region: 0x95, script: 0x5a, flags: 0x0},
-	720:  {region: 0x23, script: 0x3, flags: 0x1},
-	721:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	722:  {region: 0x165, script: 0x5a, flags: 0x0},
-	723:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	724:  {region: 0x165, script: 0x5a, flags: 0x0},
-	725:  {region: 0x165, script: 0x5a, flags: 0x0},
-	726:  {region: 0x165, script: 0x5a, flags: 0x0},
-	727:  {region: 0x165, script: 0x5a, flags: 0x0},
-	728:  {region: 0x165, script: 0x5a, flags: 0x0},
-	729:  {region: 0x165, script: 0x5a, flags: 0x0},
-	730:  {region: 0x165, script: 0x5a, flags: 0x0},
-	731:  {region: 0x165, script: 0x5a, flags: 0x0},
-	732:  {region: 0x165, script: 0x5a, flags: 0x0},
-	733:  {region: 0x165, script: 0x5a, flags: 0x0},
-	734:  {region: 0x165, script: 0x5a, flags: 0x0},
-	735:  {region: 0x165, script: 0x5, flags: 0x0},
-	736:  {region: 0x106, script: 0x20, flags: 0x0},
-	737:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	738:  {region: 0x165, script: 0x5a, flags: 0x0},
-	739:  {region: 0x95, script: 0x5a, flags: 0x0},
-	740:  {region: 0x165, script: 0x2c, flags: 0x0},
-	741:  {region: 0x165, script: 0x5a, flags: 0x0},
-	742:  {region: 0x165, script: 0x5a, flags: 0x0},
-	743:  {region: 0x165, script: 0x5a, flags: 0x0},
-	744:  {region: 0x112, script: 0x5a, flags: 0x0},
-	745:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	746:  {region: 0x165, script: 0x5a, flags: 0x0},
-	747:  {region: 0x165, script: 0x5a, flags: 0x0},
-	748:  {region: 0x123, script: 0x5, flags: 0x0},
-	749:  {region: 0xcc, script: 0x5a, flags: 0x0},
-	750:  {region: 0x165, script: 0x5a, flags: 0x0},
-	751:  {region: 0x165, script: 0x5a, flags: 0x0},
-	752:  {region: 0x165, script: 0x5a, flags: 0x0},
-	753:  {region: 0xbf, script: 0x5a, flags: 0x0},
-	754:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	755:  {region: 0x165, script: 0x5a, flags: 0x0},
-	756:  {region: 0x52, script: 0x5a, flags: 0x0},
-	757:  {region: 0xdb, script: 0x22, flags: 0x0},
-	758:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	759:  {region: 0xc0, script: 0x5a, flags: 0x0},
-	760:  {region: 0x165, script: 0x5a, flags: 0x0},
-	761:  {region: 0x165, script: 0x5a, flags: 0x0},
-	762:  {region: 0xe0, script: 0x5a, flags: 0x0},
-	763:  {region: 0x165, script: 0x5a, flags: 0x0},
-	764:  {region: 0x95, script: 0x5a, flags: 0x0},
-	765:  {region: 0x9b, script: 0x3d, flags: 0x0},
-	766:  {region: 0x165, script: 0x5a, flags: 0x0},
-	767:  {region: 0xc2, script: 0x20, flags: 0x0},
-	768:  {region: 0x165, script: 0x5, flags: 0x0},
-	769:  {region: 0x165, script: 0x5a, flags: 0x0},
-	770:  {region: 0x165, script: 0x5a, flags: 0x0},
-	771:  {region: 0x165, script: 0x5a, flags: 0x0},
-	772:  {region: 0x99, script: 0x6e, flags: 0x0},
-	773:  {region: 0x165, script: 0x5a, flags: 0x0},
-	774:  {region: 0x165, script: 0x5a, flags: 0x0},
-	775:  {region: 0x10b, script: 0x5a, flags: 0x0},
-	776:  {region: 0x165, script: 0x5a, flags: 0x0},
-	777:  {region: 0x165, script: 0x5a, flags: 0x0},
-	778:  {region: 0x165, script: 0x5a, flags: 0x0},
-	779:  {region: 0x26, script: 0x3, flags: 0x1},
-	780:  {region: 0x165, script: 0x5a, flags: 0x0},
-	781:  {region: 0x165, script: 0x5a, flags: 0x0},
-	782:  {region: 0x99, script: 0xe, flags: 0x0},
-	783:  {region: 0xc4, script: 0x75, flags: 0x0},
-	785:  {region: 0x165, script: 0x5a, flags: 0x0},
-	786:  {region: 0x49, script: 0x5a, flags: 0x0},
-	787:  {region: 0x49, script: 0x5a, flags: 0x0},
-	788:  {region: 0x37, script: 0x5a, flags: 0x0},
-	789:  {region: 0x165, script: 0x5a, flags: 0x0},
-	790:  {region: 0x165, script: 0x5a, flags: 0x0},
-	791:  {region: 0x165, script: 0x5a, flags: 0x0},
-	792:  {region: 0x165, script: 0x5a, flags: 0x0},
-	793:  {region: 0x165, script: 0x5a, flags: 0x0},
-	794:  {region: 0x165, script: 0x5a, flags: 0x0},
-	795:  {region: 0x99, script: 0x22, flags: 0x0},
-	796:  {region: 0xdb, script: 0x22, flags: 0x0},
-	797:  {region: 0x106, script: 0x20, flags: 0x0},
-	798:  {region: 0x35, script: 0x72, flags: 0x0},
-	799:  {region: 0x29, script: 0x3, flags: 0x1},
-	800:  {region: 0xcb, script: 0x5a, flags: 0x0},
-	801:  {region: 0x165, script: 0x5a, flags: 0x0},
-	802:  {region: 0x165, script: 0x5a, flags: 0x0},
-	803:  {region: 0x165, script: 0x5a, flags: 0x0},
-	804:  {region: 0x99, script: 0x22, flags: 0x0},
-	805:  {region: 0x52, script: 0x5a, flags: 0x0},
-	807:  {region: 0x165, script: 0x5a, flags: 0x0},
-	808:  {region: 0x135, script: 0x5a, flags: 0x0},
-	809:  {region: 0x165, script: 0x5a, flags: 0x0},
-	810:  {region: 0x165, script: 0x5a, flags: 0x0},
-	811:  {region: 0xe8, script: 0x5, flags: 0x0},
-	812:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	813:  {region: 0x99, script: 0x22, flags: 0x0},
-	814:  {region: 0x95, script: 0x5a, flags: 0x0},
-	815:  {region: 0x164, script: 0x5a, flags: 0x0},
-	816:  {region: 0x165, script: 0x5a, flags: 0x0},
-	817:  {region: 0xc4, script: 0x75, flags: 0x0},
-	818:  {region: 0x165, script: 0x5a, flags: 0x0},
-	819:  {region: 0x165, script: 0x2c, flags: 0x0},
-	820:  {region: 0x106, script: 0x20, flags: 0x0},
-	821:  {region: 0x165, script: 0x5a, flags: 0x0},
-	822:  {region: 0x131, script: 0x5a, flags: 0x0},
-	823:  {region: 0x9c, script: 0x66, flags: 0x0},
-	824:  {region: 0x165, script: 0x5a, flags: 0x0},
-	825:  {region: 0x165, script: 0x5a, flags: 0x0},
-	826:  {region: 0x9c, script: 0x5, flags: 0x0},
-	827:  {region: 0x165, script: 0x5a, flags: 0x0},
-	828:  {region: 0x165, script: 0x5a, flags: 0x0},
-	829:  {region: 0x165, script: 0x5a, flags: 0x0},
-	830:  {region: 0xdd, script: 0x5a, flags: 0x0},
-	831:  {region: 0x165, script: 0x5a, flags: 0x0},
-	832:  {region: 0x165, script: 0x5a, flags: 0x0},
-	834:  {region: 0x165, script: 0x5a, flags: 0x0},
-	835:  {region: 0x53, script: 0x3b, flags: 0x0},
-	836:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	837:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	838:  {region: 0x165, script: 0x5a, flags: 0x0},
-	839:  {region: 0xda, script: 0x5a, flags: 0x0},
-	840:  {region: 0x165, script: 0x5a, flags: 0x0},
-	841:  {region: 0x165, script: 0x5a, flags: 0x0},
-	842:  {region: 0x165, script: 0x5a, flags: 0x0},
-	843:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	844:  {region: 0x165, script: 0x5a, flags: 0x0},
-	845:  {region: 0x165, script: 0x5a, flags: 0x0},
-	846:  {region: 0x164, script: 0x5a, flags: 0x0},
-	847:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	848:  {region: 0x60, script: 0x5a, flags: 0x0},
-	849:  {region: 0xdb, script: 0x22, flags: 0x0},
-	850:  {region: 0x165, script: 0x5a, flags: 0x0},
-	851:  {region: 0xdb, script: 0x22, flags: 0x0},
-	852:  {region: 0x165, script: 0x5a, flags: 0x0},
-	853:  {region: 0x165, script: 0x5a, flags: 0x0},
-	854:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	855:  {region: 0x165, script: 0x5a, flags: 0x0},
-	856:  {region: 0x165, script: 0x5a, flags: 0x0},
-	857:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	858:  {region: 0x165, script: 0x5a, flags: 0x0},
-	859:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	860:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	861:  {region: 0x165, script: 0x5a, flags: 0x0},
-	862:  {region: 0x165, script: 0x5a, flags: 0x0},
-	863:  {region: 0x95, script: 0x5a, flags: 0x0},
-	864:  {region: 0x165, script: 0x5a, flags: 0x0},
-	865:  {region: 0xdf, script: 0x5a, flags: 0x0},
-	866:  {region: 0x165, script: 0x5a, flags: 0x0},
-	867:  {region: 0x165, script: 0x5a, flags: 0x0},
-	868:  {region: 0x99, script: 0x5a, flags: 0x0},
-	869:  {region: 0x165, script: 0x5a, flags: 0x0},
-	870:  {region: 0x165, script: 0x5a, flags: 0x0},
-	871:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	872:  {region: 0x52, script: 0x5a, flags: 0x0},
-	873:  {region: 0x165, script: 0x5a, flags: 0x0},
-	874:  {region: 0xda, script: 0x5a, flags: 0x0},
-	875:  {region: 0x165, script: 0x5a, flags: 0x0},
-	876:  {region: 0x52, script: 0x5a, flags: 0x0},
-	877:  {region: 0x165, script: 0x5a, flags: 0x0},
-	878:  {region: 0x165, script: 0x5a, flags: 0x0},
-	879:  {region: 0xda, script: 0x5a, flags: 0x0},
-	880:  {region: 0x123, script: 0x56, flags: 0x0},
-	881:  {region: 0x99, script: 0x22, flags: 0x0},
-	882:  {region: 0x10c, script: 0xc4, flags: 0x0},
-	883:  {region: 0x165, script: 0x5a, flags: 0x0},
-	884:  {region: 0x165, script: 0x5a, flags: 0x0},
-	885:  {region: 0x84, script: 0x7c, flags: 0x0},
-	886:  {region: 0x161, script: 0x5a, flags: 0x0},
-	887:  {region: 0x165, script: 0x5a, flags: 0x0},
-	888:  {region: 0x49, script: 0x17, flags: 0x0},
-	889:  {region: 0x165, script: 0x5a, flags: 0x0},
-	890:  {region: 0x161, script: 0x5a, flags: 0x0},
-	891:  {region: 0x165, script: 0x5a, flags: 0x0},
-	892:  {region: 0x165, script: 0x5a, flags: 0x0},
-	893:  {region: 0x165, script: 0x5a, flags: 0x0},
-	894:  {region: 0x165, script: 0x5a, flags: 0x0},
-	895:  {region: 0x165, script: 0x5a, flags: 0x0},
-	896:  {region: 0x117, script: 0x5a, flags: 0x0},
-	897:  {region: 0x165, script: 0x5a, flags: 0x0},
-	898:  {region: 0x165, script: 0x5a, flags: 0x0},
-	899:  {region: 0x135, script: 0x5a, flags: 0x0},
-	900:  {region: 0x165, script: 0x5a, flags: 0x0},
-	901:  {region: 0x53, script: 0x5a, flags: 0x0},
-	902:  {region: 0x165, script: 0x5a, flags: 0x0},
-	903:  {region: 0xce, script: 0x5a, flags: 0x0},
-	904:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	905:  {region: 0x131, script: 0x5a, flags: 0x0},
-	906:  {region: 0x80, script: 0x5a, flags: 0x0},
-	907:  {region: 0x78, script: 0x5a, flags: 0x0},
-	908:  {region: 0x165, script: 0x5a, flags: 0x0},
-	910:  {region: 0x165, script: 0x5a, flags: 0x0},
-	911:  {region: 0x165, script: 0x5a, flags: 0x0},
-	912:  {region: 0x6f, script: 0x5a, flags: 0x0},
-	913:  {region: 0x165, script: 0x5a, flags: 0x0},
-	914:  {region: 0x165, script: 0x5a, flags: 0x0},
-	915:  {region: 0x165, script: 0x5a, flags: 0x0},
-	916:  {region: 0x165, script: 0x5a, flags: 0x0},
-	917:  {region: 0x99, script: 0x81, flags: 0x0},
-	918:  {region: 0x165, script: 0x5a, flags: 0x0},
-	919:  {region: 0x165, script: 0x5, flags: 0x0},
-	920:  {region: 0x7d, script: 0x20, flags: 0x0},
-	921:  {region: 0x135, script: 0x82, flags: 0x0},
-	922:  {region: 0x165, script: 0x5, flags: 0x0},
-	923:  {region: 0xc5, script: 0x80, flags: 0x0},
-	924:  {region: 0x165, script: 0x5a, flags: 0x0},
-	925:  {region: 0x2c, script: 0x3, flags: 0x1},
-	926:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	927:  {region: 0x2f, script: 0x2, flags: 0x1},
-	928:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	929:  {region: 0x30, script: 0x5a, flags: 0x0},
-	930:  {region: 0xf0, script: 0x5a, flags: 0x0},
-	931:  {region: 0x165, script: 0x5a, flags: 0x0},
-	932:  {region: 0x78, script: 0x5a, flags: 0x0},
-	933:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	934:  {region: 0x135, script: 0x5a, flags: 0x0},
-	935:  {region: 0x49, script: 0x5a, flags: 0x0},
-	936:  {region: 0x165, script: 0x5a, flags: 0x0},
-	937:  {region: 0x9c, script: 0xf0, flags: 0x0},
-	938:  {region: 0x165, script: 0x5a, flags: 0x0},
-	939:  {region: 0x60, script: 0x5a, flags: 0x0},
-	940:  {region: 0x165, script: 0x5, flags: 0x0},
-	941:  {region: 0xb0, script: 0x8b, flags: 0x0},
-	943:  {region: 0x165, script: 0x5a, flags: 0x0},
-	944:  {region: 0x165, script: 0x5a, flags: 0x0},
-	945:  {region: 0x99, script: 0x12, flags: 0x0},
-	946:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	947:  {region: 0xe9, script: 0x5a, flags: 0x0},
-	948:  {region: 0x165, script: 0x5a, flags: 0x0},
-	949:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	950:  {region: 0x165, script: 0x5a, flags: 0x0},
-	951:  {region: 0x165, script: 0x5a, flags: 0x0},
-	952:  {region: 0x87, script: 0x34, flags: 0x0},
-	953:  {region: 0x75, script: 0x5a, flags: 0x0},
-	954:  {region: 0x165, script: 0x5a, flags: 0x0},
-	955:  {region: 0xe8, script: 0x4d, flags: 0x0},
-	956:  {region: 0x9c, script: 0x5, flags: 0x0},
-	957:  {region: 0x1, script: 0x5a, flags: 0x0},
-	958:  {region: 0x24, script: 0x5, flags: 0x0},
-	959:  {region: 0x165, script: 0x5a, flags: 0x0},
-	960:  {region: 0x41, script: 0x5a, flags: 0x0},
-	961:  {region: 0x165, script: 0x5a, flags: 0x0},
-	962:  {region: 0x7a, script: 0x5a, flags: 0x0},
-	963:  {region: 0x165, script: 0x5a, flags: 0x0},
-	964:  {region: 0xe4, script: 0x5a, flags: 0x0},
-	965:  {region: 0x89, script: 0x5a, flags: 0x0},
-	966:  {region: 0x69, script: 0x5a, flags: 0x0},
-	967:  {region: 0x165, script: 0x5a, flags: 0x0},
-	968:  {region: 0x99, script: 0x22, flags: 0x0},
-	969:  {region: 0x165, script: 0x5a, flags: 0x0},
-	970:  {region: 0x102, script: 0x5a, flags: 0x0},
-	971:  {region: 0x95, script: 0x5a, flags: 0x0},
-	972:  {region: 0x165, script: 0x5a, flags: 0x0},
-	973:  {region: 0x165, script: 0x5a, flags: 0x0},
-	974:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	975:  {region: 0x165, script: 0x5, flags: 0x0},
-	976:  {region: 0x99, script: 0x5a, flags: 0x0},
-	977:  {region: 0x31, script: 0x2, flags: 0x1},
-	978:  {region: 0xdb, script: 0x22, flags: 0x0},
-	979:  {region: 0x35, script: 0xe, flags: 0x0},
-	980:  {region: 0x4e, script: 0x5a, flags: 0x0},
-	981:  {region: 0x72, script: 0x5a, flags: 0x0},
-	982:  {region: 0x4e, script: 0x5a, flags: 0x0},
-	983:  {region: 0x9c, script: 0x5, flags: 0x0},
-	984:  {region: 0x10c, script: 0x5a, flags: 0x0},
-	985:  {region: 0x3a, script: 0x5a, flags: 0x0},
-	986:  {region: 0x165, script: 0x5a, flags: 0x0},
-	987:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	988:  {region: 0x104, script: 0x5a, flags: 0x0},
-	989:  {region: 0x95, script: 0x5a, flags: 0x0},
-	990:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	991:  {region: 0x165, script: 0x5a, flags: 0x0},
-	992:  {region: 0x165, script: 0x5a, flags: 0x0},
-	993:  {region: 0x73, script: 0x5a, flags: 0x0},
-	994:  {region: 0x106, script: 0x20, flags: 0x0},
-	995:  {region: 0x130, script: 0x20, flags: 0x0},
-	996:  {region: 0x109, script: 0x5a, flags: 0x0},
-	997:  {region: 0x107, script: 0x5a, flags: 0x0},
-	998:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	999:  {region: 0x165, script: 0x5a, flags: 0x0},
-	1000: {region: 0xa2, script: 0x4c, flags: 0x0},
-	1001: {region: 0x99, script: 0x22, flags: 0x0},
-	1002: {region: 0x80, script: 0x5a, flags: 0x0},
-	1003: {region: 0x106, script: 0x20, flags: 0x0},
-	1004: {region: 0xa4, script: 0x5a, flags: 0x0},
-	1005: {region: 0x95, script: 0x5a, flags: 0x0},
-	1006: {region: 0x99, script: 0x5a, flags: 0x0},
-	1007: {region: 0x114, script: 0x5a, flags: 0x0},
-	1008: {region: 0x99, script: 0xc8, flags: 0x0},
-	1009: {region: 0x165, script: 0x5a, flags: 0x0},
-	1010: {region: 0x165, script: 0x5a, flags: 0x0},
-	1011: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1012: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1013: {region: 0x99, script: 0x22, flags: 0x0},
-	1014: {region: 0x165, script: 0x5, flags: 0x0},
-	1015: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1016: {region: 0x7b, script: 0x5a, flags: 0x0},
-	1017: {region: 0x49, script: 0x5a, flags: 0x0},
-	1018: {region: 0x33, script: 0x4, flags: 0x1},
-	1019: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1020: {region: 0x9c, script: 0x5, flags: 0x0},
-	1021: {region: 0xda, script: 0x5a, flags: 0x0},
-	1022: {region: 0x4f, script: 0x5a, flags: 0x0},
-	1023: {region: 0xd1, script: 0x5a, flags: 0x0},
-	1024: {region: 0xcf, script: 0x5a, flags: 0x0},
-	1025: {region: 0xc3, script: 0x5a, flags: 0x0},
-	1026: {region: 0x4c, script: 0x5a, flags: 0x0},
-	1027: {region: 0x96, script: 0x7e, flags: 0x0},
-	1028: {region: 0xb6, script: 0x5a, flags: 0x0},
-	1029: {region: 0x165, script: 0x2c, flags: 0x0},
-	1030: {region: 0x165, script: 0x5a, flags: 0x0},
-	1032: {region: 0xba, script: 0xe3, flags: 0x0},
-	1033: {region: 0x165, script: 0x5a, flags: 0x0},
-	1034: {region: 0xc4, script: 0x75, flags: 0x0},
-	1035: {region: 0x165, script: 0x5, flags: 0x0},
-	1036: {region: 0xb3, script: 0xcf, flags: 0x0},
-	1037: {region: 0x6f, script: 0x5a, flags: 0x0},
-	1038: {region: 0x165, script: 0x5a, flags: 0x0},
-	1039: {region: 0x165, script: 0x5a, flags: 0x0},
-	1040: {region: 0x165, script: 0x5a, flags: 0x0},
-	1041: {region: 0x165, script: 0x5a, flags: 0x0},
-	1042: {region: 0x111, script: 0x5a, flags: 0x0},
-	1043: {region: 0x165, script: 0x5a, flags: 0x0},
-	1044: {region: 0xe8, script: 0x5, flags: 0x0},
-	1045: {region: 0x165, script: 0x5a, flags: 0x0},
-	1046: {region: 0x10f, script: 0x5a, flags: 0x0},
-	1047: {region: 0x165, script: 0x5a, flags: 0x0},
-	1048: {region: 0xe9, script: 0x5a, flags: 0x0},
-	1049: {region: 0x165, script: 0x5a, flags: 0x0},
-	1050: {region: 0x95, script: 0x5a, flags: 0x0},
-	1051: {region: 0x142, script: 0x5a, flags: 0x0},
-	1052: {region: 0x10c, script: 0x5a, flags: 0x0},
-	1054: {region: 0x10c, script: 0x5a, flags: 0x0},
-	1055: {region: 0x72, script: 0x5a, flags: 0x0},
-	1056: {region: 0x97, script: 0xc5, flags: 0x0},
-	1057: {region: 0x165, script: 0x5a, flags: 0x0},
-	1058: {region: 0x72, script: 0x5a, flags: 0x0},
-	1059: {region: 0x164, script: 0x5a, flags: 0x0},
-	1060: {region: 0x165, script: 0x5a, flags: 0x0},
-	1061: {region: 0xc3, script: 0x5a, flags: 0x0},
-	1062: {region: 0x165, script: 0x5a, flags: 0x0},
-	1063: {region: 0x165, script: 0x5a, flags: 0x0},
-	1064: {region: 0x165, script: 0x5a, flags: 0x0},
-	1065: {region: 0x115, script: 0x5a, flags: 0x0},
-	1066: {region: 0x165, script: 0x5a, flags: 0x0},
-	1067: {region: 0x165, script: 0x5a, flags: 0x0},
-	1068: {region: 0x123, script: 0xe6, flags: 0x0},
-	1069: {region: 0x165, script: 0x5a, flags: 0x0},
-	1070: {region: 0x165, script: 0x5a, flags: 0x0},
-	1071: {region: 0x165, script: 0x5a, flags: 0x0},
-	1072: {region: 0x165, script: 0x5a, flags: 0x0},
-	1073: {region: 0x27, script: 0x5a, flags: 0x0},
-	1074: {region: 0x37, script: 0x5, flags: 0x1},
-	1075: {region: 0x99, script: 0xd2, flags: 0x0},
-	1076: {region: 0x116, script: 0x5a, flags: 0x0},
-	1077: {region: 0x114, script: 0x5a, flags: 0x0},
-	1078: {region: 0x99, script: 0x22, flags: 0x0},
-	1079: {region: 0x161, script: 0x5a, flags: 0x0},
-	1080: {region: 0x165, script: 0x5a, flags: 0x0},
-	1081: {region: 0x165, script: 0x5a, flags: 0x0},
-	1082: {region: 0x6d, script: 0x5a, flags: 0x0},
-	1083: {region: 0x161, script: 0x5a, flags: 0x0},
-	1084: {region: 0x165, script: 0x5a, flags: 0x0},
-	1085: {region: 0x60, script: 0x5a, flags: 0x0},
-	1086: {region: 0x95, script: 0x5a, flags: 0x0},
-	1087: {region: 0x165, script: 0x5a, flags: 0x0},
-	1088: {region: 0x165, script: 0x5a, flags: 0x0},
-	1089: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1090: {region: 0x165, script: 0x5a, flags: 0x0},
-	1091: {region: 0x84, script: 0x5a, flags: 0x0},
-	1092: {region: 0x10c, script: 0x5a, flags: 0x0},
-	1093: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1094: {region: 0x15f, script: 0x5, flags: 0x0},
-	1095: {region: 0x4b, script: 0x5a, flags: 0x0},
-	1096: {region: 0x60, script: 0x5a, flags: 0x0},
-	1097: {region: 0x165, script: 0x5a, flags: 0x0},
-	1098: {region: 0x99, script: 0x22, flags: 0x0},
-	1099: {region: 0x95, script: 0x5a, flags: 0x0},
-	1100: {region: 0x165, script: 0x5a, flags: 0x0},
-	1101: {region: 0x35, script: 0xe, flags: 0x0},
-	1102: {region: 0x9b, script: 0xd6, flags: 0x0},
-	1103: {region: 0xe9, script: 0x5a, flags: 0x0},
-	1104: {region: 0x99, script: 0xde, flags: 0x0},
-	1105: {region: 0xdb, script: 0x22, flags: 0x0},
-	1106: {region: 0x165, script: 0x5a, flags: 0x0},
-	1107: {region: 0x165, script: 0x5a, flags: 0x0},
-	1108: {region: 0x165, script: 0x5a, flags: 0x0},
-	1109: {region: 0x165, script: 0x5a, flags: 0x0},
-	1110: {region: 0x165, script: 0x5a, flags: 0x0},
-	1111: {region: 0x165, script: 0x5a, flags: 0x0},
-	1112: {region: 0x165, script: 0x5a, flags: 0x0},
-	1113: {region: 0x165, script: 0x5a, flags: 0x0},
-	1114: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1115: {region: 0x165, script: 0x5a, flags: 0x0},
-	1116: {region: 0x165, script: 0x5a, flags: 0x0},
-	1117: {region: 0x99, script: 0x52, flags: 0x0},
-	1118: {region: 0x53, script: 0xdc, flags: 0x0},
-	1119: {region: 0xdb, script: 0x22, flags: 0x0},
-	1120: {region: 0xdb, script: 0x22, flags: 0x0},
-	1121: {region: 0x99, script: 0xe1, flags: 0x0},
-	1122: {region: 0x165, script: 0x5a, flags: 0x0},
-	1123: {region: 0x112, script: 0x5a, flags: 0x0},
-	1124: {region: 0x131, script: 0x5a, flags: 0x0},
-	1125: {region: 0x126, script: 0x5a, flags: 0x0},
-	1126: {region: 0x165, script: 0x5a, flags: 0x0},
-	1127: {region: 0x3c, script: 0x3, flags: 0x1},
-	1128: {region: 0x165, script: 0x5a, flags: 0x0},
-	1129: {region: 0x165, script: 0x5a, flags: 0x0},
-	1130: {region: 0x165, script: 0x5a, flags: 0x0},
-	1131: {region: 0x123, script: 0xe6, flags: 0x0},
-	1132: {region: 0xdb, script: 0x22, flags: 0x0},
-	1133: {region: 0xdb, script: 0x22, flags: 0x0},
-	1134: {region: 0xdb, script: 0x22, flags: 0x0},
-	1135: {region: 0x6f, script: 0x2c, flags: 0x0},
-	1136: {region: 0x165, script: 0x5a, flags: 0x0},
-	1137: {region: 0x6d, script: 0x2c, flags: 0x0},
-	1138: {region: 0x165, script: 0x5a, flags: 0x0},
-	1139: {region: 0x165, script: 0x5a, flags: 0x0},
-	1140: {region: 0x165, script: 0x5a, flags: 0x0},
-	1141: {region: 0xd6, script: 0x5a, flags: 0x0},
-	1142: {region: 0x127, script: 0x5a, flags: 0x0},
-	1143: {region: 0x125, script: 0x5a, flags: 0x0},
-	1144: {region: 0x32, script: 0x5a, flags: 0x0},
-	1145: {region: 0xdb, script: 0x22, flags: 0x0},
-	1146: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1147: {region: 0x165, script: 0x5a, flags: 0x0},
-	1148: {region: 0x165, script: 0x5a, flags: 0x0},
-	1149: {region: 0x32, script: 0x5a, flags: 0x0},
-	1150: {region: 0xd4, script: 0x5a, flags: 0x0},
-	1151: {region: 0x165, script: 0x5a, flags: 0x0},
-	1152: {region: 0x161, script: 0x5a, flags: 0x0},
-	1153: {region: 0x165, script: 0x5a, flags: 0x0},
-	1154: {region: 0x129, script: 0x5a, flags: 0x0},
-	1155: {region: 0x165, script: 0x5a, flags: 0x0},
-	1156: {region: 0xce, script: 0x5a, flags: 0x0},
-	1157: {region: 0x165, script: 0x5a, flags: 0x0},
-	1158: {region: 0xe6, script: 0x5a, flags: 0x0},
-	1159: {region: 0x165, script: 0x5a, flags: 0x0},
-	1160: {region: 0x165, script: 0x5a, flags: 0x0},
-	1161: {region: 0x165, script: 0x5a, flags: 0x0},
-	1162: {region: 0x12b, script: 0x5a, flags: 0x0},
-	1163: {region: 0x12b, script: 0x5a, flags: 0x0},
-	1164: {region: 0x12e, script: 0x5a, flags: 0x0},
-	1165: {region: 0x165, script: 0x5, flags: 0x0},
-	1166: {region: 0x161, script: 0x5a, flags: 0x0},
-	1167: {region: 0x87, script: 0x34, flags: 0x0},
-	1168: {region: 0xdb, script: 0x22, flags: 0x0},
-	1169: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1170: {region: 0x43, script: 0xe7, flags: 0x0},
-	1171: {region: 0x165, script: 0x5a, flags: 0x0},
-	1172: {region: 0x106, script: 0x20, flags: 0x0},
-	1173: {region: 0x165, script: 0x5a, flags: 0x0},
-	1174: {region: 0x165, script: 0x5a, flags: 0x0},
-	1175: {region: 0x131, script: 0x5a, flags: 0x0},
-	1176: {region: 0x165, script: 0x5a, flags: 0x0},
-	1177: {region: 0x123, script: 0xe6, flags: 0x0},
-	1178: {region: 0x32, script: 0x5a, flags: 0x0},
-	1179: {region: 0x165, script: 0x5a, flags: 0x0},
-	1180: {region: 0x165, script: 0x5a, flags: 0x0},
-	1181: {region: 0xce, script: 0x5a, flags: 0x0},
-	1182: {region: 0x165, script: 0x5a, flags: 0x0},
-	1183: {region: 0x165, script: 0x5a, flags: 0x0},
-	1184: {region: 0x12d, script: 0x5a, flags: 0x0},
-	1185: {region: 0x165, script: 0x5a, flags: 0x0},
-	1187: {region: 0x165, script: 0x5a, flags: 0x0},
-	1188: {region: 0xd4, script: 0x5a, flags: 0x0},
-	1189: {region: 0x53, script: 0xdf, flags: 0x0},
-	1190: {region: 0xe5, script: 0x5a, flags: 0x0},
-	1191: {region: 0x165, script: 0x5a, flags: 0x0},
-	1192: {region: 0x106, script: 0x20, flags: 0x0},
-	1193: {region: 0xba, script: 0x5a, flags: 0x0},
-	1194: {region: 0x165, script: 0x5a, flags: 0x0},
-	1195: {region: 0x106, script: 0x20, flags: 0x0},
-	1196: {region: 0x3f, script: 0x4, flags: 0x1},
-	1197: {region: 0x11c, script: 0xea, flags: 0x0},
-	1198: {region: 0x130, script: 0x20, flags: 0x0},
-	1199: {region: 0x75, script: 0x5a, flags: 0x0},
-	1200: {region: 0x2a, script: 0x5a, flags: 0x0},
-	1202: {region: 0x43, script: 0x3, flags: 0x1},
-	1203: {region: 0x99, script: 0xe, flags: 0x0},
-	1204: {region: 0xe8, script: 0x5, flags: 0x0},
-	1205: {region: 0x165, script: 0x5a, flags: 0x0},
-	1206: {region: 0x165, script: 0x5a, flags: 0x0},
-	1207: {region: 0x165, script: 0x5a, flags: 0x0},
-	1208: {region: 0x165, script: 0x5a, flags: 0x0},
-	1209: {region: 0x165, script: 0x5a, flags: 0x0},
-	1210: {region: 0x165, script: 0x5a, flags: 0x0},
-	1211: {region: 0x165, script: 0x5a, flags: 0x0},
-	1212: {region: 0x46, script: 0x4, flags: 0x1},
-	1213: {region: 0x165, script: 0x5a, flags: 0x0},
-	1214: {region: 0xb4, script: 0xeb, flags: 0x0},
-	1215: {region: 0x165, script: 0x5a, flags: 0x0},
-	1216: {region: 0x161, script: 0x5a, flags: 0x0},
-	1217: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1218: {region: 0x106, script: 0x5a, flags: 0x0},
-	1219: {region: 0x13e, script: 0x5a, flags: 0x0},
-	1220: {region: 0x11b, script: 0x5a, flags: 0x0},
-	1221: {region: 0x165, script: 0x5a, flags: 0x0},
-	1222: {region: 0x36, script: 0x5a, flags: 0x0},
-	1223: {region: 0x60, script: 0x5a, flags: 0x0},
-	1224: {region: 0xd1, script: 0x5a, flags: 0x0},
-	1225: {region: 0x1, script: 0x5a, flags: 0x0},
-	1226: {region: 0x106, script: 0x5a, flags: 0x0},
-	1227: {region: 0x6a, script: 0x5a, flags: 0x0},
-	1228: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1229: {region: 0x165, script: 0x5a, flags: 0x0},
-	1230: {region: 0x36, script: 0x5a, flags: 0x0},
-	1231: {region: 0x4e, script: 0x5a, flags: 0x0},
-	1232: {region: 0x165, script: 0x5a, flags: 0x0},
-	1233: {region: 0x6f, script: 0x2c, flags: 0x0},
-	1234: {region: 0x165, script: 0x5a, flags: 0x0},
-	1235: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1236: {region: 0x2f, script: 0x5a, flags: 0x0},
-	1237: {region: 0x99, script: 0xe1, flags: 0x0},
-	1238: {region: 0x99, script: 0x22, flags: 0x0},
-	1239: {region: 0x165, script: 0x5a, flags: 0x0},
-	1240: {region: 0x165, script: 0x5a, flags: 0x0},
-	1241: {region: 0x165, script: 0x5a, flags: 0x0},
-	1242: {region: 0x165, script: 0x5a, flags: 0x0},
-	1243: {region: 0x165, script: 0x5a, flags: 0x0},
-	1244: {region: 0x165, script: 0x5a, flags: 0x0},
-	1245: {region: 0x165, script: 0x5a, flags: 0x0},
-	1246: {region: 0x165, script: 0x5a, flags: 0x0},
-	1247: {region: 0x165, script: 0x5a, flags: 0x0},
-	1248: {region: 0x140, script: 0x5a, flags: 0x0},
-	1249: {region: 0x165, script: 0x5a, flags: 0x0},
-	1250: {region: 0x165, script: 0x5a, flags: 0x0},
-	1251: {region: 0xa8, script: 0x5, flags: 0x0},
-	1252: {region: 0x165, script: 0x5a, flags: 0x0},
-	1253: {region: 0x114, script: 0x5a, flags: 0x0},
-	1254: {region: 0x165, script: 0x5a, flags: 0x0},
-	1255: {region: 0x165, script: 0x5a, flags: 0x0},
-	1256: {region: 0x165, script: 0x5a, flags: 0x0},
-	1257: {region: 0x165, script: 0x5a, flags: 0x0},
-	1258: {region: 0x99, script: 0x22, flags: 0x0},
-	1259: {region: 0x53, script: 0x3b, flags: 0x0},
-	1260: {region: 0x165, script: 0x5a, flags: 0x0},
-	1261: {region: 0x165, script: 0x5a, flags: 0x0},
-	1262: {region: 0x41, script: 0x5a, flags: 0x0},
-	1263: {region: 0x165, script: 0x5a, flags: 0x0},
-	1264: {region: 0x12b, script: 0x18, flags: 0x0},
-	1265: {region: 0x165, script: 0x5a, flags: 0x0},
-	1266: {region: 0x161, script: 0x5a, flags: 0x0},
-	1267: {region: 0x165, script: 0x5a, flags: 0x0},
-	1268: {region: 0x12b, script: 0x62, flags: 0x0},
-	1269: {region: 0x12b, script: 0x63, flags: 0x0},
-	1270: {region: 0x7d, script: 0x2e, flags: 0x0},
-	1271: {region: 0x53, script: 0x67, flags: 0x0},
-	1272: {region: 0x10b, script: 0x6c, flags: 0x0},
-	1273: {region: 0x108, script: 0x77, flags: 0x0},
-	1274: {region: 0x99, script: 0x22, flags: 0x0},
-	1275: {region: 0x131, script: 0x5a, flags: 0x0},
-	1276: {region: 0x165, script: 0x5a, flags: 0x0},
-	1277: {region: 0x9c, script: 0x8e, flags: 0x0},
-	1278: {region: 0x165, script: 0x5a, flags: 0x0},
-	1279: {region: 0x15e, script: 0xc7, flags: 0x0},
-	1280: {region: 0x165, script: 0x5a, flags: 0x0},
-	1281: {region: 0x165, script: 0x5a, flags: 0x0},
-	1282: {region: 0xdb, script: 0x22, flags: 0x0},
-	1283: {region: 0x165, script: 0x5a, flags: 0x0},
-	1284: {region: 0x165, script: 0x5a, flags: 0x0},
-	1285: {region: 0xd1, script: 0x5a, flags: 0x0},
-	1286: {region: 0x75, script: 0x5a, flags: 0x0},
-	1287: {region: 0x165, script: 0x5a, flags: 0x0},
-	1288: {region: 0x165, script: 0x5a, flags: 0x0},
-	1289: {region: 0x52, script: 0x5a, flags: 0x0},
-	1290: {region: 0x165, script: 0x5a, flags: 0x0},
-	1291: {region: 0x165, script: 0x5a, flags: 0x0},
-	1292: {region: 0x165, script: 0x5a, flags: 0x0},
-	1293: {region: 0x52, script: 0x5a, flags: 0x0},
-	1294: {region: 0x165, script: 0x5a, flags: 0x0},
-	1295: {region: 0x165, script: 0x5a, flags: 0x0},
-	1296: {region: 0x165, script: 0x5a, flags: 0x0},
-	1297: {region: 0x165, script: 0x5a, flags: 0x0},
-	1298: {region: 0x1, script: 0x3e, flags: 0x0},
-	1299: {region: 0x165, script: 0x5a, flags: 0x0},
-	1300: {region: 0x165, script: 0x5a, flags: 0x0},
-	1301: {region: 0x165, script: 0x5a, flags: 0x0},
-	1302: {region: 0x165, script: 0x5a, flags: 0x0},
-	1303: {region: 0x165, script: 0x5a, flags: 0x0},
-	1304: {region: 0xd6, script: 0x5a, flags: 0x0},
-	1305: {region: 0x165, script: 0x5a, flags: 0x0},
-	1306: {region: 0x165, script: 0x5a, flags: 0x0},
-	1307: {region: 0x165, script: 0x5a, flags: 0x0},
-	1308: {region: 0x41, script: 0x5a, flags: 0x0},
-	1309: {region: 0x165, script: 0x5a, flags: 0x0},
-	1310: {region: 0xcf, script: 0x5a, flags: 0x0},
-	1311: {region: 0x4a, script: 0x3, flags: 0x1},
-	1312: {region: 0x165, script: 0x5a, flags: 0x0},
-	1313: {region: 0x165, script: 0x5a, flags: 0x0},
-	1314: {region: 0x165, script: 0x5a, flags: 0x0},
-	1315: {region: 0x53, script: 0x5a, flags: 0x0},
-	1316: {region: 0x10b, script: 0x5a, flags: 0x0},
-	1318: {region: 0xa8, script: 0x5, flags: 0x0},
-	1319: {region: 0xd9, script: 0x5a, flags: 0x0},
-	1320: {region: 0xba, script: 0xe3, flags: 0x0},
-	1321: {region: 0x4d, script: 0x14, flags: 0x1},
-	1322: {region: 0x53, script: 0x7d, flags: 0x0},
-	1323: {region: 0x165, script: 0x5a, flags: 0x0},
-	1324: {region: 0x122, script: 0x5a, flags: 0x0},
-	1325: {region: 0xd0, script: 0x5a, flags: 0x0},
-	1326: {region: 0x165, script: 0x5a, flags: 0x0},
-	1327: {region: 0x161, script: 0x5a, flags: 0x0},
-	1329: {region: 0x12b, script: 0x5a, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 388 bytes, 97 elements
-var likelyLangList = [97]likelyScriptRegion{
-	0:  {region: 0x9c, script: 0x7, flags: 0x0},
-	1:  {region: 0xa1, script: 0x78, flags: 0x2},
-	2:  {region: 0x11c, script: 0x84, flags: 0x2},
-	3:  {region: 0x32, script: 0x5a, flags: 0x0},
-	4:  {region: 0x9b, script: 0x5, flags: 0x4},
-	5:  {region: 0x9c, script: 0x5, flags: 0x4},
-	6:  {region: 0x106, script: 0x20, flags: 0x4},
-	7:  {region: 0x9c, script: 0x5, flags: 0x2},
-	8:  {region: 0x106, script: 0x20, flags: 0x0},
-	9:  {region: 0x38, script: 0x2f, flags: 0x2},
-	10: {region: 0x135, script: 0x5a, flags: 0x0},
-	11: {region: 0x7b, script: 0xca, flags: 0x2},
-	12: {region: 0x114, script: 0x5a, flags: 0x0},
-	13: {region: 0x84, script: 0x1, flags: 0x2},
-	14: {region: 0x5d, script: 0x1f, flags: 0x0},
-	15: {region: 0x87, script: 0x5f, flags: 0x2},
-	16: {region: 0xd6, script: 0x5a, flags: 0x0},
-	17: {region: 0x52, script: 0x5, flags: 0x4},
-	18: {region: 0x10b, script: 0x5, flags: 0x4},
-	19: {region: 0xae, script: 0x20, flags: 0x0},
-	20: {region: 0x24, script: 0x5, flags: 0x4},
-	21: {region: 0x53, script: 0x5, flags: 0x4},
-	22: {region: 0x9c, script: 0x5, flags: 0x4},
-	23: {region: 0xc5, script: 0x5, flags: 0x4},
-	24: {region: 0x53, script: 0x5, flags: 0x2},
-	25: {region: 0x12b, script: 0x5a, flags: 0x0},
-	26: {region: 0xb0, script: 0x5, flags: 0x4},
-	27: {region: 0x9b, script: 0x5, flags: 0x2},
-	28: {region: 0xa5, script: 0x20, flags: 0x0},
-	29: {region: 0x53, script: 0x5, flags: 0x4},
-	30: {region: 0x12b, script: 0x5a, flags: 0x4},
-	31: {region: 0x53, script: 0x5, flags: 0x2},
-	32: {region: 0x12b, script: 0x5a, flags: 0x2},
-	33: {region: 0xdb, script: 0x22, flags: 0x0},
-	34: {region: 0x99, script: 0x5d, flags: 0x2},
-	35: {region: 0x83, script: 0x5a, flags: 0x0},
-	36: {region: 0x84, script: 0x7c, flags: 0x4},
-	37: {region: 0x84, script: 0x7c, flags: 0x2},
-	38: {region: 0xc5, script: 0x20, flags: 0x0},
-	39: {region: 0x53, script: 0x70, flags: 0x4},
-	40: {region: 0x53, script: 0x70, flags: 0x2},
-	41: {region: 0xd0, script: 0x5a, flags: 0x0},
-	42: {region: 0x4a, script: 0x5, flags: 0x4},
-	43: {region: 0x95, script: 0x5, flags: 0x4},
-	44: {region: 0x99, script: 0x36, flags: 0x0},
-	45: {region: 0xe8, script: 0x5, flags: 0x4},
-	46: {region: 0xe8, script: 0x5, flags: 0x2},
-	47: {region: 0x9c, script: 0x88, flags: 0x0},
-	48: {region: 0x53, script: 0x89, flags: 0x2},
-	49: {region: 0xba, script: 0xe3, flags: 0x0},
-	50: {region: 0xd9, script: 0x5a, flags: 0x4},
-	51: {region: 0xe8, script: 0x5, flags: 0x0},
-	52: {region: 0x99, script: 0x22, flags: 0x2},
-	53: {region: 0x99, script: 0x4f, flags: 0x2},
-	54: {region: 0x99, script: 0xce, flags: 0x2},
-	55: {region: 0x105, script: 0x20, flags: 0x0},
-	56: {region: 0xbd, script: 0x5a, flags: 0x4},
-	57: {region: 0x104, script: 0x5a, flags: 0x4},
-	58: {region: 0x106, script: 0x5a, flags: 0x4},
-	59: {region: 0x12b, script: 0x5a, flags: 0x4},
-	60: {region: 0x124, script: 0x20, flags: 0x0},
-	61: {region: 0xe8, script: 0x5, flags: 0x4},
-	62: {region: 0xe8, script: 0x5, flags: 0x2},
-	63: {region: 0x53, script: 0x5, flags: 0x0},
-	64: {region: 0xae, script: 0x20, flags: 0x4},
-	65: {region: 0xc5, script: 0x20, flags: 0x4},
-	66: {region: 0xae, script: 0x20, flags: 0x2},
-	67: {region: 0x99, script: 0xe, flags: 0x0},
-	68: {region: 0xdb, script: 0x22, flags: 0x4},
-	69: {region: 0xdb, script: 0x22, flags: 0x2},
-	70: {region: 0x137, script: 0x5a, flags: 0x0},
-	71: {region: 0x24, script: 0x5, flags: 0x4},
-	72: {region: 0x53, script: 0x20, flags: 0x4},
-	73: {region: 0x24, script: 0x5, flags: 0x2},
-	74: {region: 0x8d, script: 0x3c, flags: 0x0},
-	75: {region: 0x53, script: 0x3b, flags: 0x4},
-	76: {region: 0x53, script: 0x3b, flags: 0x2},
-	77: {region: 0x53, script: 0x3b, flags: 0x0},
-	78: {region: 0x2f, script: 0x3c, flags: 0x4},
-	79: {region: 0x3e, script: 0x3c, flags: 0x4},
-	80: {region: 0x7b, script: 0x3c, flags: 0x4},
-	81: {region: 0x7e, script: 0x3c, flags: 0x4},
-	82: {region: 0x8d, script: 0x3c, flags: 0x4},
-	83: {region: 0x95, script: 0x3c, flags: 0x4},
-	84: {region: 0xc6, script: 0x3c, flags: 0x4},
-	85: {region: 0xd0, script: 0x3c, flags: 0x4},
-	86: {region: 0xe2, script: 0x3c, flags: 0x4},
-	87: {region: 0xe5, script: 0x3c, flags: 0x4},
-	88: {region: 0xe7, script: 0x3c, flags: 0x4},
-	89: {region: 0x116, script: 0x3c, flags: 0x4},
-	90: {region: 0x123, script: 0x3c, flags: 0x4},
-	91: {region: 0x12e, script: 0x3c, flags: 0x4},
-	92: {region: 0x135, script: 0x3c, flags: 0x4},
-	93: {region: 0x13e, script: 0x3c, flags: 0x4},
-	94: {region: 0x12e, script: 0x11, flags: 0x2},
-	95: {region: 0x12e, script: 0x37, flags: 0x2},
-	96: {region: 0x12e, script: 0x3c, flags: 0x2},
-}
-
-type likelyLangScript struct {
-	lang   uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1432 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
-	34:  {lang: 0xd7, script: 0x5a, flags: 0x0},
-	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	36:  {lang: 0x0, script: 0x2, flags: 0x1},
-	39:  {lang: 0x2, script: 0x2, flags: 0x1},
-	40:  {lang: 0x4, script: 0x2, flags: 0x1},
-	42:  {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	43:  {lang: 0x0, script: 0x5a, flags: 0x0},
-	44:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	45:  {lang: 0x41b, script: 0x5a, flags: 0x0},
-	46:  {lang: 0x10d, script: 0x5a, flags: 0x0},
-	48:  {lang: 0x367, script: 0x5a, flags: 0x0},
-	49:  {lang: 0x444, script: 0x5a, flags: 0x0},
-	50:  {lang: 0x58, script: 0x5a, flags: 0x0},
-	51:  {lang: 0x6, script: 0x2, flags: 0x1},
-	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
-	54:  {lang: 0x367, script: 0x5a, flags: 0x0},
-	55:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	56:  {lang: 0x7e, script: 0x20, flags: 0x0},
-	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	58:  {lang: 0x3d9, script: 0x5a, flags: 0x0},
-	59:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	60:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	62:  {lang: 0x31f, script: 0x5a, flags: 0x0},
-	63:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	64:  {lang: 0x3a1, script: 0x5a, flags: 0x0},
-	65:  {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	67:  {lang: 0x8, script: 0x2, flags: 0x1},
-	69:  {lang: 0x0, script: 0x5a, flags: 0x0},
-	71:  {lang: 0x71, script: 0x20, flags: 0x0},
-	73:  {lang: 0x512, script: 0x3e, flags: 0x2},
-	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
-	75:  {lang: 0x445, script: 0x5a, flags: 0x0},
-	76:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	77:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	78:  {lang: 0x10d, script: 0x5a, flags: 0x0},
-	79:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	81:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	82:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	83:  {lang: 0xa, script: 0x4, flags: 0x1},
-	84:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	85:  {lang: 0x0, script: 0x5a, flags: 0x0},
-	86:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	89:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	90:  {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	91:  {lang: 0x3a1, script: 0x5a, flags: 0x0},
-	93:  {lang: 0xe, script: 0x2, flags: 0x1},
-	94:  {lang: 0xfa, script: 0x5a, flags: 0x0},
-	96:  {lang: 0x10d, script: 0x5a, flags: 0x0},
-	98:  {lang: 0x1, script: 0x5a, flags: 0x0},
-	99:  {lang: 0x101, script: 0x5a, flags: 0x0},
-	101: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	103: {lang: 0x10, script: 0x2, flags: 0x1},
-	104: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	105: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	106: {lang: 0x140, script: 0x5a, flags: 0x0},
-	107: {lang: 0x3a, script: 0x5, flags: 0x0},
-	108: {lang: 0x3a, script: 0x5, flags: 0x0},
-	109: {lang: 0x46f, script: 0x2c, flags: 0x0},
-	110: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	111: {lang: 0x12, script: 0x2, flags: 0x1},
-	113: {lang: 0x10d, script: 0x5a, flags: 0x0},
-	114: {lang: 0x151, script: 0x5a, flags: 0x0},
-	115: {lang: 0x1c0, script: 0x22, flags: 0x2},
-	118: {lang: 0x158, script: 0x5a, flags: 0x0},
-	120: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	122: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	123: {lang: 0x14, script: 0x2, flags: 0x1},
-	125: {lang: 0x16, script: 0x3, flags: 0x1},
-	126: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	128: {lang: 0x21, script: 0x5a, flags: 0x0},
-	130: {lang: 0x245, script: 0x5a, flags: 0x0},
-	132: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	133: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	134: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	135: {lang: 0x19, script: 0x2, flags: 0x1},
-	136: {lang: 0x0, script: 0x5a, flags: 0x0},
-	137: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	139: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	141: {lang: 0x529, script: 0x3c, flags: 0x0},
-	142: {lang: 0x0, script: 0x5a, flags: 0x0},
-	143: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	144: {lang: 0x1d1, script: 0x5a, flags: 0x0},
-	145: {lang: 0x1d4, script: 0x5a, flags: 0x0},
-	146: {lang: 0x1d5, script: 0x5a, flags: 0x0},
-	148: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	149: {lang: 0x1b, script: 0x2, flags: 0x1},
-	151: {lang: 0x1bc, script: 0x3e, flags: 0x0},
-	153: {lang: 0x1d, script: 0x3, flags: 0x1},
-	155: {lang: 0x3a, script: 0x5, flags: 0x0},
-	156: {lang: 0x20, script: 0x2, flags: 0x1},
-	157: {lang: 0x1f8, script: 0x5a, flags: 0x0},
-	158: {lang: 0x1f9, script: 0x5a, flags: 0x0},
-	161: {lang: 0x3a, script: 0x5, flags: 0x0},
-	162: {lang: 0x200, script: 0x49, flags: 0x0},
-	164: {lang: 0x445, script: 0x5a, flags: 0x0},
-	165: {lang: 0x28a, script: 0x20, flags: 0x0},
-	166: {lang: 0x22, script: 0x3, flags: 0x1},
-	168: {lang: 0x25, script: 0x2, flags: 0x1},
-	170: {lang: 0x254, script: 0x53, flags: 0x0},
-	171: {lang: 0x254, script: 0x53, flags: 0x0},
-	172: {lang: 0x3a, script: 0x5, flags: 0x0},
-	174: {lang: 0x3e2, script: 0x20, flags: 0x0},
-	175: {lang: 0x27, script: 0x2, flags: 0x1},
-	176: {lang: 0x3a, script: 0x5, flags: 0x0},
-	178: {lang: 0x10d, script: 0x5a, flags: 0x0},
-	179: {lang: 0x40c, script: 0xcf, flags: 0x0},
-	181: {lang: 0x43b, script: 0x5a, flags: 0x0},
-	182: {lang: 0x2c0, script: 0x5a, flags: 0x0},
-	183: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	184: {lang: 0x2c7, script: 0x5a, flags: 0x0},
-	185: {lang: 0x3a, script: 0x5, flags: 0x0},
-	186: {lang: 0x29, script: 0x2, flags: 0x1},
-	187: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	188: {lang: 0x2b, script: 0x2, flags: 0x1},
-	189: {lang: 0x432, script: 0x5a, flags: 0x0},
-	190: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	191: {lang: 0x2f1, script: 0x5a, flags: 0x0},
-	194: {lang: 0x2d, script: 0x2, flags: 0x1},
-	195: {lang: 0xa0, script: 0x5a, flags: 0x0},
-	196: {lang: 0x2f, script: 0x2, flags: 0x1},
-	197: {lang: 0x31, script: 0x2, flags: 0x1},
-	198: {lang: 0x33, script: 0x2, flags: 0x1},
-	200: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	201: {lang: 0x35, script: 0x2, flags: 0x1},
-	203: {lang: 0x320, script: 0x5a, flags: 0x0},
-	204: {lang: 0x37, script: 0x3, flags: 0x1},
-	205: {lang: 0x128, script: 0xe5, flags: 0x0},
-	207: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	208: {lang: 0x31f, script: 0x5a, flags: 0x0},
-	209: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	210: {lang: 0x16, script: 0x5a, flags: 0x0},
-	211: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	212: {lang: 0x1b4, script: 0x5a, flags: 0x0},
-	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
-	216: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	217: {lang: 0x367, script: 0x5a, flags: 0x0},
-	218: {lang: 0x347, script: 0x5a, flags: 0x0},
-	219: {lang: 0x351, script: 0x22, flags: 0x0},
-	225: {lang: 0x3a, script: 0x5, flags: 0x0},
-	226: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	228: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	229: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	230: {lang: 0x486, script: 0x5a, flags: 0x0},
-	231: {lang: 0x153, script: 0x5a, flags: 0x0},
-	232: {lang: 0x3a, script: 0x3, flags: 0x1},
-	233: {lang: 0x3b3, script: 0x5a, flags: 0x0},
-	234: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	236: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	237: {lang: 0x3a, script: 0x5, flags: 0x0},
-	238: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	240: {lang: 0x3a2, script: 0x5a, flags: 0x0},
-	241: {lang: 0x194, script: 0x5a, flags: 0x0},
-	243: {lang: 0x3a, script: 0x5, flags: 0x0},
-	258: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	260: {lang: 0x3d, script: 0x2, flags: 0x1},
-	261: {lang: 0x432, script: 0x20, flags: 0x0},
-	262: {lang: 0x3f, script: 0x2, flags: 0x1},
-	263: {lang: 0x3e5, script: 0x5a, flags: 0x0},
-	264: {lang: 0x3a, script: 0x5, flags: 0x0},
-	266: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	267: {lang: 0x3a, script: 0x5, flags: 0x0},
-	268: {lang: 0x41, script: 0x2, flags: 0x1},
-	271: {lang: 0x416, script: 0x5a, flags: 0x0},
-	272: {lang: 0x347, script: 0x5a, flags: 0x0},
-	273: {lang: 0x43, script: 0x2, flags: 0x1},
-	275: {lang: 0x1f9, script: 0x5a, flags: 0x0},
-	276: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	277: {lang: 0x429, script: 0x5a, flags: 0x0},
-	278: {lang: 0x367, script: 0x5a, flags: 0x0},
-	280: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	282: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	284: {lang: 0x45, script: 0x2, flags: 0x1},
-	288: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	289: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	290: {lang: 0x47, script: 0x2, flags: 0x1},
-	291: {lang: 0x49, script: 0x3, flags: 0x1},
-	292: {lang: 0x4c, script: 0x2, flags: 0x1},
-	293: {lang: 0x477, script: 0x5a, flags: 0x0},
-	294: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	295: {lang: 0x476, script: 0x5a, flags: 0x0},
-	296: {lang: 0x4e, script: 0x2, flags: 0x1},
-	297: {lang: 0x482, script: 0x5a, flags: 0x0},
-	299: {lang: 0x50, script: 0x4, flags: 0x1},
-	301: {lang: 0x4a0, script: 0x5a, flags: 0x0},
-	302: {lang: 0x54, script: 0x2, flags: 0x1},
-	303: {lang: 0x445, script: 0x5a, flags: 0x0},
-	304: {lang: 0x56, script: 0x3, flags: 0x1},
-	305: {lang: 0x445, script: 0x5a, flags: 0x0},
-	309: {lang: 0x512, script: 0x3e, flags: 0x2},
-	310: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	311: {lang: 0x4bc, script: 0x5a, flags: 0x0},
-	312: {lang: 0x1f9, script: 0x5a, flags: 0x0},
-	315: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	318: {lang: 0x4c3, script: 0x5a, flags: 0x0},
-	319: {lang: 0x8a, script: 0x5a, flags: 0x0},
-	320: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	322: {lang: 0x41b, script: 0x5a, flags: 0x0},
-	333: {lang: 0x59, script: 0x2, flags: 0x1},
-	350: {lang: 0x3a, script: 0x5, flags: 0x0},
-	351: {lang: 0x5b, script: 0x2, flags: 0x1},
-	356: {lang: 0x423, script: 0x5a, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 372 bytes, 93 elements
-var likelyRegionList = [93]likelyLangScript{
-	0:  {lang: 0x148, script: 0x5, flags: 0x0},
-	1:  {lang: 0x476, script: 0x5a, flags: 0x0},
-	2:  {lang: 0x431, script: 0x5a, flags: 0x0},
-	3:  {lang: 0x2ff, script: 0x20, flags: 0x0},
-	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
-	5:  {lang: 0x274, script: 0x5a, flags: 0x0},
-	6:  {lang: 0xb7, script: 0x5a, flags: 0x0},
-	7:  {lang: 0x432, script: 0x20, flags: 0x0},
-	8:  {lang: 0x12d, script: 0xe7, flags: 0x0},
-	9:  {lang: 0x351, script: 0x22, flags: 0x0},
-	10: {lang: 0x529, script: 0x3b, flags: 0x0},
-	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
-	12: {lang: 0x523, script: 0x5a, flags: 0x0},
-	13: {lang: 0x29a, script: 0xe6, flags: 0x0},
-	14: {lang: 0x136, script: 0x34, flags: 0x0},
-	15: {lang: 0x48a, script: 0x5a, flags: 0x0},
-	16: {lang: 0x3a, script: 0x5, flags: 0x0},
-	17: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	18: {lang: 0x27, script: 0x2c, flags: 0x0},
-	19: {lang: 0x139, script: 0x5a, flags: 0x0},
-	20: {lang: 0x26a, script: 0x5, flags: 0x2},
-	21: {lang: 0x512, script: 0x3e, flags: 0x2},
-	22: {lang: 0x210, script: 0x2e, flags: 0x0},
-	23: {lang: 0x5, script: 0x20, flags: 0x0},
-	24: {lang: 0x274, script: 0x5a, flags: 0x0},
-	25: {lang: 0x136, script: 0x34, flags: 0x0},
-	26: {lang: 0x2ff, script: 0x20, flags: 0x0},
-	27: {lang: 0x1e1, script: 0x5a, flags: 0x0},
-	28: {lang: 0x31f, script: 0x5, flags: 0x0},
-	29: {lang: 0x1be, script: 0x22, flags: 0x0},
-	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	31: {lang: 0x236, script: 0x75, flags: 0x0},
-	32: {lang: 0x148, script: 0x5, flags: 0x0},
-	33: {lang: 0x476, script: 0x5a, flags: 0x0},
-	34: {lang: 0x24a, script: 0x4e, flags: 0x0},
-	35: {lang: 0xe6, script: 0x5, flags: 0x0},
-	36: {lang: 0x226, script: 0xe6, flags: 0x0},
-	37: {lang: 0x3a, script: 0x5, flags: 0x0},
-	38: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	39: {lang: 0x2b8, script: 0x57, flags: 0x0},
-	40: {lang: 0x226, script: 0xe6, flags: 0x0},
-	41: {lang: 0x3a, script: 0x5, flags: 0x0},
-	42: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	43: {lang: 0x3dc, script: 0x5a, flags: 0x0},
-	44: {lang: 0x4ae, script: 0x20, flags: 0x0},
-	45: {lang: 0x2ff, script: 0x20, flags: 0x0},
-	46: {lang: 0x431, script: 0x5a, flags: 0x0},
-	47: {lang: 0x331, script: 0x75, flags: 0x0},
-	48: {lang: 0x213, script: 0x5a, flags: 0x0},
-	49: {lang: 0x30b, script: 0x20, flags: 0x0},
-	50: {lang: 0x242, script: 0x5, flags: 0x0},
-	51: {lang: 0x529, script: 0x3c, flags: 0x0},
-	52: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	53: {lang: 0x3a, script: 0x5, flags: 0x0},
-	54: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	55: {lang: 0x2ed, script: 0x5a, flags: 0x0},
-	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	57: {lang: 0x88, script: 0x22, flags: 0x0},
-	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	60: {lang: 0xbe, script: 0x22, flags: 0x0},
-	61: {lang: 0x3dc, script: 0x5a, flags: 0x0},
-	62: {lang: 0x7e, script: 0x20, flags: 0x0},
-	63: {lang: 0x3e2, script: 0x20, flags: 0x0},
-	64: {lang: 0x267, script: 0x5a, flags: 0x0},
-	65: {lang: 0x444, script: 0x5a, flags: 0x0},
-	66: {lang: 0x512, script: 0x3e, flags: 0x0},
-	67: {lang: 0x412, script: 0x5a, flags: 0x0},
-	68: {lang: 0x4ae, script: 0x20, flags: 0x0},
-	69: {lang: 0x3a, script: 0x5, flags: 0x0},
-	70: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	71: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	72: {lang: 0x35, script: 0x5, flags: 0x0},
-	73: {lang: 0x46b, script: 0xe6, flags: 0x0},
-	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
-	75: {lang: 0x30f, script: 0x75, flags: 0x0},
-	76: {lang: 0x467, script: 0x20, flags: 0x0},
-	77: {lang: 0x148, script: 0x5, flags: 0x0},
-	78: {lang: 0x3a, script: 0x5, flags: 0x0},
-	79: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	80: {lang: 0x48a, script: 0x5a, flags: 0x0},
-	81: {lang: 0x58, script: 0x5, flags: 0x0},
-	82: {lang: 0x219, script: 0x20, flags: 0x0},
-	83: {lang: 0x81, script: 0x34, flags: 0x0},
-	84: {lang: 0x529, script: 0x3c, flags: 0x0},
-	85: {lang: 0x48c, script: 0x5a, flags: 0x0},
-	86: {lang: 0x4ae, script: 0x20, flags: 0x0},
-	87: {lang: 0x512, script: 0x3e, flags: 0x0},
-	88: {lang: 0x3b3, script: 0x5a, flags: 0x0},
-	89: {lang: 0x431, script: 0x5a, flags: 0x0},
-	90: {lang: 0x432, script: 0x20, flags: 0x0},
-	91: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	92: {lang: 0x446, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
-	lang   uint16
-	region uint16
-	script uint8
-}
-
-// Size: 198 bytes, 33 elements
-var likelyRegionGroup = [33]likelyTag{
-	1:  {lang: 0x139, region: 0xd6, script: 0x5a},
-	2:  {lang: 0x139, region: 0x135, script: 0x5a},
-	3:  {lang: 0x3c0, region: 0x41, script: 0x5a},
-	4:  {lang: 0x139, region: 0x2f, script: 0x5a},
-	5:  {lang: 0x139, region: 0xd6, script: 0x5a},
-	6:  {lang: 0x13e, region: 0xcf, script: 0x5a},
-	7:  {lang: 0x445, region: 0x12f, script: 0x5a},
-	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
-	9:  {lang: 0x445, region: 0x4b, script: 0x5a},
-	10: {lang: 0x139, region: 0x161, script: 0x5a},
-	11: {lang: 0x139, region: 0x135, script: 0x5a},
-	12: {lang: 0x139, region: 0x135, script: 0x5a},
-	13: {lang: 0x13e, region: 0x59, script: 0x5a},
-	14: {lang: 0x529, region: 0x53, script: 0x3b},
-	15: {lang: 0x1be, region: 0x99, script: 0x22},
-	16: {lang: 0x1e1, region: 0x95, script: 0x5a},
-	17: {lang: 0x1f9, region: 0x9e, script: 0x5a},
-	18: {lang: 0x139, region: 0x2f, script: 0x5a},
-	19: {lang: 0x139, region: 0xe6, script: 0x5a},
-	20: {lang: 0x139, region: 0x8a, script: 0x5a},
-	21: {lang: 0x41b, region: 0x142, script: 0x5a},
-	22: {lang: 0x529, region: 0x53, script: 0x3b},
-	23: {lang: 0x4bc, region: 0x137, script: 0x5a},
-	24: {lang: 0x3a, region: 0x108, script: 0x5},
-	25: {lang: 0x3e2, region: 0x106, script: 0x20},
-	26: {lang: 0x3e2, region: 0x106, script: 0x20},
-	27: {lang: 0x139, region: 0x7b, script: 0x5a},
-	28: {lang: 0x10d, region: 0x60, script: 0x5a},
-	29: {lang: 0x139, region: 0xd6, script: 0x5a},
-	30: {lang: 0x13e, region: 0x1f, script: 0x5a},
-	31: {lang: 0x139, region: 0x9a, script: 0x5a},
-	32: {lang: 0x139, region: 0x7b, script: 0x5a},
-}
-
-// Size: 264 bytes, 33 elements
-var regionContainment = [33]uint64{
-	// Entry 0 - 1F
-	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
-	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
-	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
-	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
-	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
-	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
-	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
-	// Entry 20 - 3F
-	0x0000000100000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
-	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
-	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
-	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
-	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
-	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
-	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
-	// Entry 40 - 7F
-	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
-	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
-	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
-	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
-	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
-	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
-	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
-	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
-	// Entry 80 - BF
-	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
-	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
-	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
-	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
-	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
-	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
-	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
-	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
-	// Entry C0 - FF
-	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
-	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
-	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
-	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
-	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
-	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
-	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	// Entry 100 - 13F
-	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
-	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
-	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
-	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
-	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
-	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
-	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
-	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
-	// Entry 140 - 17F
-	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
-	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings.  These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 584 bytes, 73 elements
-var regionInclusionBits = [73]uint64{
-	// Entry 0 - 1F
-	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
-	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
-	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
-	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
-	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
-	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
-	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
-	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
-	// Entry 20 - 3F
-	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
-	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
-	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
-	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
-	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
-	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
-	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
-	// Entry 40 - 5F
-	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
-	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
-	0x0000000102020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 73 bytes, 73 elements
-var regionInclusionNext = [73]uint8{
-	// Entry 0 - 3F
-	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
-	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
-	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
-	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
-	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
-	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
-	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
-	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
-	// Entry 40 - 7F
-	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
-	0x43,
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-// Size: 414 bytes, 5 elements
-var parents = [5]parentRel{
-	0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
-	1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
-	2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
-	3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
-	4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
-}
-
-// Total table size 26398 bytes (25KiB); checksum: 1C859EA7
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
deleted file mode 100644
index e7afd3188e..0000000000
--- a/vendor/golang.org/x/text/internal/language/tags.go
+++ /dev/null
@@ -1,48 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
-// It simplifies safe initialization of Tag values.
-func MustParse(s string) Tag {
-	t, err := Parse(s)
-	if err != nil {
-		panic(err)
-	}
-	return t
-}
-
-// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
-// It simplifies safe initialization of Base values.
-func MustParseBase(s string) Language {
-	b, err := ParseBase(s)
-	if err != nil {
-		panic(err)
-	}
-	return b
-}
-
-// MustParseScript is like ParseScript, but panics if the given script cannot be
-// parsed. It simplifies safe initialization of Script values.
-func MustParseScript(s string) Script {
-	scr, err := ParseScript(s)
-	if err != nil {
-		panic(err)
-	}
-	return scr
-}
-
-// MustParseRegion is like ParseRegion, but panics if the given region cannot be
-// parsed. It simplifies safe initialization of Region values.
-func MustParseRegion(s string) Region {
-	r, err := ParseRegion(s)
-	if err != nil {
-		panic(err)
-	}
-	return r
-}
-
-// Und is the root language.
-var Und Tag
diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go
deleted file mode 100644
index 1cc004a6d5..0000000000
--- a/vendor/golang.org/x/text/internal/match.go
+++ /dev/null
@@ -1,67 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package internal
-
-// This file contains matchers that implement CLDR inheritance.
-//
-//     See https://unicode.org/reports/tr35/#Locale_Inheritance.
-//
-// Some of the inheritance described in this document is already handled by
-// the cldr package.
-
-import (
-	"golang.org/x/text/language"
-)
-
-// TODO: consider if (some of the) matching algorithm needs to be public after
-// getting some feel about what is generic and what is specific.
-
-// NewInheritanceMatcher returns a matcher that matches based on the inheritance
-// chain.
-//
-// The matcher uses canonicalization and the parent relationship to find a
-// match. The resulting match will always be either Und or a language with the
-// same language and script as the requested language. It will not match
-// languages for which there is understood to be mutual or one-directional
-// intelligibility.
-//
-// A Match will indicate an Exact match if the language matches after
-// canonicalization and High if the matched tag is a parent.
-func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher {
-	tags := &InheritanceMatcher{make(map[language.Tag]int)}
-	for i, tag := range t {
-		ct, err := language.All.Canonicalize(tag)
-		if err != nil {
-			ct = tag
-		}
-		tags.index[ct] = i
-	}
-	return tags
-}
-
-type InheritanceMatcher struct {
-	index map[language.Tag]int
-}
-
-func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) {
-	for _, t := range want {
-		ct, err := language.All.Canonicalize(t)
-		if err != nil {
-			ct = t
-		}
-		conf := language.Exact
-		for {
-			if index, ok := m.index[ct]; ok {
-				return ct, index, conf
-			}
-			if ct == language.Und {
-				break
-			}
-			ct = ct.Parent()
-			conf = language.High
-		}
-	}
-	return language.Und, 0, language.No
-}
diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go
deleted file mode 100644
index b5d348891d..0000000000
--- a/vendor/golang.org/x/text/internal/tag/tag.go
+++ /dev/null
@@ -1,100 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package tag contains functionality handling tags and related data.
-package tag // import "golang.org/x/text/internal/tag"
-
-import "sort"
-
-// An Index converts tags to a compact numeric value.
-//
-// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can
-// be used to store additional information about the tag.
-type Index string
-
-// Elem returns the element data at the given index.
-func (s Index) Elem(x int) string {
-	return string(s[x*4 : x*4+4])
-}
-
-// Index reports the index of the given key or -1 if it could not be found.
-// Only the first len(key) bytes from the start of the 4-byte entries will be
-// considered for the search and the first match in Index will be returned.
-func (s Index) Index(key []byte) int {
-	n := len(key)
-	// search the index of the first entry with an equal or higher value than
-	// key in s.
-	index := sort.Search(len(s)/4, func(i int) bool {
-		return cmp(s[i*4:i*4+n], key) != -1
-	})
-	i := index * 4
-	if cmp(s[i:i+len(key)], key) != 0 {
-		return -1
-	}
-	return index
-}
-
-// Next finds the next occurrence of key after index x, which must have been
-// obtained from a call to Index using the same key. It returns x+1 or -1.
-func (s Index) Next(key []byte, x int) int {
-	if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 {
-		return x
-	}
-	return -1
-}
-
-// cmp returns an integer comparing a and b lexicographically.
-func cmp(a Index, b []byte) int {
-	n := len(a)
-	if len(b) < n {
-		n = len(b)
-	}
-	for i, c := range b[:n] {
-		switch {
-		case a[i] > c:
-			return 1
-		case a[i] < c:
-			return -1
-		}
-	}
-	switch {
-	case len(a) < len(b):
-		return -1
-	case len(a) > len(b):
-		return 1
-	}
-	return 0
-}
-
-// Compare returns an integer comparing a and b lexicographically.
-func Compare(a string, b []byte) int {
-	return cmp(Index(a), b)
-}
-
-// FixCase reformats b to the same pattern of cases as form.
-// If returns false if string b is malformed.
-func FixCase(form string, b []byte) bool {
-	if len(form) != len(b) {
-		return false
-	}
-	for i, c := range b {
-		if form[i] <= 'Z' {
-			if c >= 'a' {
-				c -= 'z' - 'Z'
-			}
-			if c < 'A' || 'Z' < c {
-				return false
-			}
-		} else {
-			if c <= 'Z' {
-				c += 'z' - 'Z'
-			}
-			if c < 'a' || 'z' < c {
-				return false
-			}
-		}
-		b[i] = c
-	}
-	return true
-}
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
deleted file mode 100644
index a24fd1a4d6..0000000000
--- a/vendor/golang.org/x/text/language/coverage.go
+++ /dev/null
@@ -1,187 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"fmt"
-	"sort"
-
-	"golang.org/x/text/internal/language"
-)
-
-// The Coverage interface is used to define the level of coverage of an
-// internationalization service. Note that not all types are supported by all
-// services. As lists may be generated on the fly, it is recommended that users
-// of a Coverage cache the results.
-type Coverage interface {
-	// Tags returns the list of supported tags.
-	Tags() []Tag
-
-	// BaseLanguages returns the list of supported base languages.
-	BaseLanguages() []Base
-
-	// Scripts returns the list of supported scripts.
-	Scripts() []Script
-
-	// Regions returns the list of supported regions.
-	Regions() []Region
-}
-
-var (
-	// Supported defines a Coverage that lists all supported subtags. Tags
-	// always returns nil.
-	Supported Coverage = allSubtags{}
-)
-
-// TODO:
-// - Support Variants, numbering systems.
-// - CLDR coverage levels.
-// - Set of common tags defined in this package.
-
-type allSubtags struct{}
-
-// Regions returns the list of supported regions. As all regions are in a
-// consecutive range, it simply returns a slice of numbers in increasing order.
-// The "undefined" region is not returned.
-func (s allSubtags) Regions() []Region {
-	reg := make([]Region, language.NumRegions)
-	for i := range reg {
-		reg[i] = Region{language.Region(i + 1)}
-	}
-	return reg
-}
-
-// Scripts returns the list of supported scripts. As all scripts are in a
-// consecutive range, it simply returns a slice of numbers in increasing order.
-// The "undefined" script is not returned.
-func (s allSubtags) Scripts() []Script {
-	scr := make([]Script, language.NumScripts)
-	for i := range scr {
-		scr[i] = Script{language.Script(i + 1)}
-	}
-	return scr
-}
-
-// BaseLanguages returns the list of all supported base languages. It generates
-// the list by traversing the internal structures.
-func (s allSubtags) BaseLanguages() []Base {
-	bs := language.BaseLanguages()
-	base := make([]Base, len(bs))
-	for i, b := range bs {
-		base[i] = Base{b}
-	}
-	return base
-}
-
-// Tags always returns nil.
-func (s allSubtags) Tags() []Tag {
-	return nil
-}
-
-// coverage is used by NewCoverage which is used as a convenient way for
-// creating Coverage implementations for partially defined data. Very often a
-// package will only need to define a subset of slices. coverage provides a
-// convenient way to do this. Moreover, packages using NewCoverage, instead of
-// their own implementation, will not break if later new slice types are added.
-type coverage struct {
-	tags    func() []Tag
-	bases   func() []Base
-	scripts func() []Script
-	regions func() []Region
-}
-
-func (s *coverage) Tags() []Tag {
-	if s.tags == nil {
-		return nil
-	}
-	return s.tags()
-}
-
-// bases implements sort.Interface and is used to sort base languages.
-type bases []Base
-
-func (b bases) Len() int {
-	return len(b)
-}
-
-func (b bases) Swap(i, j int) {
-	b[i], b[j] = b[j], b[i]
-}
-
-func (b bases) Less(i, j int) bool {
-	return b[i].langID < b[j].langID
-}
-
-// BaseLanguages returns the result from calling s.bases if it is specified or
-// otherwise derives the set of supported base languages from tags.
-func (s *coverage) BaseLanguages() []Base {
-	if s.bases == nil {
-		tags := s.Tags()
-		if len(tags) == 0 {
-			return nil
-		}
-		a := make([]Base, len(tags))
-		for i, t := range tags {
-			a[i] = Base{language.Language(t.lang())}
-		}
-		sort.Sort(bases(a))
-		k := 0
-		for i := 1; i < len(a); i++ {
-			if a[k] != a[i] {
-				k++
-				a[k] = a[i]
-			}
-		}
-		return a[:k+1]
-	}
-	return s.bases()
-}
-
-func (s *coverage) Scripts() []Script {
-	if s.scripts == nil {
-		return nil
-	}
-	return s.scripts()
-}
-
-func (s *coverage) Regions() []Region {
-	if s.regions == nil {
-		return nil
-	}
-	return s.regions()
-}
-
-// NewCoverage returns a Coverage for the given lists. It is typically used by
-// packages providing internationalization services to define their level of
-// coverage. A list may be of type []T or func() []T, where T is either Tag,
-// Base, Script or Region. The returned Coverage derives the value for Bases
-// from Tags if no func or slice for []Base is specified. For other unspecified
-// types the returned Coverage will return nil for the respective methods.
-func NewCoverage(list ...interface{}) Coverage {
-	s := &coverage{}
-	for _, x := range list {
-		switch v := x.(type) {
-		case func() []Base:
-			s.bases = v
-		case func() []Script:
-			s.scripts = v
-		case func() []Region:
-			s.regions = v
-		case func() []Tag:
-			s.tags = v
-		case []Base:
-			s.bases = func() []Base { return v }
-		case []Script:
-			s.scripts = func() []Script { return v }
-		case []Region:
-			s.regions = func() []Region { return v }
-		case []Tag:
-			s.tags = func() []Tag { return v }
-		default:
-			panic(fmt.Sprintf("language: unsupported set type %T", v))
-		}
-	}
-	return s
-}
diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go
deleted file mode 100644
index 8afecd50e1..0000000000
--- a/vendor/golang.org/x/text/language/doc.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// Copyright 2017 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package language implements BCP 47 language tags and related functionality.
-//
-// The most important function of package language is to match a list of
-// user-preferred languages to a list of supported languages.
-// It alleviates the developer of dealing with the complexity of this process
-// and provides the user with the best experience
-// (see https://blog.golang.org/matchlang).
-//
-//
-// Matching preferred against supported languages
-//
-// A Matcher for an application that supports English, Australian English,
-// Danish, and standard Mandarin can be created as follows:
-//
-//    var matcher = language.NewMatcher([]language.Tag{
-//        language.English,   // The first language is used as fallback.
-//        language.MustParse("en-AU"),
-//        language.Danish,
-//        language.Chinese,
-//    })
-//
-// This list of supported languages is typically implied by the languages for
-// which there exists translations of the user interface.
-//
-// User-preferred languages usually come as a comma-separated list of BCP 47
-// language tags.
-// The MatchString finds best matches for such strings:
-//
-//    handler(w http.ResponseWriter, r *http.Request) {
-//        lang, _ := r.Cookie("lang")
-//        accept := r.Header.Get("Accept-Language")
-//        tag, _ := language.MatchStrings(matcher, lang.String(), accept)
-//
-//        // tag should now be used for the initialization of any
-//        // locale-specific service.
-//    }
-//
-// The Matcher's Match method can be used to match Tags directly.
-//
-// Matchers are aware of the intricacies of equivalence between languages, such
-// as deprecated subtags, legacy tags, macro languages, mutual
-// intelligibility between scripts and languages, and transparently passing
-// BCP 47 user configuration.
-// For instance, it will know that a reader of Bokmål Danish can read Norwegian
-// and will know that Cantonese ("yue") is a good match for "zh-HK".
-//
-//
-// Using match results
-//
-// To guarantee a consistent user experience to the user it is important to
-// use the same language tag for the selection of any locale-specific services.
-// For example, it is utterly confusing to substitute spelled-out numbers
-// or dates in one language in text of another language.
-// More subtly confusing is using the wrong sorting order or casing
-// algorithm for a certain language.
-//
-//    All the packages in x/text that provide locale-specific services
-//    (e.g. collate, cases) should be initialized with the tag that was
-//    obtained at the start of an interaction with the user.
-//
-// Note that Tag that is returned by Match and MatchString may differ from any
-// of the supported languages, as it may contain carried over settings from
-// the user tags.
-// This may be inconvenient when your application has some additional
-// locale-specific data for your supported languages.
-// Match and MatchString both return the index of the matched supported tag
-// to simplify associating such data with the matched tag.
-//
-//
-// Canonicalization
-//
-// If one uses the Matcher to compare languages one does not need to
-// worry about canonicalization.
-//
-// The meaning of a Tag varies per application. The language package
-// therefore delays canonicalization and preserves information as much
-// as possible. The Matcher, however, will always take into account that
-// two different tags may represent the same language.
-//
-// By default, only legacy and deprecated tags are converted into their
-// canonical equivalent. All other information is preserved. This approach makes
-// the confidence scores more accurate and allows matchers to distinguish
-// between variants that are otherwise lost.
-//
-// As a consequence, two tags that should be treated as identical according to
-// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
-// Matcher handles such distinctions, though, and is aware of the
-// equivalence relations. The CanonType type can be used to alter the
-// canonicalization form.
-//
-// References
-//
-// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47
-//
-package language // import "golang.org/x/text/language"
-
-// TODO: explanation on how to match languages for your own locale-specific
-// service.
diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go
deleted file mode 100644
index c7435583b5..0000000000
--- a/vendor/golang.org/x/text/language/go1_1.go
+++ /dev/null
@@ -1,39 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build !go1.2
-// +build !go1.2
-
-package language
-
-import "sort"
-
-func sortStable(s sort.Interface) {
-	ss := stableSort{
-		s:   s,
-		pos: make([]int, s.Len()),
-	}
-	for i := range ss.pos {
-		ss.pos[i] = i
-	}
-	sort.Sort(&ss)
-}
-
-type stableSort struct {
-	s   sort.Interface
-	pos []int
-}
-
-func (s *stableSort) Len() int {
-	return len(s.pos)
-}
-
-func (s *stableSort) Less(i, j int) bool {
-	return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j]
-}
-
-func (s *stableSort) Swap(i, j int) {
-	s.s.Swap(i, j)
-	s.pos[i], s.pos[j] = s.pos[j], s.pos[i]
-}
diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go
deleted file mode 100644
index 77aaaa299e..0000000000
--- a/vendor/golang.org/x/text/language/go1_2.go
+++ /dev/null
@@ -1,12 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build go1.2
-// +build go1.2
-
-package language
-
-import "sort"
-
-var sortStable = sort.Stable
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
deleted file mode 100644
index 289b3a36d5..0000000000
--- a/vendor/golang.org/x/text/language/language.go
+++ /dev/null
@@ -1,605 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:generate go run gen.go -output tables.go
-
-package language
-
-// TODO: Remove above NOTE after:
-// - verifying that tables are dropped correctly (most notably matcher tables).
-
-import (
-	"strings"
-
-	"golang.org/x/text/internal/language"
-	"golang.org/x/text/internal/language/compact"
-)
-
-// Tag represents a BCP 47 language tag. It is used to specify an instance of a
-// specific language or locale. All language tag values are guaranteed to be
-// well-formed.
-type Tag compact.Tag
-
-func makeTag(t language.Tag) (tag Tag) {
-	return Tag(compact.Make(t))
-}
-
-func (t *Tag) tag() language.Tag {
-	return (*compact.Tag)(t).Tag()
-}
-
-func (t *Tag) isCompact() bool {
-	return (*compact.Tag)(t).IsCompact()
-}
-
-// TODO: improve performance.
-func (t *Tag) lang() language.Language { return t.tag().LangID }
-func (t *Tag) region() language.Region { return t.tag().RegionID }
-func (t *Tag) script() language.Script { return t.tag().ScriptID }
-
-// Make is a convenience wrapper for Parse that omits the error.
-// In case of an error, a sensible default is returned.
-func Make(s string) Tag {
-	return Default.Make(s)
-}
-
-// Make is a convenience wrapper for c.Parse that omits the error.
-// In case of an error, a sensible default is returned.
-func (c CanonType) Make(s string) Tag {
-	t, _ := c.Parse(s)
-	return t
-}
-
-// Raw returns the raw base language, script and region, without making an
-// attempt to infer their values.
-func (t Tag) Raw() (b Base, s Script, r Region) {
-	tt := t.tag()
-	return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
-}
-
-// IsRoot returns true if t is equal to language "und".
-func (t Tag) IsRoot() bool {
-	return compact.Tag(t).IsRoot()
-}
-
-// CanonType can be used to enable or disable various types of canonicalization.
-type CanonType int
-
-const (
-	// Replace deprecated base languages with their preferred replacements.
-	DeprecatedBase CanonType = 1 << iota
-	// Replace deprecated scripts with their preferred replacements.
-	DeprecatedScript
-	// Replace deprecated regions with their preferred replacements.
-	DeprecatedRegion
-	// Remove redundant scripts.
-	SuppressScript
-	// Normalize legacy encodings. This includes legacy languages defined in
-	// CLDR as well as bibliographic codes defined in ISO-639.
-	Legacy
-	// Map the dominant language of a macro language group to the macro language
-	// subtag. For example cmn -> zh.
-	Macro
-	// The CLDR flag should be used if full compatibility with CLDR is required.
-	// There are a few cases where language.Tag may differ from CLDR. To follow all
-	// of CLDR's suggestions, use All|CLDR.
-	CLDR
-
-	// Raw can be used to Compose or Parse without Canonicalization.
-	Raw CanonType = 0
-
-	// Replace all deprecated tags with their preferred replacements.
-	Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion
-
-	// All canonicalizations recommended by BCP 47.
-	BCP47 = Deprecated | SuppressScript
-
-	// All canonicalizations.
-	All = BCP47 | Legacy | Macro
-
-	// Default is the canonicalization used by Parse, Make and Compose. To
-	// preserve as much information as possible, canonicalizations that remove
-	// potentially valuable information are not included. The Matcher is
-	// designed to recognize similar tags that would be the same if
-	// they were canonicalized using All.
-	Default = Deprecated | Legacy
-
-	canonLang = DeprecatedBase | Legacy | Macro
-
-	// TODO: LikelyScript, LikelyRegion: suppress similar to ICU.
-)
-
-// canonicalize returns the canonicalized equivalent of the tag and
-// whether there was any change.
-func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
-	if c == Raw {
-		return t, false
-	}
-	changed := false
-	if c&SuppressScript != 0 {
-		if t.LangID.SuppressScript() == t.ScriptID {
-			t.ScriptID = 0
-			changed = true
-		}
-	}
-	if c&canonLang != 0 {
-		for {
-			if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
-				switch aliasType {
-				case language.Legacy:
-					if c&Legacy != 0 {
-						if t.LangID == _sh && t.ScriptID == 0 {
-							t.ScriptID = _Latn
-						}
-						t.LangID = l
-						changed = true
-					}
-				case language.Macro:
-					if c&Macro != 0 {
-						// We deviate here from CLDR. The mapping "nb" -> "no"
-						// qualifies as a typical Macro language mapping.  However,
-						// for legacy reasons, CLDR maps "no", the macro language
-						// code for Norwegian, to the dominant variant "nb". This
-						// change is currently under consideration for CLDR as well.
-						// See https://unicode.org/cldr/trac/ticket/2698 and also
-						// https://unicode.org/cldr/trac/ticket/1790 for some of the
-						// practical implications. TODO: this check could be removed
-						// if CLDR adopts this change.
-						if c&CLDR == 0 || t.LangID != _nb {
-							changed = true
-							t.LangID = l
-						}
-					}
-				case language.Deprecated:
-					if c&DeprecatedBase != 0 {
-						if t.LangID == _mo && t.RegionID == 0 {
-							t.RegionID = _MD
-						}
-						t.LangID = l
-						changed = true
-						// Other canonicalization types may still apply.
-						continue
-					}
-				}
-			} else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
-				t.LangID = _nb
-				changed = true
-			}
-			break
-		}
-	}
-	if c&DeprecatedScript != 0 {
-		if t.ScriptID == _Qaai {
-			changed = true
-			t.ScriptID = _Zinh
-		}
-	}
-	if c&DeprecatedRegion != 0 {
-		if r := t.RegionID.Canonicalize(); r != t.RegionID {
-			changed = true
-			t.RegionID = r
-		}
-	}
-	return t, changed
-}
-
-// Canonicalize returns the canonicalized equivalent of the tag.
-func (c CanonType) Canonicalize(t Tag) (Tag, error) {
-	// First try fast path.
-	if t.isCompact() {
-		if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
-			return t, nil
-		}
-	}
-	// It is unlikely that one will canonicalize a tag after matching. So do
-	// a slow but simple approach here.
-	if tag, changed := canonicalize(c, t.tag()); changed {
-		tag.RemakeString()
-		return makeTag(tag), nil
-	}
-	return t, nil
-
-}
-
-// Confidence indicates the level of certainty for a given return value.
-// For example, Serbian may be written in Cyrillic or Latin script.
-// The confidence level indicates whether a value was explicitly specified,
-// whether it is typically the only possible value, or whether there is
-// an ambiguity.
-type Confidence int
-
-const (
-	No    Confidence = iota // full confidence that there was no match
-	Low                     // most likely value picked out of a set of alternatives
-	High                    // value is generally assumed to be the correct match
-	Exact                   // exact match or explicitly specified value
-)
-
-var confName = []string{"No", "Low", "High", "Exact"}
-
-func (c Confidence) String() string {
-	return confName[c]
-}
-
-// String returns the canonical string representation of the language tag.
-func (t Tag) String() string {
-	return t.tag().String()
-}
-
-// MarshalText implements encoding.TextMarshaler.
-func (t Tag) MarshalText() (text []byte, err error) {
-	return t.tag().MarshalText()
-}
-
-// UnmarshalText implements encoding.TextUnmarshaler.
-func (t *Tag) UnmarshalText(text []byte) error {
-	var tag language.Tag
-	err := tag.UnmarshalText(text)
-	*t = makeTag(tag)
-	return err
-}
-
-// Base returns the base language of the language tag. If the base language is
-// unspecified, an attempt will be made to infer it from the context.
-// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
-func (t Tag) Base() (Base, Confidence) {
-	if b := t.lang(); b != 0 {
-		return Base{b}, Exact
-	}
-	tt := t.tag()
-	c := High
-	if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
-		c = Low
-	}
-	if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
-		return Base{tag.LangID}, c
-	}
-	return Base{0}, No
-}
-
-// Script infers the script for the language tag. If it was not explicitly given, it will infer
-// a most likely candidate.
-// If more than one script is commonly used for a language, the most likely one
-// is returned with a low confidence indication. For example, it returns (Cyrl, Low)
-// for Serbian.
-// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
-// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
-// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
-// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
-// unknown value in CLDR.  (Zzzz, Exact) is returned if Zzzz was explicitly specified.
-// Note that an inferred script is never guaranteed to be the correct one. Latin is
-// almost exclusively used for Afrikaans, but Arabic has been used for some texts
-// in the past.  Also, the script that is commonly used may change over time.
-// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
-func (t Tag) Script() (Script, Confidence) {
-	if scr := t.script(); scr != 0 {
-		return Script{scr}, Exact
-	}
-	tt := t.tag()
-	sc, c := language.Script(_Zzzz), No
-	if scr := tt.LangID.SuppressScript(); scr != 0 {
-		// Note: it is not always the case that a language with a suppress
-		// script value is only written in one script (e.g. kk, ms, pa).
-		if tt.RegionID == 0 {
-			return Script{scr}, High
-		}
-		sc, c = scr, High
-	}
-	if tag, err := tt.Maximize(); err == nil {
-		if tag.ScriptID != sc {
-			sc, c = tag.ScriptID, Low
-		}
-	} else {
-		tt, _ = canonicalize(Deprecated|Macro, tt)
-		if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
-			sc, c = tag.ScriptID, Low
-		}
-	}
-	return Script{sc}, c
-}
-
-// Region returns the region for the language tag. If it was not explicitly given, it will
-// infer a most likely candidate from the context.
-// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
-func (t Tag) Region() (Region, Confidence) {
-	if r := t.region(); r != 0 {
-		return Region{r}, Exact
-	}
-	tt := t.tag()
-	if tt, err := tt.Maximize(); err == nil {
-		return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
-	}
-	tt, _ = canonicalize(Deprecated|Macro, tt)
-	if tag, err := tt.Maximize(); err == nil {
-		return Region{tag.RegionID}, Low
-	}
-	return Region{_ZZ}, No // TODO: return world instead of undetermined?
-}
-
-// Variants returns the variants specified explicitly for this language tag.
-// or nil if no variant was specified.
-func (t Tag) Variants() []Variant {
-	if !compact.Tag(t).MayHaveVariants() {
-		return nil
-	}
-	v := []Variant{}
-	x, str := "", t.tag().Variants()
-	for str != "" {
-		x, str = nextToken(str)
-		v = append(v, Variant{x})
-	}
-	return v
-}
-
-// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
-// specific language are substituted with fields from the parent language.
-// The parent for a language may change for newer versions of CLDR.
-//
-// Parent returns a tag for a less specific language that is mutually
-// intelligible or Und if there is no such language. This may not be the same as
-// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
-// is "zh-Hant", and the parent of "zh-Hant" is "und".
-func (t Tag) Parent() Tag {
-	return Tag(compact.Tag(t).Parent())
-}
-
-// returns token t and the rest of the string.
-func nextToken(s string) (t, tail string) {
-	p := strings.Index(s[1:], "-")
-	if p == -1 {
-		return s[1:], ""
-	}
-	p++
-	return s[1:p], s[p:]
-}
-
-// Extension is a single BCP 47 extension.
-type Extension struct {
-	s string
-}
-
-// String returns the string representation of the extension, including the
-// type tag.
-func (e Extension) String() string {
-	return e.s
-}
-
-// ParseExtension parses s as an extension and returns it on success.
-func ParseExtension(s string) (e Extension, err error) {
-	ext, err := language.ParseExtension(s)
-	return Extension{ext}, err
-}
-
-// Type returns the one-byte extension type of e. It returns 0 for the zero
-// exception.
-func (e Extension) Type() byte {
-	if e.s == "" {
-		return 0
-	}
-	return e.s[0]
-}
-
-// Tokens returns the list of tokens of e.
-func (e Extension) Tokens() []string {
-	return strings.Split(e.s, "-")
-}
-
-// Extension returns the extension of type x for tag t. It will return
-// false for ok if t does not have the requested extension. The returned
-// extension will be invalid in this case.
-func (t Tag) Extension(x byte) (ext Extension, ok bool) {
-	if !compact.Tag(t).MayHaveExtensions() {
-		return Extension{}, false
-	}
-	e, ok := t.tag().Extension(x)
-	return Extension{e}, ok
-}
-
-// Extensions returns all extensions of t.
-func (t Tag) Extensions() []Extension {
-	if !compact.Tag(t).MayHaveExtensions() {
-		return nil
-	}
-	e := []Extension{}
-	for _, ext := range t.tag().Extensions() {
-		e = append(e, Extension{ext})
-	}
-	return e
-}
-
-// TypeForKey returns the type associated with the given key, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// TypeForKey will traverse the inheritance chain to get the correct value.
-//
-// If there are multiple types associated with a key, only the first will be
-// returned. If there is no type associated with a key, it returns the empty
-// string.
-func (t Tag) TypeForKey(key string) string {
-	if !compact.Tag(t).MayHaveExtensions() {
-		if key != "rg" && key != "va" {
-			return ""
-		}
-	}
-	return t.tag().TypeForKey(key)
-}
-
-// SetTypeForKey returns a new Tag with the key set to type, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// An empty value removes an existing pair with the same key.
-func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	tt, err := t.tag().SetTypeForKey(key, value)
-	return makeTag(tt), err
-}
-
-// NumCompactTags is the number of compact tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = compact.NumCompactTags
-
-// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository.The index will change over time
-// and should not be stored in persistent storage. If t does not match a compact
-// index, exact will be false and the compact index will be returned for the
-// first match after repeatedly taking the Parent of t.
-func CompactIndex(t Tag) (index int, exact bool) {
-	id, exact := compact.LanguageID(compact.Tag(t))
-	return int(id), exact
-}
-
-var root = language.Tag{}
-
-// Base is an ISO 639 language code, used for encoding the base language
-// of a language tag.
-type Base struct {
-	langID language.Language
-}
-
-// ParseBase parses a 2- or 3-letter ISO 639 code.
-// It returns a ValueError if s is a well-formed but unknown language identifier
-// or another error if another error occurred.
-func ParseBase(s string) (Base, error) {
-	l, err := language.ParseBase(s)
-	return Base{l}, err
-}
-
-// String returns the BCP 47 representation of the base language.
-func (b Base) String() string {
-	return b.langID.String()
-}
-
-// ISO3 returns the ISO 639-3 language code.
-func (b Base) ISO3() string {
-	return b.langID.ISO3()
-}
-
-// IsPrivateUse reports whether this language code is reserved for private use.
-func (b Base) IsPrivateUse() bool {
-	return b.langID.IsPrivateUse()
-}
-
-// Script is a 4-letter ISO 15924 code for representing scripts.
-// It is idiomatically represented in title case.
-type Script struct {
-	scriptID language.Script
-}
-
-// ParseScript parses a 4-letter ISO 15924 code.
-// It returns a ValueError if s is a well-formed but unknown script identifier
-// or another error if another error occurred.
-func ParseScript(s string) (Script, error) {
-	sc, err := language.ParseScript(s)
-	return Script{sc}, err
-}
-
-// String returns the script code in title case.
-// It returns "Zzzz" for an unspecified script.
-func (s Script) String() string {
-	return s.scriptID.String()
-}
-
-// IsPrivateUse reports whether this script code is reserved for private use.
-func (s Script) IsPrivateUse() bool {
-	return s.scriptID.IsPrivateUse()
-}
-
-// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
-type Region struct {
-	regionID language.Region
-}
-
-// EncodeM49 returns the Region for the given UN M.49 code.
-// It returns an error if r is not a valid code.
-func EncodeM49(r int) (Region, error) {
-	rid, err := language.EncodeM49(r)
-	return Region{rid}, err
-}
-
-// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
-// It returns a ValueError if s is a well-formed but unknown region identifier
-// or another error if another error occurred.
-func ParseRegion(s string) (Region, error) {
-	r, err := language.ParseRegion(s)
-	return Region{r}, err
-}
-
-// String returns the BCP 47 representation for the region.
-// It returns "ZZ" for an unspecified region.
-func (r Region) String() string {
-	return r.regionID.String()
-}
-
-// ISO3 returns the 3-letter ISO code of r.
-// Note that not all regions have a 3-letter ISO code.
-// In such cases this method returns "ZZZ".
-func (r Region) ISO3() string {
-	return r.regionID.ISO3()
-}
-
-// M49 returns the UN M.49 encoding of r, or 0 if this encoding
-// is not defined for r.
-func (r Region) M49() int {
-	return r.regionID.M49()
-}
-
-// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
-// may include private-use tags that are assigned by CLDR and used in this
-// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r Region) IsPrivateUse() bool {
-	return r.regionID.IsPrivateUse()
-}
-
-// IsCountry returns whether this region is a country or autonomous area. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsCountry() bool {
-	return r.regionID.IsCountry()
-}
-
-// IsGroup returns whether this region defines a collection of regions. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsGroup() bool {
-	return r.regionID.IsGroup()
-}
-
-// Contains returns whether Region c is contained by Region r. It returns true
-// if c == r.
-func (r Region) Contains(c Region) bool {
-	return r.regionID.Contains(c.regionID)
-}
-
-// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
-// In all other cases it returns either the region itself or an error.
-//
-// This method may return an error for a region for which there exists a
-// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
-// region will already be canonicalized it was obtained from a Tag that was
-// obtained using any of the default methods.
-func (r Region) TLD() (Region, error) {
-	tld, err := r.regionID.TLD()
-	return Region{tld}, err
-}
-
-// Canonicalize returns the region or a possible replacement if the region is
-// deprecated. It will not return a replacement for deprecated regions that
-// are split into multiple regions.
-func (r Region) Canonicalize() Region {
-	return Region{r.regionID.Canonicalize()}
-}
-
-// Variant represents a registered variant of a language as defined by BCP 47.
-type Variant struct {
-	variant string
-}
-
-// ParseVariant parses and returns a Variant. An error is returned if s is not
-// a valid variant.
-func ParseVariant(s string) (Variant, error) {
-	v, err := language.ParseVariant(s)
-	return Variant{v.String()}, err
-}
-
-// String returns the string representation of the variant.
-func (v Variant) String() string {
-	return v.variant
-}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
deleted file mode 100644
index f734921349..0000000000
--- a/vendor/golang.org/x/text/language/match.go
+++ /dev/null
@@ -1,735 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"errors"
-	"strings"
-
-	"golang.org/x/text/internal/language"
-)
-
-// A MatchOption configures a Matcher.
-type MatchOption func(*matcher)
-
-// PreferSameScript will, in the absence of a match, result in the first
-// preferred tag with the same script as a supported tag to match this supported
-// tag. The default is currently true, but this may change in the future.
-func PreferSameScript(preferSame bool) MatchOption {
-	return func(m *matcher) { m.preferSameScript = preferSame }
-}
-
-// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface.
-// There doesn't seem to be too much need for multiple types.
-// Making it a concrete type allows MatchStrings to be a method, which will
-// improve its discoverability.
-
-// MatchStrings parses and matches the given strings until one of them matches
-// the language in the Matcher. A string may be an Accept-Language header as
-// handled by ParseAcceptLanguage. The default language is returned if no
-// other language matched.
-func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) {
-	for _, accept := range lang {
-		desired, _, err := ParseAcceptLanguage(accept)
-		if err != nil {
-			continue
-		}
-		if tag, index, conf := m.Match(desired...); conf != No {
-			return tag, index
-		}
-	}
-	tag, index, _ = m.Match()
-	return
-}
-
-// Matcher is the interface that wraps the Match method.
-//
-// Match returns the best match for any of the given tags, along with
-// a unique index associated with the returned tag and a confidence
-// score.
-type Matcher interface {
-	Match(t ...Tag) (tag Tag, index int, c Confidence)
-}
-
-// Comprehends reports the confidence score for a speaker of a given language
-// to being able to comprehend the written form of an alternative language.
-func Comprehends(speaker, alternative Tag) Confidence {
-	_, _, c := NewMatcher([]Tag{alternative}).Match(speaker)
-	return c
-}
-
-// NewMatcher returns a Matcher that matches an ordered list of preferred tags
-// against a list of supported tags based on written intelligibility, closeness
-// of dialect, equivalence of subtags and various other rules. It is initialized
-// with the list of supported tags. The first element is used as the default
-// value in case no match is found.
-//
-// Its Match method matches the first of the given Tags to reach a certain
-// confidence threshold. The tags passed to Match should therefore be specified
-// in order of preference. Extensions are ignored for matching.
-//
-// The index returned by the Match method corresponds to the index of the
-// matched tag in t, but is augmented with the Unicode extension ('u')of the
-// corresponding preferred tag. This allows user locale options to be passed
-// transparently.
-func NewMatcher(t []Tag, options ...MatchOption) Matcher {
-	return newMatcher(t, options)
-}
-
-func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
-	var tt language.Tag
-	match, w, c := m.getBest(want...)
-	if match != nil {
-		tt, index = match.tag, match.index
-	} else {
-		// TODO: this should be an option
-		tt = m.default_.tag
-		if m.preferSameScript {
-		outer:
-			for _, w := range want {
-				script, _ := w.Script()
-				if script.scriptID == 0 {
-					// Don't do anything if there is no script, such as with
-					// private subtags.
-					continue
-				}
-				for i, h := range m.supported {
-					if script.scriptID == h.maxScript {
-						tt, index = h.tag, i
-						break outer
-					}
-				}
-			}
-		}
-		// TODO: select first language tag based on script.
-	}
-	if w.RegionID != tt.RegionID && w.RegionID != 0 {
-		if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
-			tt.RegionID = w.RegionID
-			tt.RemakeString()
-		} else if r := w.RegionID.String(); len(r) == 2 {
-			// TODO: also filter macro and deprecated.
-			tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
-		}
-	}
-	// Copy options from the user-provided tag into the result tag. This is hard
-	// to do after the fact, so we do it here.
-	// TODO: add in alternative variants to -u-va-.
-	// TODO: add preferred region to -u-rg-.
-	if e := w.Extensions(); len(e) > 0 {
-		b := language.Builder{}
-		b.SetTag(tt)
-		for _, e := range e {
-			b.AddExt(e)
-		}
-		tt = b.Make()
-	}
-	return makeTag(tt), index, c
-}
-
-// ErrMissingLikelyTagsData indicates no information was available
-// to compute likely values of missing tags.
-var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-
-// func (t *Tag) setTagsFrom(id Tag) {
-// 	t.LangID = id.LangID
-// 	t.ScriptID = id.ScriptID
-// 	t.RegionID = id.RegionID
-// }
-
-// Tag Matching
-// CLDR defines an algorithm for finding the best match between two sets of language
-// tags. The basic algorithm defines how to score a possible match and then find
-// the match with the best score
-// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
-// Using scoring has several disadvantages. The scoring obfuscates the importance of
-// the various factors considered, making the algorithm harder to understand. Using
-// scoring also requires the full score to be computed for each pair of tags.
-//
-// We will use a different algorithm which aims to have the following properties:
-// - clarity on the precedence of the various selection factors, and
-// - improved performance by allowing early termination of a comparison.
-//
-// Matching algorithm (overview)
-// Input:
-//   - supported: a set of supported tags
-//   - default:   the default tag to return in case there is no match
-//   - desired:   list of desired tags, ordered by preference, starting with
-//                the most-preferred.
-//
-// Algorithm:
-//   1) Set the best match to the lowest confidence level
-//   2) For each tag in "desired":
-//     a) For each tag in "supported":
-//        1) compute the match between the two tags.
-//        2) if the match is better than the previous best match, replace it
-//           with the new match. (see next section)
-//     b) if the current best match is Exact and pin is true the result will be
-//        frozen to the language found thusfar, although better matches may
-//        still be found for the same language.
-//   3) If the best match so far is below a certain threshold, return "default".
-//
-// Ranking:
-// We use two phases to determine whether one pair of tags are a better match
-// than another pair of tags. First, we determine a rough confidence level. If the
-// levels are different, the one with the highest confidence wins.
-// Second, if the rough confidence levels are identical, we use a set of tie-breaker
-// rules.
-//
-// The confidence level of matching a pair of tags is determined by finding the
-// lowest confidence level of any matches of the corresponding subtags (the
-// result is deemed as good as its weakest link).
-// We define the following levels:
-//   Exact    - An exact match of a subtag, before adding likely subtags.
-//   MaxExact - An exact match of a subtag, after adding likely subtags.
-//              [See Note 2].
-//   High     - High level of mutual intelligibility between different subtag
-//              variants.
-//   Low      - Low level of mutual intelligibility between different subtag
-//              variants.
-//   No       - No mutual intelligibility.
-//
-// The following levels can occur for each type of subtag:
-//   Base:    Exact, MaxExact, High, Low, No
-//   Script:  Exact, MaxExact [see Note 3], Low, No
-//   Region:  Exact, MaxExact, High
-//   Variant: Exact, High
-//   Private: Exact, No
-//
-// Any result with a confidence level of Low or higher is deemed a possible match.
-// Once a desired tag matches any of the supported tags with a level of MaxExact
-// or higher, the next desired tag is not considered (see Step 2.b).
-// Note that CLDR provides languageMatching data that defines close equivalence
-// classes for base languages, scripts and regions.
-//
-// Tie-breaking
-// If we get the same confidence level for two matches, we apply a sequence of
-// tie-breaking rules. The first that succeeds defines the result. The rules are
-// applied in the following order.
-//   1) Original language was defined and was identical.
-//   2) Original region was defined and was identical.
-//   3) Distance between two maximized regions was the smallest.
-//   4) Original script was defined and was identical.
-//   5) Distance from want tag to have tag using the parent relation [see Note 5.]
-// If there is still no winner after these rules are applied, the first match
-// found wins.
-//
-// Notes:
-// [2] In practice, as matching of Exact is done in a separate phase from
-//     matching the other levels, we reuse the Exact level to mean MaxExact in
-//     the second phase. As a consequence, we only need the levels defined by
-//     the Confidence type. The MaxExact confidence level is mapped to High in
-//     the public API.
-// [3] We do not differentiate between maximized script values that were derived
-//     from suppressScript versus most likely tag data. We determined that in
-//     ranking the two, one ranks just after the other. Moreover, the two cannot
-//     occur concurrently. As a consequence, they are identical for practical
-//     purposes.
-// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign
-//     the MaxExact level to allow iw vs he to still be a closer match than
-//     en-AU vs en-US, for example.
-// [5] In CLDR a locale inherits fields that are unspecified for this locale
-//     from its parent. Therefore, if a locale is a parent of another locale,
-//     it is a strong measure for closeness, especially when no other tie
-//     breaker rule applies. One could also argue it is inconsistent, for
-//     example, when pt-AO matches pt (which CLDR equates with pt-BR), even
-//     though its parent is pt-PT according to the inheritance rules.
-//
-// Implementation Details:
-// There are several performance considerations worth pointing out. Most notably,
-// we preprocess as much as possible (within reason) at the time of creation of a
-// matcher. This includes:
-//   - creating a per-language map, which includes data for the raw base language
-//     and its canonicalized variant (if applicable),
-//   - expanding entries for the equivalence classes defined in CLDR's
-//     languageMatch data.
-// The per-language map ensures that typically only a very small number of tags
-// need to be considered. The pre-expansion of canonicalized subtags and
-// equivalence classes reduces the amount of map lookups that need to be done at
-// runtime.
-
-// matcher keeps a set of supported language tags, indexed by language.
-type matcher struct {
-	default_         *haveTag
-	supported        []*haveTag
-	index            map[language.Language]*matchHeader
-	passSettings     bool
-	preferSameScript bool
-}
-
-// matchHeader has the lists of tags for exact matches and matches based on
-// maximized and canonicalized tags for a given language.
-type matchHeader struct {
-	haveTags []*haveTag
-	original bool
-}
-
-// haveTag holds a supported Tag and its maximized script and region. The maximized
-// or canonicalized language is not stored as it is not needed during matching.
-type haveTag struct {
-	tag language.Tag
-
-	// index of this tag in the original list of supported tags.
-	index int
-
-	// conf is the maximum confidence that can result from matching this haveTag.
-	// When conf < Exact this means it was inserted after applying a CLDR equivalence rule.
-	conf Confidence
-
-	// Maximized region and script.
-	maxRegion language.Region
-	maxScript language.Script
-
-	// altScript may be checked as an alternative match to maxScript. If altScript
-	// matches, the confidence level for this match is Low. Theoretically there
-	// could be multiple alternative scripts. This does not occur in practice.
-	altScript language.Script
-
-	// nextMax is the index of the next haveTag with the same maximized tags.
-	nextMax uint16
-}
-
-func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
-	max := tag
-	if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
-		max, _ = canonicalize(All, max)
-		max, _ = max.Maximize()
-		max.RemakeString()
-	}
-	return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
-}
-
-// altScript returns an alternative script that may match the given script with
-// a low confidence.  At the moment, the langMatch data allows for at most one
-// script to map to another and we rely on this to keep the code simple.
-func altScript(l language.Language, s language.Script) language.Script {
-	for _, alt := range matchScript {
-		// TODO: also match cases where language is not the same.
-		if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
-			language.Script(alt.haveScript) == s {
-			return language.Script(alt.wantScript)
-		}
-	}
-	return 0
-}
-
-// addIfNew adds a haveTag to the list of tags only if it is a unique tag.
-// Tags that have the same maximized values are linked by index.
-func (h *matchHeader) addIfNew(n haveTag, exact bool) {
-	h.original = h.original || exact
-	// Don't add new exact matches.
-	for _, v := range h.haveTags {
-		if equalsRest(v.tag, n.tag) {
-			return
-		}
-	}
-	// Allow duplicate maximized tags, but create a linked list to allow quickly
-	// comparing the equivalents and bail out.
-	for i, v := range h.haveTags {
-		if v.maxScript == n.maxScript &&
-			v.maxRegion == n.maxRegion &&
-			v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
-			for h.haveTags[i].nextMax != 0 {
-				i = int(h.haveTags[i].nextMax)
-			}
-			h.haveTags[i].nextMax = uint16(len(h.haveTags))
-			break
-		}
-	}
-	h.haveTags = append(h.haveTags, &n)
-}
-
-// header returns the matchHeader for the given language. It creates one if
-// it doesn't already exist.
-func (m *matcher) header(l language.Language) *matchHeader {
-	if h := m.index[l]; h != nil {
-		return h
-	}
-	h := &matchHeader{}
-	m.index[l] = h
-	return h
-}
-
-func toConf(d uint8) Confidence {
-	if d <= 10 {
-		return High
-	}
-	if d < 30 {
-		return Low
-	}
-	return No
-}
-
-// newMatcher builds an index for the given supported tags and returns it as
-// a matcher. It also expands the index by considering various equivalence classes
-// for a given tag.
-func newMatcher(supported []Tag, options []MatchOption) *matcher {
-	m := &matcher{
-		index:            make(map[language.Language]*matchHeader),
-		preferSameScript: true,
-	}
-	for _, o := range options {
-		o(m)
-	}
-	if len(supported) == 0 {
-		m.default_ = &haveTag{}
-		return m
-	}
-	// Add supported languages to the index. Add exact matches first to give
-	// them precedence.
-	for i, tag := range supported {
-		tt := tag.tag()
-		pair, _ := makeHaveTag(tt, i)
-		m.header(tt.LangID).addIfNew(pair, true)
-		m.supported = append(m.supported, &pair)
-	}
-	m.default_ = m.header(supported[0].lang()).haveTags[0]
-	// Keep these in two different loops to support the case that two equivalent
-	// languages are distinguished, such as iw and he.
-	for i, tag := range supported {
-		tt := tag.tag()
-		pair, max := makeHaveTag(tt, i)
-		if max != tt.LangID {
-			m.header(max).addIfNew(pair, true)
-		}
-	}
-
-	// update is used to add indexes in the map for equivalent languages.
-	// update will only add entries to original indexes, thus not computing any
-	// transitive relations.
-	update := func(want, have uint16, conf Confidence) {
-		if hh := m.index[language.Language(have)]; hh != nil {
-			if !hh.original {
-				return
-			}
-			hw := m.header(language.Language(want))
-			for _, ht := range hh.haveTags {
-				v := *ht
-				if conf < v.conf {
-					v.conf = conf
-				}
-				v.nextMax = 0 // this value needs to be recomputed
-				if v.altScript != 0 {
-					v.altScript = altScript(language.Language(want), v.maxScript)
-				}
-				hw.addIfNew(v, conf == Exact && hh.original)
-			}
-		}
-	}
-
-	// Add entries for languages with mutual intelligibility as defined by CLDR's
-	// languageMatch data.
-	for _, ml := range matchLang {
-		update(ml.want, ml.have, toConf(ml.distance))
-		if !ml.oneway {
-			update(ml.have, ml.want, toConf(ml.distance))
-		}
-	}
-
-	// Add entries for possible canonicalizations. This is an optimization to
-	// ensure that only one map lookup needs to be done at runtime per desired tag.
-	// First we match deprecated equivalents. If they are perfect equivalents
-	// (their canonicalization simply substitutes a different language code, but
-	// nothing else), the match confidence is Exact, otherwise it is High.
-	for i, lm := range language.AliasMap {
-		// If deprecated codes match and there is no fiddling with the script or
-		// or region, we consider it an exact match.
-		conf := Exact
-		if language.AliasTypes[i] != language.Macro {
-			if !isExactEquivalent(language.Language(lm.From)) {
-				conf = High
-			}
-			update(lm.To, lm.From, conf)
-		}
-		update(lm.From, lm.To, conf)
-	}
-	return m
-}
-
-// getBest gets the best matching tag in m for any of the given tags, taking into
-// account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
-	best := bestMatch{}
-	for i, ww := range want {
-		w := ww.tag()
-		var max language.Tag
-		// Check for exact match first.
-		h := m.index[w.LangID]
-		if w.LangID != 0 {
-			if h == nil {
-				continue
-			}
-			// Base language is defined.
-			max, _ = canonicalize(Legacy|Deprecated|Macro, w)
-			// A region that is added through canonicalization is stronger than
-			// a maximized region: set it in the original (e.g. mo -> ro-MD).
-			if w.RegionID != max.RegionID {
-				w.RegionID = max.RegionID
-			}
-			// TODO: should we do the same for scripts?
-			// See test case: en, sr, nl ; sh ; sr
-			max, _ = max.Maximize()
-		} else {
-			// Base language is not defined.
-			if h != nil {
-				for i := range h.haveTags {
-					have := h.haveTags[i]
-					if equalsRest(have.tag, w) {
-						return have, w, Exact
-					}
-				}
-			}
-			if w.ScriptID == 0 && w.RegionID == 0 {
-				// We skip all tags matching und for approximate matching, including
-				// private tags.
-				continue
-			}
-			max, _ = w.Maximize()
-			if h = m.index[max.LangID]; h == nil {
-				continue
-			}
-		}
-		pin := true
-		for _, t := range want[i+1:] {
-			if w.LangID == t.lang() {
-				pin = false
-				break
-			}
-		}
-		// Check for match based on maximized tag.
-		for i := range h.haveTags {
-			have := h.haveTags[i]
-			best.update(have, w, max.ScriptID, max.RegionID, pin)
-			if best.conf == Exact {
-				for have.nextMax != 0 {
-					have = h.haveTags[have.nextMax]
-					best.update(have, w, max.ScriptID, max.RegionID, pin)
-				}
-				return best.have, best.want, best.conf
-			}
-		}
-	}
-	if best.conf <= No {
-		if len(want) != 0 {
-			return nil, want[0].tag(), No
-		}
-		return nil, language.Tag{}, No
-	}
-	return best.have, best.want, best.conf
-}
-
-// bestMatch accumulates the best match so far.
-type bestMatch struct {
-	have            *haveTag
-	want            language.Tag
-	conf            Confidence
-	pinnedRegion    language.Region
-	pinLanguage     bool
-	sameRegionGroup bool
-	// Cached results from applying tie-breaking rules.
-	origLang     bool
-	origReg      bool
-	paradigmReg  bool
-	regGroupDist uint8
-	origScript   bool
-}
-
-// update updates the existing best match if the new pair is considered to be a
-// better match. To determine if the given pair is a better match, it first
-// computes the rough confidence level. If this surpasses the current match, it
-// will replace it and update the tie-breaker rule cache. If there is a tie, it
-// proceeds with applying a series of tie-breaker rules. If there is no
-// conclusive winner after applying the tie-breaker rules, it leaves the current
-// match as the preferred match.
-//
-// If pin is true and have and tag are a strong match, it will henceforth only
-// consider matches for this language. This corresponds to the nothing that most
-// users have a strong preference for the first defined language. A user can
-// still prefer a second language over a dialect of the preferred language by
-// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
-// be false.
-func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
-	// Bail if the maximum attainable confidence is below that of the current best match.
-	c := have.conf
-	if c < m.conf {
-		return
-	}
-	// Don't change the language once we already have found an exact match.
-	if m.pinLanguage && tag.LangID != m.want.LangID {
-		return
-	}
-	// Pin the region group if we are comparing tags for the same language.
-	if tag.LangID == m.want.LangID && m.sameRegionGroup {
-		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
-		if !sameGroup {
-			return
-		}
-	}
-	if c == Exact && have.maxScript == maxScript {
-		// If there is another language and then another entry of this language,
-		// don't pin anything, otherwise pin the language.
-		m.pinLanguage = pin
-	}
-	if equalsRest(have.tag, tag) {
-	} else if have.maxScript != maxScript {
-		// There is usually very little comprehension between different scripts.
-		// In a few cases there may still be Low comprehension. This possibility
-		// is pre-computed and stored in have.altScript.
-		if Low < m.conf || have.altScript != maxScript {
-			return
-		}
-		c = Low
-	} else if have.maxRegion != maxRegion {
-		if High < c {
-			// There is usually a small difference between languages across regions.
-			c = High
-		}
-	}
-
-	// We store the results of the computations of the tie-breaker rules along
-	// with the best match. There is no need to do the checks once we determine
-	// we have a winner, but we do still need to do the tie-breaker computations.
-	// We use "beaten" to keep track if we still need to do the checks.
-	beaten := false // true if the new pair defeats the current one.
-	if c != m.conf {
-		if c < m.conf {
-			return
-		}
-		beaten = true
-	}
-
-	// Tie-breaker rules:
-	// We prefer if the pre-maximized language was specified and identical.
-	origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
-	if !beaten && m.origLang != origLang {
-		if m.origLang {
-			return
-		}
-		beaten = true
-	}
-
-	// We prefer if the pre-maximized region was specified and identical.
-	origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
-	if !beaten && m.origReg != origReg {
-		if m.origReg {
-			return
-		}
-		beaten = true
-	}
-
-	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
-	if !beaten && m.regGroupDist != regGroupDist {
-		if regGroupDist > m.regGroupDist {
-			return
-		}
-		beaten = true
-	}
-
-	paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
-	if !beaten && m.paradigmReg != paradigmReg {
-		if !paradigmReg {
-			return
-		}
-		beaten = true
-	}
-
-	// Next we prefer if the pre-maximized script was specified and identical.
-	origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
-	if !beaten && m.origScript != origScript {
-		if m.origScript {
-			return
-		}
-		beaten = true
-	}
-
-	// Update m to the newly found best match.
-	if beaten {
-		m.have = have
-		m.want = tag
-		m.conf = c
-		m.pinnedRegion = maxRegion
-		m.sameRegionGroup = sameGroup
-		m.origLang = origLang
-		m.origReg = origReg
-		m.paradigmReg = paradigmReg
-		m.origScript = origScript
-		m.regGroupDist = regGroupDist
-	}
-}
-
-func isParadigmLocale(lang language.Language, r language.Region) bool {
-	for _, e := range paradigmLocales {
-		if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
-			return true
-		}
-	}
-	return false
-}
-
-// regionGroupDist computes the distance between two regions based on their
-// CLDR grouping.
-func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
-	const defaultDistance = 4
-
-	aGroup := uint(regionToGroups[a]) << 1
-	bGroup := uint(regionToGroups[b]) << 1
-	for _, ri := range matchRegion {
-		if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
-			group := uint(1 << (ri.group &^ 0x80))
-			if 0x80&ri.group == 0 {
-				if aGroup&bGroup&group != 0 { // Both regions are in the group.
-					return ri.distance, ri.distance == defaultDistance
-				}
-			} else {
-				if (aGroup|bGroup)&group == 0 { // Both regions are not in the group.
-					return ri.distance, ri.distance == defaultDistance
-				}
-			}
-		}
-	}
-	return defaultDistance, true
-}
-
-// equalsRest compares everything except the language.
-func equalsRest(a, b language.Tag) bool {
-	// TODO: don't include extensions in this comparison. To do this efficiently,
-	// though, we should handle private tags separately.
-	return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
-}
-
-// isExactEquivalent returns true if canonicalizing the language will not alter
-// the script or region of a tag.
-func isExactEquivalent(l language.Language) bool {
-	for _, o := range notEquivalent {
-		if o == l {
-			return false
-		}
-	}
-	return true
-}
-
-var notEquivalent []language.Language
-
-func init() {
-	// Create a list of all languages for which canonicalization may alter the
-	// script or region.
-	for _, lm := range language.AliasMap {
-		tag := language.Tag{LangID: language.Language(lm.From)}
-		if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
-			notEquivalent = append(notEquivalent, language.Language(lm.From))
-		}
-	}
-	// Maximize undefined regions of paradigm locales.
-	for i, v := range paradigmLocales {
-		t := language.Tag{LangID: language.Language(v[0])}
-		max, _ := t.Maximize()
-		if v[1] == 0 {
-			paradigmLocales[i][1] = uint16(max.RegionID)
-		}
-		if v[2] == 0 {
-			paradigmLocales[i][2] = uint16(max.RegionID)
-		}
-	}
-}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
deleted file mode 100644
index 59b0410080..0000000000
--- a/vendor/golang.org/x/text/language/parse.go
+++ /dev/null
@@ -1,250 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"errors"
-	"strconv"
-	"strings"
-
-	"golang.org/x/text/internal/language"
-)
-
-// ValueError is returned by any of the parsing functions when the
-// input is well-formed but the respective subtag is not recognized
-// as a valid value.
-type ValueError interface {
-	error
-
-	// Subtag returns the subtag for which the error occurred.
-	Subtag() string
-}
-
-// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
-// failed it returns an error and any part of the tag that could be parsed.
-// If parsing succeeded but an unknown value was found, it returns
-// ValueError. The Tag returned in this case is just stripped of the unknown
-// value. All other values are preserved. It accepts tags in the BCP 47 format
-// and extensions to this standard defined in
-// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the default canonicalization type.
-func Parse(s string) (t Tag, err error) {
-	return Default.Parse(s)
-}
-
-// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
-// failed it returns an error and any part of the tag that could be parsed.
-// If parsing succeeded but an unknown value was found, it returns
-// ValueError. The Tag returned in this case is just stripped of the unknown
-// value. All other values are preserved. It accepts tags in the BCP 47 format
-// and extensions to this standard defined in
-// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the canonicalization type c.
-func (c CanonType) Parse(s string) (t Tag, err error) {
-	defer func() {
-		if recover() != nil {
-			t = Tag{}
-			err = language.ErrSyntax
-		}
-	}()
-
-	tt, err := language.Parse(s)
-	if err != nil {
-		return makeTag(tt), err
-	}
-	tt, changed := canonicalize(c, tt)
-	if changed {
-		tt.RemakeString()
-	}
-	return makeTag(tt), err
-}
-
-// Compose creates a Tag from individual parts, which may be of type Tag, Base,
-// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
-// Base, Script or Region or slice of type Variant or Extension is passed more
-// than once, the latter will overwrite the former. Variants and Extensions are
-// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. For -u extensions, though, the key-type pairs are
-// added, where later values overwrite older ones. A Tag overwrites all former
-// values and typically only makes sense as the first argument. The resulting
-// tag is returned after canonicalizing using the Default CanonType. If one or
-// more errors are encountered, one of the errors is returned.
-func Compose(part ...interface{}) (t Tag, err error) {
-	return Default.Compose(part...)
-}
-
-// Compose creates a Tag from individual parts, which may be of type Tag, Base,
-// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
-// Base, Script or Region or slice of type Variant or Extension is passed more
-// than once, the latter will overwrite the former. Variants and Extensions are
-// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. For -u extensions, though, the key-type pairs are
-// added, where later values overwrite older ones. A Tag overwrites all former
-// values and typically only makes sense as the first argument. The resulting
-// tag is returned after canonicalizing using CanonType c. If one or more errors
-// are encountered, one of the errors is returned.
-func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
-	defer func() {
-		if recover() != nil {
-			t = Tag{}
-			err = language.ErrSyntax
-		}
-	}()
-
-	var b language.Builder
-	if err = update(&b, part...); err != nil {
-		return und, err
-	}
-	b.Tag, _ = canonicalize(c, b.Tag)
-	return makeTag(b.Make()), err
-}
-
-var errInvalidArgument = errors.New("invalid Extension or Variant")
-
-func update(b *language.Builder, part ...interface{}) (err error) {
-	for _, x := range part {
-		switch v := x.(type) {
-		case Tag:
-			b.SetTag(v.tag())
-		case Base:
-			b.Tag.LangID = v.langID
-		case Script:
-			b.Tag.ScriptID = v.scriptID
-		case Region:
-			b.Tag.RegionID = v.regionID
-		case Variant:
-			if v.variant == "" {
-				err = errInvalidArgument
-				break
-			}
-			b.AddVariant(v.variant)
-		case Extension:
-			if v.s == "" {
-				err = errInvalidArgument
-				break
-			}
-			b.SetExt(v.s)
-		case []Variant:
-			b.ClearVariants()
-			for _, v := range v {
-				b.AddVariant(v.variant)
-			}
-		case []Extension:
-			b.ClearExtensions()
-			for _, e := range v {
-				b.SetExt(e.s)
-			}
-		// TODO: support parsing of raw strings based on morphology or just extensions?
-		case error:
-			if v != nil {
-				err = v
-			}
-		}
-	}
-	return
-}
-
-var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
-
-// ParseAcceptLanguage parses the contents of an Accept-Language header as
-// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
-// a list of corresponding quality weights. It is more permissive than RFC 2616
-// and may return non-nil slices even if the input is not valid.
-// The Tags will be sorted by highest weight first and then by first occurrence.
-// Tags with a weight of zero will be dropped. An error will be returned if the
-// input could not be parsed.
-func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
-	defer func() {
-		if recover() != nil {
-			tag = nil
-			q = nil
-			err = language.ErrSyntax
-		}
-	}()
-
-	var entry string
-	for s != "" {
-		if entry, s = split(s, ','); entry == "" {
-			continue
-		}
-
-		entry, weight := split(entry, ';')
-
-		// Scan the language.
-		t, err := Parse(entry)
-		if err != nil {
-			id, ok := acceptFallback[entry]
-			if !ok {
-				return nil, nil, err
-			}
-			t = makeTag(language.Tag{LangID: id})
-		}
-
-		// Scan the optional weight.
-		w := 1.0
-		if weight != "" {
-			weight = consume(weight, 'q')
-			weight = consume(weight, '=')
-			// consume returns the empty string when a token could not be
-			// consumed, resulting in an error for ParseFloat.
-			if w, err = strconv.ParseFloat(weight, 32); err != nil {
-				return nil, nil, errInvalidWeight
-			}
-			// Drop tags with a quality weight of 0.
-			if w <= 0 {
-				continue
-			}
-		}
-
-		tag = append(tag, t)
-		q = append(q, float32(w))
-	}
-	sortStable(&tagSort{tag, q})
-	return tag, q, nil
-}
-
-// consume removes a leading token c from s and returns the result or the empty
-// string if there is no such token.
-func consume(s string, c byte) string {
-	if s == "" || s[0] != c {
-		return ""
-	}
-	return strings.TrimSpace(s[1:])
-}
-
-func split(s string, c byte) (head, tail string) {
-	if i := strings.IndexByte(s, c); i >= 0 {
-		return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:])
-	}
-	return strings.TrimSpace(s), ""
-}
-
-// Add hack mapping to deal with a small number of cases that occur
-// in Accept-Language (with reasonable frequency).
-var acceptFallback = map[string]language.Language{
-	"english": _en,
-	"deutsch": _de,
-	"italian": _it,
-	"french":  _fr,
-	"*":       _mul, // defined in the spec to match all languages.
-}
-
-type tagSort struct {
-	tag []Tag
-	q   []float32
-}
-
-func (s *tagSort) Len() int {
-	return len(s.q)
-}
-
-func (s *tagSort) Less(i, j int) bool {
-	return s.q[i] > s.q[j]
-}
-
-func (s *tagSort) Swap(i, j int) {
-	s.tag[i], s.tag[j] = s.tag[j], s.tag[i]
-	s.q[i], s.q[j] = s.q[j], s.q[i]
-}
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
deleted file mode 100644
index 96b57f610a..0000000000
--- a/vendor/golang.org/x/text/language/tables.go
+++ /dev/null
@@ -1,298 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "32"
-
-const (
-	_de  = 269
-	_en  = 313
-	_fr  = 350
-	_it  = 505
-	_mo  = 784
-	_no  = 879
-	_nb  = 839
-	_pt  = 960
-	_sh  = 1031
-	_mul = 806
-	_und = 0
-)
-const (
-	_001 = 1
-	_419 = 31
-	_BR  = 65
-	_CA  = 73
-	_ES  = 110
-	_GB  = 123
-	_MD  = 188
-	_PT  = 238
-	_UK  = 306
-	_US  = 309
-	_ZZ  = 357
-	_XA  = 323
-	_XC  = 325
-	_XK  = 333
-)
-const (
-	_Latn = 90
-	_Hani = 57
-	_Hans = 59
-	_Hant = 60
-	_Qaaa = 143
-	_Qaai = 151
-	_Qabx = 192
-	_Zinh = 245
-	_Zyyy = 250
-	_Zzzz = 251
-)
-
-var regionToGroups = []uint8{ // 358 elements
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00,
-	0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04,
-	// Entry 40 - 7F
-	0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08,
-	0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00,
-	0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00,
-	// Entry C0 - FF
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01,
-	0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00,
-	0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00,
-	// Entry 140 - 17F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-} // Size: 382 bytes
-
-var paradigmLocales = [][3]uint16{ // 3 elements
-	0: [3]uint16{0x139, 0x0, 0x7b},
-	1: [3]uint16{0x13e, 0x0, 0x1f},
-	2: [3]uint16{0x3c0, 0x41, 0xee},
-} // Size: 42 bytes
-
-type mutualIntelligibility struct {
-	want     uint16
-	have     uint16
-	distance uint8
-	oneway   bool
-}
-type scriptIntelligibility struct {
-	wantLang   uint16
-	haveLang   uint16
-	wantScript uint8
-	haveScript uint8
-	distance   uint8
-}
-type regionIntelligibility struct {
-	lang     uint16
-	script   uint8
-	group    uint8
-	distance uint8
-}
-
-// matchLang holds pairs of langIDs of base languages that are typically
-// mutually intelligible. Each pair is associated with a confidence and
-// whether the intelligibility goes one or both ways.
-var matchLang = []mutualIntelligibility{ // 113 elements
-	0:   {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
-	1:   {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
-	2:   {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
-	3:   {want: 0x407, have: 0x432, distance: 0x4, oneway: false},
-	4:   {want: 0x43a, have: 0x1, distance: 0x4, oneway: false},
-	5:   {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true},
-	6:   {want: 0x295, have: 0x10d, distance: 0x4, oneway: true},
-	7:   {want: 0x101, have: 0x36f, distance: 0x8, oneway: false},
-	8:   {want: 0x101, have: 0x347, distance: 0x8, oneway: false},
-	9:   {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true},
-	10:  {want: 0xd, have: 0x139, distance: 0xa, oneway: true},
-	11:  {want: 0x16, have: 0x367, distance: 0xa, oneway: true},
-	12:  {want: 0x21, have: 0x139, distance: 0xa, oneway: true},
-	13:  {want: 0x56, have: 0x13e, distance: 0xa, oneway: true},
-	14:  {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true},
-	15:  {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true},
-	16:  {want: 0x75, have: 0x139, distance: 0xa, oneway: true},
-	17:  {want: 0x82, have: 0x1be, distance: 0xa, oneway: true},
-	18:  {want: 0xa5, have: 0x139, distance: 0xa, oneway: true},
-	19:  {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true},
-	20:  {want: 0xdd, have: 0x153, distance: 0xa, oneway: true},
-	21:  {want: 0xe5, have: 0x139, distance: 0xa, oneway: true},
-	22:  {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true},
-	23:  {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true},
-	24:  {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true},
-	25:  {want: 0x100, have: 0x139, distance: 0xa, oneway: true},
-	26:  {want: 0x130, have: 0x139, distance: 0xa, oneway: true},
-	27:  {want: 0x13c, have: 0x139, distance: 0xa, oneway: true},
-	28:  {want: 0x140, have: 0x151, distance: 0xa, oneway: true},
-	29:  {want: 0x145, have: 0x13e, distance: 0xa, oneway: true},
-	30:  {want: 0x158, have: 0x101, distance: 0xa, oneway: true},
-	31:  {want: 0x16d, have: 0x367, distance: 0xa, oneway: true},
-	32:  {want: 0x16e, have: 0x139, distance: 0xa, oneway: true},
-	33:  {want: 0x16f, have: 0x139, distance: 0xa, oneway: true},
-	34:  {want: 0x17e, have: 0x139, distance: 0xa, oneway: true},
-	35:  {want: 0x190, have: 0x13e, distance: 0xa, oneway: true},
-	36:  {want: 0x194, have: 0x13e, distance: 0xa, oneway: true},
-	37:  {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true},
-	38:  {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true},
-	39:  {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true},
-	40:  {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true},
-	41:  {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true},
-	42:  {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true},
-	43:  {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true},
-	44:  {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true},
-	45:  {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true},
-	46:  {want: 0x210, have: 0x139, distance: 0xa, oneway: true},
-	47:  {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true},
-	48:  {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true},
-	49:  {want: 0x24a, have: 0x139, distance: 0xa, oneway: true},
-	50:  {want: 0x251, have: 0x139, distance: 0xa, oneway: true},
-	51:  {want: 0x265, have: 0x139, distance: 0xa, oneway: true},
-	52:  {want: 0x274, have: 0x48a, distance: 0xa, oneway: true},
-	53:  {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true},
-	54:  {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true},
-	55:  {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true},
-	56:  {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true},
-	57:  {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true},
-	58:  {want: 0x2be, have: 0x139, distance: 0xa, oneway: true},
-	59:  {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true},
-	60:  {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true},
-	61:  {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true},
-	62:  {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true},
-	63:  {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true},
-	64:  {want: 0x304, have: 0x139, distance: 0xa, oneway: true},
-	65:  {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true},
-	66:  {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true},
-	67:  {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true},
-	68:  {want: 0x320, have: 0x139, distance: 0xa, oneway: true},
-	69:  {want: 0x331, have: 0x139, distance: 0xa, oneway: true},
-	70:  {want: 0x351, have: 0x139, distance: 0xa, oneway: true},
-	71:  {want: 0x36a, have: 0x347, distance: 0xa, oneway: false},
-	72:  {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true},
-	73:  {want: 0x37a, have: 0x139, distance: 0xa, oneway: true},
-	74:  {want: 0x387, have: 0x139, distance: 0xa, oneway: true},
-	75:  {want: 0x389, have: 0x139, distance: 0xa, oneway: true},
-	76:  {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true},
-	77:  {want: 0x390, have: 0x139, distance: 0xa, oneway: true},
-	78:  {want: 0x395, have: 0x139, distance: 0xa, oneway: true},
-	79:  {want: 0x39d, have: 0x139, distance: 0xa, oneway: true},
-	80:  {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true},
-	81:  {want: 0x3be, have: 0x139, distance: 0xa, oneway: true},
-	82:  {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true},
-	83:  {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true},
-	84:  {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true},
-	85:  {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true},
-	86:  {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true},
-	87:  {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true},
-	88:  {want: 0x40c, have: 0x139, distance: 0xa, oneway: true},
-	89:  {want: 0x423, have: 0x139, distance: 0xa, oneway: true},
-	90:  {want: 0x429, have: 0x139, distance: 0xa, oneway: true},
-	91:  {want: 0x431, have: 0x139, distance: 0xa, oneway: true},
-	92:  {want: 0x43b, have: 0x139, distance: 0xa, oneway: true},
-	93:  {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true},
-	94:  {want: 0x445, have: 0x139, distance: 0xa, oneway: true},
-	95:  {want: 0x450, have: 0x139, distance: 0xa, oneway: true},
-	96:  {want: 0x461, have: 0x139, distance: 0xa, oneway: true},
-	97:  {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true},
-	98:  {want: 0x46f, have: 0x139, distance: 0xa, oneway: true},
-	99:  {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true},
-	100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true},
-	101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true},
-	102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true},
-	103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true},
-	104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true},
-	105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true},
-	106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true},
-	107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true},
-	108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true},
-	109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true},
-	110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
-	111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
-	112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
-} // Size: 702 bytes
-
-// matchScript holds pairs of scriptIDs where readers of one script
-// can typically also read the other. Each is associated with a confidence.
-var matchScript = []scriptIntelligibility{ // 26 elements
-	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5},
-	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5},
-	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa},
-	3:  {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa},
-	4:  {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa},
-	5:  {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa},
-	6:  {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa},
-	7:  {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa},
-	8:  {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa},
-	9:  {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa},
-	10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa},
-	11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa},
-	12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa},
-	13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa},
-	14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa},
-	15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa},
-	16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xcf, haveScript: 0x5a, distance: 0xa},
-	17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xde, haveScript: 0x5a, distance: 0xa},
-	18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe1, haveScript: 0x5a, distance: 0xa},
-	19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa},
-	20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa},
-	21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa},
-	22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa},
-	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa},
-	24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf},
-	25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13},
-} // Size: 232 bytes
-
-var matchRegion = []regionIntelligibility{ // 15 elements
-	0:  {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
-	1:  {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
-	2:  {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
-	3:  {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4},
-	4:  {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4},
-	5:  {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4},
-	6:  {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4},
-	7:  {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4},
-	8:  {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4},
-	9:  {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4},
-	10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5},
-	11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5},
-	12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
-	13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
-	14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5},
-} // Size: 114 bytes
-
-// Total table size 1472 bytes (1KiB); checksum: F86C669
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
deleted file mode 100644
index 42ea792666..0000000000
--- a/vendor/golang.org/x/text/language/tags.go
+++ /dev/null
@@ -1,145 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import "golang.org/x/text/internal/language/compact"
-
-// TODO: Various sets of commonly use tags and regions.
-
-// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
-// It simplifies safe initialization of Tag values.
-func MustParse(s string) Tag {
-	t, err := Parse(s)
-	if err != nil {
-		panic(err)
-	}
-	return t
-}
-
-// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
-// It simplifies safe initialization of Tag values.
-func (c CanonType) MustParse(s string) Tag {
-	t, err := c.Parse(s)
-	if err != nil {
-		panic(err)
-	}
-	return t
-}
-
-// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
-// It simplifies safe initialization of Base values.
-func MustParseBase(s string) Base {
-	b, err := ParseBase(s)
-	if err != nil {
-		panic(err)
-	}
-	return b
-}
-
-// MustParseScript is like ParseScript, but panics if the given script cannot be
-// parsed. It simplifies safe initialization of Script values.
-func MustParseScript(s string) Script {
-	scr, err := ParseScript(s)
-	if err != nil {
-		panic(err)
-	}
-	return scr
-}
-
-// MustParseRegion is like ParseRegion, but panics if the given region cannot be
-// parsed. It simplifies safe initialization of Region values.
-func MustParseRegion(s string) Region {
-	r, err := ParseRegion(s)
-	if err != nil {
-		panic(err)
-	}
-	return r
-}
-
-var (
-	und = Tag{}
-
-	Und Tag = Tag{}
-
-	Afrikaans            Tag = Tag(compact.Afrikaans)
-	Amharic              Tag = Tag(compact.Amharic)
-	Arabic               Tag = Tag(compact.Arabic)
-	ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
-	Azerbaijani          Tag = Tag(compact.Azerbaijani)
-	Bulgarian            Tag = Tag(compact.Bulgarian)
-	Bengali              Tag = Tag(compact.Bengali)
-	Catalan              Tag = Tag(compact.Catalan)
-	Czech                Tag = Tag(compact.Czech)
-	Danish               Tag = Tag(compact.Danish)
-	German               Tag = Tag(compact.German)
-	Greek                Tag = Tag(compact.Greek)
-	English              Tag = Tag(compact.English)
-	AmericanEnglish      Tag = Tag(compact.AmericanEnglish)
-	BritishEnglish       Tag = Tag(compact.BritishEnglish)
-	Spanish              Tag = Tag(compact.Spanish)
-	EuropeanSpanish      Tag = Tag(compact.EuropeanSpanish)
-	LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
-	Estonian             Tag = Tag(compact.Estonian)
-	Persian              Tag = Tag(compact.Persian)
-	Finnish              Tag = Tag(compact.Finnish)
-	Filipino             Tag = Tag(compact.Filipino)
-	French               Tag = Tag(compact.French)
-	CanadianFrench       Tag = Tag(compact.CanadianFrench)
-	Gujarati             Tag = Tag(compact.Gujarati)
-	Hebrew               Tag = Tag(compact.Hebrew)
-	Hindi                Tag = Tag(compact.Hindi)
-	Croatian             Tag = Tag(compact.Croatian)
-	Hungarian            Tag = Tag(compact.Hungarian)
-	Armenian             Tag = Tag(compact.Armenian)
-	Indonesian           Tag = Tag(compact.Indonesian)
-	Icelandic            Tag = Tag(compact.Icelandic)
-	Italian              Tag = Tag(compact.Italian)
-	Japanese             Tag = Tag(compact.Japanese)
-	Georgian             Tag = Tag(compact.Georgian)
-	Kazakh               Tag = Tag(compact.Kazakh)
-	Khmer                Tag = Tag(compact.Khmer)
-	Kannada              Tag = Tag(compact.Kannada)
-	Korean               Tag = Tag(compact.Korean)
-	Kirghiz              Tag = Tag(compact.Kirghiz)
-	Lao                  Tag = Tag(compact.Lao)
-	Lithuanian           Tag = Tag(compact.Lithuanian)
-	Latvian              Tag = Tag(compact.Latvian)
-	Macedonian           Tag = Tag(compact.Macedonian)
-	Malayalam            Tag = Tag(compact.Malayalam)
-	Mongolian            Tag = Tag(compact.Mongolian)
-	Marathi              Tag = Tag(compact.Marathi)
-	Malay                Tag = Tag(compact.Malay)
-	Burmese              Tag = Tag(compact.Burmese)
-	Nepali               Tag = Tag(compact.Nepali)
-	Dutch                Tag = Tag(compact.Dutch)
-	Norwegian            Tag = Tag(compact.Norwegian)
-	Punjabi              Tag = Tag(compact.Punjabi)
-	Polish               Tag = Tag(compact.Polish)
-	Portuguese           Tag = Tag(compact.Portuguese)
-	BrazilianPortuguese  Tag = Tag(compact.BrazilianPortuguese)
-	EuropeanPortuguese   Tag = Tag(compact.EuropeanPortuguese)
-	Romanian             Tag = Tag(compact.Romanian)
-	Russian              Tag = Tag(compact.Russian)
-	Sinhala              Tag = Tag(compact.Sinhala)
-	Slovak               Tag = Tag(compact.Slovak)
-	Slovenian            Tag = Tag(compact.Slovenian)
-	Albanian             Tag = Tag(compact.Albanian)
-	Serbian              Tag = Tag(compact.Serbian)
-	SerbianLatin         Tag = Tag(compact.SerbianLatin)
-	Swedish              Tag = Tag(compact.Swedish)
-	Swahili              Tag = Tag(compact.Swahili)
-	Tamil                Tag = Tag(compact.Tamil)
-	Telugu               Tag = Tag(compact.Telugu)
-	Thai                 Tag = Tag(compact.Thai)
-	Turkish              Tag = Tag(compact.Turkish)
-	Ukrainian            Tag = Tag(compact.Ukrainian)
-	Urdu                 Tag = Tag(compact.Urdu)
-	Uzbek                Tag = Tag(compact.Uzbek)
-	Vietnamese           Tag = Tag(compact.Vietnamese)
-	Chinese              Tag = Tag(compact.Chinese)
-	SimplifiedChinese    Tag = Tag(compact.SimplifiedChinese)
-	TraditionalChinese   Tag = Tag(compact.TraditionalChinese)
-	Zulu                 Tag = Tag(compact.Zulu)
-)
diff --git a/vendor/modules.txt b/vendor/modules.txt
index e99fd2f39b..0b309c8a19 100644
--- a/vendor/modules.txt
+++ b/vendor/modules.txt
@@ -217,9 +217,6 @@ github.com/aws/smithy-go/rand
 github.com/aws/smithy-go/time
 github.com/aws/smithy-go/transport/http
 github.com/aws/smithy-go/transport/http/internal/io
-# github.com/benbjohnson/clock v1.3.0
-## explicit; go 1.15
-github.com/benbjohnson/clock
 # github.com/beorn7/perks v1.0.1
 ## explicit; go 1.11
 github.com/beorn7/perks/quantile
@@ -660,8 +657,8 @@ github.com/pkg/errors
 # github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2
 ## explicit
 github.com/pmezard/go-difflib/difflib
-# github.com/prometheus/alertmanager v0.24.1-0.20220805150254-c732372d7d3b
-## explicit; go 1.17
+# github.com/prometheus/alertmanager v0.24.0 => github.com/prometheus/alertmanager v0.24.0
+## explicit; go 1.16
 github.com/prometheus/alertmanager/api
 github.com/prometheus/alertmanager/api/metrics
 github.com/prometheus/alertmanager/api/v1
@@ -1115,12 +1112,6 @@ golang.org/x/sys/windows
 golang.org/x/sys/windows/registry
 # golang.org/x/text v0.3.7
 ## explicit; go 1.17
-golang.org/x/text/cases
-golang.org/x/text/internal
-golang.org/x/text/internal/language
-golang.org/x/text/internal/language/compact
-golang.org/x/text/internal/tag
-golang.org/x/text/language
 golang.org/x/text/secure/bidirule
 golang.org/x/text/transform
 golang.org/x/text/unicode/bidi
@@ -1358,6 +1349,7 @@ sigs.k8s.io/kustomize/kyaml/yaml/walk
 # sigs.k8s.io/yaml v1.3.0
 ## explicit; go 1.12
 sigs.k8s.io/yaml
+# github.com/prometheus/alertmanager => github.com/prometheus/alertmanager v0.24.0
 # git.apache.org/thrift.git => github.com/apache/thrift v0.0.0-20180902110319-2566ecd5d999
 # github.com/bradfitz/gomemcache => github.com/grafana/gomemcache v0.0.0-20220812141943-44b6cde200bb
 # github.com/prometheus/prometheus => github.com/grafana/mimir-prometheus v0.0.0-20220822125643-4aa6d561a134