ELF(4X"4 (pHt"H"H"444Tt"Tt"Tt"Tt#Tt#Gxh"h#h#Qtd/lib/ld-uClibc.so.0^}'\H)aP?7z3ds2Ml7VYW0L^9!fB|`yMy:gX eiS;r0[41&FUkh$K,,jNIo~p]'bw46\@}tqH(2mr  "@8ED&N$YZ n J*|pC.d>%K:cgSqoR5(OW-us1{!VA=]hv_ lj xw eG+)/E9-/G<?>5TPf38~[ktL<JI;Tm*CQz.#b`xRB =Qi #Z%D"6v+aXF {UunOc_AL$t0<O<#`|HT9`lqx  g } Z h x#,T#8 ( |)S ,T   8Dl#n P(kP \hYt`  5 z   2.z#0Ap  *( 4Mx|)[TU< @!L@X d p|j  T#fD#; y#0$  C 5P s $0=<H8 TL`;lx 5%<#3H! D#0 Vd#gx* &7.   ,#8kDy#0 P\h|! It|) ##8R_ { @ uA  \#Uv#$ (4%@ LXd4#p|@ >- )H  $ 0<[ H%P <p Lt( T `il x 9BYV^̪#q48 0L $#g)m] h ,! _, 8; Ddz#0P$\ihft=r Q&#r# U  (fx  l! ,P#a(4-@~L"  74# XUdp|4{0B Se؇( 5Z 4s o@$0U <`HyT  `#.TH#\#`J lxL8L ^F P (  @ ,b)8oD P\ hty,#G)L y*dx#,y*OFJo  3"p#(4@ #eLX/# It* V$  $b8#0sR  $#0$ <HTw`Yl`xf#L#YW#!p#y*& ) -  M ,84z#0D Pz#0\H  ] hFt B * @ X R \ T0#t*(4#&@%#; L4`w#,XE#d p4 |U#X, y*m0 fX\ w~Ъ#d#$ %$]0<HBT`4 lx ( , #z#0\ ):M*L\ ^+ BP p  _#s,Rhc | 8Y  DP\h%trH#p  M8 6I(4@LXLdp|O 8  yc $ C # m# 0~d|#@<Hlibakuio.soioctlstrerrormalloc__deregister_frame_info_ITM_registerTMCloneTablefread_ITM_deregisterTMCloneTablememsetfclosepthread_mutex_unlock_finifwritepthread_mutex_lock__errno_location_Jv_RegisterClasses__register_frame_infolibakaudiocodec.sostrcpymemmovememcpymemcmpstrlenlibakv_encode.so__assertfgetsatoilibakispsdk.solibakaudiofilter.solibak_mt.sousleep../../..//arch/arm-anyka3918Ev300-linux/lib/libakmedia.solibmpi_adec.sobzerostrncpystrcmpstrchrlibmpi_aed.solibmpi_aenc.solibmpi_md.solibmpi_muxer.sofseekmktimesscanfftelllibmpi_osd.solibmpi_venc.sosem_postpthread_mutex_destroypthread_mutex_trylockpthread_mutex_initlibplat_ai.sostrstrlibplat_ao.solibplat_ats.sorecvpthread_createperrorsocketpthread_detachbindsetsockoptlibplat_common.soconnectsystemsettimeofdayinet_addrgettimeofdaylocaltime_raccesslibplat_ipcsrv.soselectpthread_selflibplat_its.solibplat_thread.sopthread_exitpthread_joinlibplat_venc_cb.solibplat_vi.sostrrchropendirclosedirlibplat_tw.soremovelibplat_vpss.sofopenfscanfprctlpthread_attr_initpthread_attr_setstacksizepthread_attr_destroypthread_cond_broadcastpthread_cond_initpthread_cond_waitstrtok_rvsnprintffcntlshutdownlistenacceptfflushstdoutclock_gettime__ctype_tolowerpowstrtolgetpidgetpagesizerewindsyscallstderrpthread_mutexattr_initpthread_mutexattr_settypepthread_mutexattr_destroysem_initsem_destroysem_waitsem_trywaitpthread_cond_destroypthread_cond_signalpthread_cond_timedwaitfilenoferrorreaddirpthread_attr_setschedparamsem_timedwaitoptargoptindak_aenc_openak_aenc_set_attrak_ao_enable_speakerak_ao_closeak_ai_closeak_ao_send_frameak_ao_notice_frame_endak_ai_get_frameak_aenc_send_frameak_ai_release_frameak_ao_openak_ao_set_dac_volumeak_ao_set_resampleak_ao_clear_frame_bufferak_ai_openak_ai_set_aecak_ai_set_nr_agcak_ai_set_resampleak_ai_set_adc_volumeak_ai_set_sourceak_ai_clear_frame_bufferak_ai_set_frame_intervalak_ai_set_capture_sizeak_venc_closeak_venc_get_yuvak_venc_send_frameak_venc_release_yuvak_vi_get_handleak_vi_get_frameak_vi_release_frameak_vi_get_channel_attrak_venc_openak_vpss_isp_get_ae_attrak_vpss_isp_get_awb_stat_infoak_vi_get_fpsak_mt_set_motion_region_paramsak_mt_set_mrd_filtersak_mt_set_camera_rotation_rangeak_mt_set_camera_init_angleak_mt_set_wait_timeak_vpss_md_get_statak_mt_trackingak_mt_set_fpsak_mt_set_max_invalid_framesak_mt_set_max_decision_framesak_mt_initak_mt_destroyak_osd_set_rectak_osd_set_alphaak_osd_draw_matrixak_vpss_osd_set_paramak_osd_destroyak_osd_set_font_fileak_osd_initak_venc_cancel_streamak_venc_set_iframeak_venc_get_streamak_venc_release_streamak_venc_request_streamak_venc_get_actual_kbpsak_venc_set_kbpsak_vi_change_channel_attrak_vpss_isp_init_sdkak_print_set_levelak_vi_capture_offak_vi_closeak_vi_capture_onak_vi_match_sensorak_vi_openak_vi_get_sensor_resolutionak_vi_set_channel_attrak_vi_set_flip_mirrorsqrtpthread_attr_setschedpolicyak_vpss_effect_setak_vi_set_fpsak_vi_switch_modeak_vpss_isp_get_ae_run_infomemchrpthread_cancelstrtoklibrt.so.0sigemptysetmq_setattrmq_timedreceivemq_closemq_receivemq_getattrmq_sendabortpthread_oncemq_unlinkdlopenpthread_sigmasksigfillsetdlsympthread_barrier_initpthread_barrier_waitmq_timedsendpthread_atforkpthread_attr_setdetachstatelibcrypt.so.0strncmplibdl.so.0dlerrorgetenvlibpthread.so.0pthread_barrier_destroywaitpidpthread_mutex_timedlocksysconfpthread_getspecificpthread_rwlock_rdlockpthread_rwlock_initpthread_condattr_initpthread_key_deletepthread_condattr_setclockpthread_equalpthread_rwlock_destroypthread_rwlock_unlocksem_unlinkfstat64nanosleeppthread_condattr_destroypthread_key_createsem_closepthread_killsetgidpthread_rwlock_wrlocksched_get_priority_maxreallocsched_get_priority_minsetmntentsigactionendmntentsem_openpthread_rwlock_trywrlockpthread_rwlock_tryrdlocksetuidmkdirpthread_attr_getschedparampthread_setspecificlibm.so.0floorlog10strtofraiselibc.so.0putcharin6addr_anyepoll_create1unsetenvwritevscandir64if_indextonamepopenvsprintfdaylightstrndupgeteuidinet_ptonpclosepathconfatol__ctype_bpwrite64fchmodsetprioritygetpriorityutimensatqsortfchownfcntl64getrlimit64readlinkdup2feofstrtolliconv_openrecvfromstrtoulclock_getresrmdirlchownsetgroupsrealpathsigaddsetstrncasecmpfreeaddrinfo__fgetc_unlockedepoll_ctlgmtime_ralarmpipestrnlenrenamestatvfs64atoffdatasyncstrcatreadvvprintfif_nametoindexrebootchdirstdintimezonepread64sendmsg__cmsg_nxthdrgetrusagestrcasecmphtonlsendtoreaddir64epoll_createfdopenexecvlstat64strncat__res_init__uClibc_mainstrdupinet_atonstrtoullsymlinkgetoptlocaltimeiconv_closesrandntohsinet_ntoagetppidgetpwuid_repoll_pwaitgetcwdgethostbynamefutimensfgetcgethostnamegetpeernameumounticonvsrandomstrsepgetifaddrsfsyncfputctimegmgetsockoptfreeifaddrsgetaddrinfosocketpairstrftimesendfile64mkdtempgetmntenthtonsinet_ntopgmtimelseek64fputsexecvpsetsidrecvmsgtzsetvfprintf__fputc_unlockedgetsocknamefopen64ftruncate64__environ_edata__bss_start__bss_start____bss_end____end__SEC_PER_MTtuya_ipc_cloud_storage_order_request_parsesrtp_aes_icm_128srtp_mod_sha1SetMediaSettingcloud_ca_locktuya_ipc_webrtc_session_proctp_chgmbedtls_calloc__event_cblog_serv_handle_err_log_seq_cbStartStreamingmbedtls_eckey_infoAES_encryptcloud_en_lockuni_log_outputlog_serv_handle_netcfg_err_log_seq_cbmbedtls_threading_readdir_mutexSHA_K3mbedtls_ctr_drbg_randommbedtls_sha256_infotuya_ipc_cloud_storage_event_request_parseak_lan_rev_active_tasksrtp_mod_hmaccode_check_statembedtls_sha1_infosrtp_mod_aes_icmmbedtls_cipher_supportedmbedtls_mutex_unlockmbedtls_sha224_infombedtls_x509_crt_profile_suitebbase64chardefault_audio_rtpmapsOpensslAES_CBC128_encryptsrtp_hmacsrtp_mod_crypto_kernelmbedtls_hardclock_pollunw_errno_transFillCloudGwSkillsmbedtls_mutex_initmbedtls_timing_set_delayPacksrtp_mod_authcur_posix_timetuya_ipc_local_ai_data_sync_parseez_headmbedtls_rsa_infouni_usr_log_outputmbedtls_x509_crt_profile_defaultSHA_K0__httpc_gw_common_cbSEC_PER_YRtuya_ipc_3rd_party_streaming_parsembedtls_havege_poll__thread_cloud_storagemod_srtpsrtp_mod_statmbedtls_timing_get_delayRegisterCallBackg_notification_ctlg_ctxsrtp_mod_ciphermbedtls_timing_alarmedsrtp_aes_icm_256mbedtls_freesrtp_null_authSEC_PER_HRupload_mutexAES_decryptmbedtls_md5_infotuya_p2p_misc_release_uv_handletuya_ipc_doorbell_status_parseSHA_K1notify_mutexmbedtls_eckeydh_infombedtls_ecdsa_infoThreadStreamingsrtp_err_handlerSEC_PER_DYbit_stringsrtp_mod_allocsrtp_null_ciphermbedtls_mutex_lockStopStreamingtuya_p2p_hw_aes_decryptmbedtls_mutex_freecrc_tabtuya_p2p_hw_aes_destroy__recv_audio_cbmbedtls_entropy_funcmbedtls_rsa_alt_infotuya_p2p_hw_aes_encrypthttpc_ipc_log_up_locktuya_p2p_rtc_authtuya_p2p_hw_aes_createon_nat_detectedMalloclog_serv_handle_mqtt_reqSHA_K2Freembedtls_cipher_definitions̏##<#h#A#Yܐ####Y##=#D### #<#@#D#H#L#P#T#X# \# `# d# h# l#p#t#x#|#########!#"#$#'#(#)#+#,#-#.ĉ#/ȉ#0̉#1Љ#2ԉ#4؉#6܉#7#9#:#;#<#=#A#B#C#D#E#F #H#I#J#L#M #O$#T(#U,#V0#W4#X8#Y<#Z@#[D#\H#]L#^P#`T#aX#b\#c`#dd#eh#fl#gp#ht#lx#n|#o#p#q#s#t#u#v#w#y#z#|#}#~#####Ċ#Ȋ#̊#Њ#Ԋ#؊#܊############ ##### #$#(#,#0#4#8#<#@#D#H#L#P#T#X#\#`#d#h#l#p#t#x#|##################ċ#ȋ#̋#Ћ#ԋ#؋#܋############ ##### #$#(#,#0#4#8#<#@#D#H#L#P#T# X# \# `# d#h#l#p#t#x#|######### #!#"###$#%#&#(#)#*Č#,Ȍ#0̌#1Ќ#2Ԍ#3،#4܌#5#6#7#8#:#;#<#>#?#B#C#E #F#G#I#J#K #L$#M(#O,#P0#Q4#S8#V<#W@#XD#ZH#\L#]P#^T#_X#`\#a`#cd#dh#el#gp#it#kx#m|#n#o#p#q#r#s#t#u#v#x#y#{#}#~####č#ȍ#̍#Ѝ#ԍ#؍#܍############ ##### #$#(#,#0#4#8#<#@#D#H#L#P#T#X#\#`#d#h#l#p#t#x#|##################Ď#Ȏ#̎#Ў#Ԏ#؎#܎############ ##### #$#(#,#0#4#8#<#@#D#H#L# -L-"Ə+ʌƏ+ʌƏ+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌ|Ə+ʌtƏ+ʌlƏ+ʌdƏ+ʌ\Ə+ʌTƏ+ʌLƏ+ʌDƏ+ʌ<Ə+ʌ4Ə+ʌ,Ə+ʌ$Ə+ʌƏ+ʌƏ+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌ|Ə+ʌtƏ+ʌlƏ+ʌdƏ+ʌ\Ə+ʌTƏ+ʌLƏ+ʌDƏ+ʌ<Ə+ʌ4Ə+ʌ,Ə+ʌ$Ə+ʌƏ+ʌƏ+ʌ Ə+ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌƏ*ʌ|Ə*ʌtƏ*ʌlƏ*ʌdƏ*ʌ\Ə*ʌTƏ*ʌLƏ*ʌDƏ*ʌ<Ə*ʌ4Ə*ʌ,Ə*ʌ$Ə*ʌƏ*ʌƏ*ʌ Ə*ʌƏ*ʌ8@-\@P  0 P bp8 0 0088  --- 0ze@- 00`S0S3/##,,@-`A0S3/##40@- @R0S 00$#P"@-80S 00.,0S 0S 3/@P"(#dt#H-1 1  1  1 1 1  1  1  1 , x1 0 l1  `1< 8 T1 4 H1 < <1 D 01d @ $1 H 1 L 1 P ,0 d!0d `!0 h!0 l!0 t!0 x!0 |!0 !0 \!0 T!x0 X!l0 !`0 !T0 !H0 !<0 !00 !$0 !0 ! 0 !@##- 0K/@#H-M00 00 00  0S60s 6آ0 y00 0Se0+d+0`0SU00O, 0S0,B 0S 0!] 6 00 1 0S 0!] 5 00   0S 0!] x5 00 p 0S 0!] 45 00 0 0S 0!{] 4 00  0S 0!j] 4 00 ܘ 0S 0!Y] h4 00 p˘ 0S 0!H] $4 00 0庘 0S 0!7] 3 00 婘 0S 0!&] 3$ 00 嘘 0S 0!] X3( 00 p凘 0S 0!] 3, 00 0v 0S 0!\ 20 00 e 0S 0!\ 28 00 T 0S 0!\ H24 00 pC 0S 0!\ 2< 00 02 0S 0!\ 1!00 ! 0S 0!\ |1h!00  0S 0!\ 81l!00 p 0S 0!|\ 0p!00 0 0S 0!k\ 0P 00 ݗ 0S ,0@000 =00 0S 兊00 0K(DH@#̇؇4L`tȈ؈$#H-M00  0S 00XX%X50NL50oZ 0ə0 $ 50aZ 0ộ0  40SZ 0᭙0  ؗ40EZ 0៙0  ʗl4 07Z 0ᑙ0 T ἗44$0)Z 0კ0   ᮗ3(0Z 0u0  ᠗3 0 Z 0g0  ᒗ30Y 0Y0  ᄗT30Y 0K0 P v3,0Y 0=0  h200Y 0/0  Z20Y 0!0  Lt280Y 00  ><240Y 00 L 02<0Y 00  "11Y 00  1P0Y 0ۘ0  0  @1h1lY 0Ƙ0 h 1l1^Y 0Ḙ0 4 0p1PY 0᪘0  Ֆ I 0S 00h 0廟x 0S'0  C 0KH0@#4L̇`t؇Ȉ#$؈D(H0H- M $ 0$ X 0 0Y 0!K$X 0!KY 0@P$00CX 0%X 0@P$X 0Y 0gZ00 0 K0Y@H-MP00S @0  00,/(03(0 0K@#HLH-bM00 0 0 0$0 0(0 00 0 0 00 00 00 0,0 l K@0 [/K< z 0S 呕 0S 0!Z0,0 00 C_?K l0K@ }_?KL"00S[?K,",0_?K c 0S\ 0 0SXX( (0S (0!Y0 0 0(0 H( (0S (0!Y00 0(0 x8( (0S (0!Y00 0(0 <(( (0S (0!Y00 0(0 00 l0K        @ 0[/Kl0K000  ‡+ ,0Rx[?K50[/K l0 0 ^$ 婇[?KK蔼#lp|܉H-Mt Kd0 d0x0 00 d0|0 0 0 忤q06 30e30U3 0g3 0Sh30hT30S830S 30S 30S20S20l2020B20S  |20S `20S H20j/ nx K|0K>x |00c0 x 1 x0|t Kd!t0Km!1<0Sw61<0S61<0x1P0p_0S]L140S<1807$140S18071400C0,0X0,0]000Sd000S ]000|00S/oZT00S,voZ000i3(( (05K@###H H-M0  0K0[0PP P0 004< <0 [ 0K tKH0<H-0M0, %0K%0[0 0$0K 0 0 0 0 0 0 0 0,0$ K T $0K04B.<0Ӝ% [,0K 1KH0LPH-0M0, %0K%0[0 0嶜$0K 0 0 0 0 0 0 0 0$0K X ,0$0K04@ @0吜% [$0K KH(0L+PH-M0  0K0[0PP P0r 004< <0k0[  0KH304PH-M 0S 00S xx x0K000 0S %vnY&pnY,0  +i+KHD`@#H-M 00SH0  80  ,00S 00e K@#H-M 00SH0 00 00gK@#H-M 00Sl0  \0  P00S400S00hK@#H-M 0S 0忛00 0 x00S \00S@00S00lKH@#H-M 00SH0  80  ,00;@z00xK@#H-M 00 0SN.0m*00S0  i00S bt0  00S XL0  @00 K4 Q=00j~KH@#LH-M 0S\\ \0/000 0S<0 ,0 KH@#H- M 0S 0 7000 000 0 0 00 00 0 K 0KKK:0d  0 x0$ 0d 0 \0( 00rZ<0$ 40(00 }KHЊԊ@#H-M 00 0S,, ,0幚+ nKH<H-Mx l Kd0 @d0p0 00 d0t0 `0S p Kt0Kr;p t00c0 p 0 p05 t l Kd l0K0 0y`0Sh005\ l Kd< l0K0,4 ,0_l0KmK#HX\H-M 0Stt t0F00S\0 < 300S80 < 53)00'KHh@#H-M 0S 0$0000S0 P x0 00S T0 P L0 D00 00KH@##H-eM 1S#30$0 0(0 0,0 000 00 00 00 00 0 0 040 t K@0 b]/K< \102( (0S(I$ $0S $0!T040 0$0 a?K ]n0K 0!o.K#dH-M 8000,, ,0$00uK#HK܋H-M 00 0S 0 %00S00 00S00 00S 00 00S 00 00 k00w KHiH-M tKH-M 0S 0Ǘ0 p0, h0,0S00 00 0,8 80岗$0,0KH@#H-M 0Sk.0嗗!000x| |0厗00Sh0 0  00S@0 0 p00KH4@#H-M 00 0SDD D0_ 00SP# [K#KH H-M 00 0SDD D0> 00S/# :*#KH H-M 00 0SDD D0 00S#  #KH H-(M $ 00 00 0S!10^$000 0SX`!`10N00 0 0 * 0 $0R$!$1ؖ60["S 0 0\ 00 0" 00 0 0 0   00 0 000 0 000K0[S$0 p 0 00<X X0墖00 0S 00 0KH T d tЊ H-M  0傖KH H- M 0 00 00 000 00 00 0 0 0 0 . 0001 00 00 00S00iS 0 !00R h 0! 003/000  0R 00 0 0R:K@##H-M 00 00 0 0 0 0 !00 0 !0 00R h 0! 003/000  0R 00 0 00R:K#H-M   0 08#88 0坣0KH-M   0 08#8 0劣0KH-M 0 0 0$0 S 5Õ f0$0 $0S0T\0K 0 0 0 0 0 0 0 0 0 00K 0 0 0 0 0 0 0 0 0 0 0 00(0 00,0 00 0 0 00 0!K000 ,0S 00dd[0S G0S 000m 3M 00Nd  00S00 00S l@0K,$ 9L ( (0S 000d  000(00 30SM 0S00  00cS0c}S ژ0 0 0 0!K0KF  00c00 00 0S 0 0 0 0!K00 0K1 0K,0/0A?0c 00@?0c0c0 00R:0S+(0x0 $0|0 i00 }=0 00 00 0/0 0 a 0&K 00S. 00 0Kjb&(0P0 $0T0 0\0 0S000X0 0/0 0 a 0$K 00 \0Kza 00S $0S $ 000 00f0K輌 (DMbl- M 0S004 00K/#H-0M   0 00 0S090  0  0 $ 0 ( 0 , 0 0 0000000 000 00p l000     0[  0S 00K輌H-(M   0 00 0 00` \10 0S 0000 00 00A0  0 00S 0œ0.0000 00 0q00   2&|0ʛ 0S T \0夓0 00^@0 0 0  0K輌ԍ!#H-M 0 0S00  00q 0 0  0 0K#- M  0S00  0K/- M 0S00  0K/- M 0S00  0K/H-M 0S S 0M/,0)N/0#K輌,-00K/#0H- IM0M ? K? @K? PK00.>> K0S񟗯H-l---:x;8...0t684994::- ..>> dx.x>ڒh> @\.\>ђP> <.<>ƒ,> x . >归> mi/=岒= b-=姒= K0 0 0 00 0\-=嘒MD-=咒0= K0$0 $0$0 $00 0m/P=倒5X0S E0S - =r0' - =k< K0(0 0,0 00 00 (0 (00 (00;K 0C0C 0Z;K 0C0C5 , ,0S (0 s/dC 0C p0 K0 0000C H0 @K0 00 0 $ 0 PK0 0 K0 0 K0 7 K ' 0 K 0 ;K 0C0C, 000v>C 0C |0 @K0 0000C T0 PK0 00 0 0 0 K0 0 K0 0 K0 6 K & 0 @K 0 I 0t K X K @ PK ( PK % PK @0  d%5ZL00P P0SE 00 P0 0R 0 0S 0000 0SP$0 K 00v> 00 K    @K PK @K PKP 0P#32 K0T0 T000#3T00X X0S Xh#h32 K0\0 \000l@#03܏\00~` V0S rB0S0`0S `~}|2 K0d0 d000"2序d00\h h0S hBdc1 K0l0 l000`"X2塏l00Cp p0S p)KJ81 K0t0 t000/1刏t00*x x0S x320 @K0|0 |000!1p|00S |00S |00 t1 l10 |0 X0 PK00 @10 0 000(!1K0 K0J@OT#kh|##Ԏ8ThtTď܏(@6LMhOtY[my#ĐH-M00 00  j00 00000 0S0K輌ԐH-M   10S 10S-oon00S 00 S 000!1]00iS 000dl!l1峎P00S(810S S 1 0 00 0 0 00 0  0凎00 S 0 0 00l X00SL 0#40 (00S-K###@#H-M TRK- 0K/#H-M 0Sx/t16X&.0 0 @ 0 ` 0, 0- 0! 0! 0 !0  0 D 0< d 0, 0 - 0Z/ 0 0 !0 $ 0e D!0}-!0 "0 D"0 !0 ( 0h H!0-!0 "0 H"0 !K輌8_H-M0 0@0 0"r0 0D0 0r01 "#%|01  0rX01P "#%@01  0q  0嘍0K#?- M00 0K/H-0 0  x0i  l0t  `0  L0 D P0$ &> p bT(( (0`0#,X=,#-0K/H-M   0 0000  0$0K-0K/H-M400 000 ,00 0K$t4`0KCCD#H-"W0H- #0H-0M0 ,0K( Z:$0 00(0 0,0 ,0K  (00KH-(M  $0 00 0S 0S 00&00 00S000 0 00/0 $ 0 ?  02r 0S 00 ( (0彌00K輌$Б.ܑH-(M  $0 00 0S 0S 0垌0&00 00S000 0 00/0 $ 0 ?   0q 0S 00 ( (0x00K輌>БHH-(M  $0 00 0S 0S 0Y000 00/ 0 $ 0 ?  0q 0S 00 F.$0;00K輌WБ,H-(M  $0 00 0S 0S 0000 00/ 0 $ 0 ?  0tq 0S 00 ( (000K輌nБwPH-d@ &e4 "(  0 E F4G$HH-VMP = 0 00 0S/K jP10pp p0ƋP1SPX X0律00 S?K  0k000 0 SK輌H-M 0St00S h00d00\T X0哋@0 0S$00S0 0K<#XH-M F0KH-nM 00 0 0 0$0 0(0 00 0 0 00 00 00 h K@0 Z/K< >K 0 0 0 0 0 0 0 0 0 0z 0S0 p弁 0S 0!9F01 00 nt0^?K ^?K$0#0S1Z/K#^?K ᒁ 0S 0 0S凁( (0S (0!F0 0 (0!E 0103P#"?0c 83K0 0(0 `( (0S (0!E00 (0!E0Z/""?0c 2K0 0(0 ;( (0S (0!E00 (0!E 0103 ""?0c 2K0 0(0 ( (0S (0!E00 (0!E0Z/!"?0c 01K0 0(0 00 h0K        @8!0eZ/Kh0K000  s0. 1R#:Z?K 0Z/K 0 0 3 01 1 C0"K 0 - 1 C0"K 0Z/ >K  (0, fs0KĒȒԒQx|d4DptH-@M8 00 80ShQQ(RRRXStSSSSST8TDTPT00K( x00 :00 00K  (0 00"2ɉ00K( `00 :00 00K  (0 00T\"T2屉00K H000 0(0 00K 02020"2嘉t00K /000 0(0 00K 01010!1[00K 000 0(0 00K 0L10T10(D!81fA 0g : 0` 3  0Y-  0S'0S - -0S --0S - - DDD0K輌SH^tidtH-M  00 0 0 0SI0K 0K  K0K0D K0K( 0S  0*0 0 0  0  0K00S 10000 0!K 0004< <0Ĉ 00 0 0S0KhlH-8M0 4 00 N0S0}0$0 0(0 0,0 0 0 00 00So 0K 2 K 0K0 K0 K$K( K,0K( 0S /400 $0S&0 0 00 4 00cS$  01000 00  400c 0u0 00 00 0 (0 R$0S" 0 0 $  0100S $  0100$  010 00 0 ,0 R$00$0 0K贏H-M @00 0S0 0 0 0 04 0KH-M 0S00400 0S #"h00 0S a00 0KH-M  0 00 0 0  t0S0N0S m:0S0 00S 00S 00S 0l0 l K0K00S00S00S 0v> 0 00 0 0 0400 0<0S- 0 < 0 080S <<#<3兇9#"0 8 0 0 0 0 0 0 0 0$ 0 0( 0 0, 080S( 0 0S$ 08 0 0 0t|"|2S#' 0S @j.L2F!0 8 00 0 8 080S<t0K 008#87K000r0K0 00q0K0$00p0K0(00o0K0,00n0Kt0K' 0SPd!d1 0L! 0S 8!810?0 8 h0K, h0K ! 0S 0' 0 `0S0  0  0  `0S000 0 \ 0 X P0 0 Q0[S00.C0 0K輌Г-M   0 0S00  0  0  0 0  0  0 < 0K/H-M 00 00SPP!P1v0L{00S (!(1j0@ 0S !1_0500 0 0! 00  0 0J000 00 0R0 000 0Ll l050 000 @ @0(0K輌8P` H-M  0S 4j0Sl㜾K̔H-M   ,00S4)0 0K@#H-M $$ $00~K輌]H-M+ 0S 0ȅ| 0…B 0S 00H\ \0嵅0L L0寅H @0嚆K^@ajlhs4uPd`H-M 0SPP P0卅0 h $00(0 0 H 0K輌H- Z蠕H-(M,0K( 00 0,0 ,0K  (0e 0` 0[\006;S,0K( 0,0 0 0 ,0K  (0G0Ky*H-M   0 0S 0Sd0KH- M    0S hh h00 -T G 0S 00 , ,000K輌dH-Mp[, 0S 00PP P00 D <0хh.(0ۄ0Kb&0PdDH-M  (($$ <#D$#LĔ#'H-M 0S$1 0嬄0  KTD#H-M00 00S 003/0S 0 70S 70 S0S0070S 70S070S00KD#H-M. 0S 00` 0]054 0S 00f 0O0'`C?K᠈ 0S C?K C?K0t C/KC?K0 4 0S 00 t ,0(00KT̘H-M v70 S0 0d70S0 \70S0 T70S0 0KH-M  t00S hX0  \4 0S 00( $0փ00KH#TH-M#4 0S 00  0彃00KT̘H-M 0S  0婃00KT4H-M 0S  0啃00KT@-0K/H-M8M\4 KT4 K 0 0 00 <8z,0|;$u1q4K0 $ C0C$  ?0c0 0K|#gfffH-M BH0S 0 0 0 0KPH-0M0 00 0 0 00S0. 0S0$,0K 00 0 01K,0Kp 0,0K X 10S@@ @0c 0 0K\#PTaH-M00KG0S 00[S 0[S [010>00KH-BM  00 0K 0 0 0A>K0C0C+ 4S0QLL 0S44!41 0CA>K0C0C[ 0S 0 0K E A>K0C0C +0S ~ 4 0K 40S 4 0Kx )0S 4 0KP 0S 4 0KT X$,H-xMp h Kd0 Mp0S+vLvvvv8d0 0 8xVx0 `Xh8LKL0 D0 p0000 00x0KP,x#H#X$T4H-HM0 4 40S0L o 0S 0@(0K!0(0K 0S0. [40  [40  [40  [40  [40  [40 400400400400400 400  0(( (00KHP'PTXH-M  0S0 00KTH-M  0S0F0S 0  0 0 00 0S%130 S 0  00  0 0 U7 0x  00`  0 0H D7 0  0(( (00K蘚PTH-M  0S0 00KTԚ-M 00 0 0 00 0 0 0   0<00S! 0 00 0000400  \0R P0R0>C0C<  ?0c000K/f gfffH-M8 00 0 0 !12Åu00 7 0S!1`C>K0C C>K0C|!0C>K0C  7 A>K0C  +0 A>K0C0 0 0408#8 0 A>K0Cf 0 0 S  0Rڴ00 AKA (" ("( b("(3/l00S `00S L0 ).40~KTnu P|#T#X#,H-M  00S0-0S /0~0  (00S 0tp0 Pd d0~(H00S 80 00K\#TDT#X#P#{XH- M   00 00/0U~ 0S 000   0R 00 | -|0C~0d  60 0 00 0 0 H0 0S 000S 0 0 KMb#H-M <00:=R 0 K#H-M00 HG000 G0S "0'H-M   0KH-M   .0KH-M 0KH-M00K0[#0KH-M 0KH-M   0KH-M   _0KH-M   0KH-M   0KH-M   %0KH-M k0KH-M 0KH-M   0KH-<0H-M 0KH-M 0KH-M J0KH-W0- M 0K/H-TM<0K 0 0 0 0 0 0 0 0 0 0 0H0K 0 0 0|0L0 L $100c0 1yL 000c;S06L 0 0 0S0,L K<0KH K<0K  FH0K 0$@0(0  @0T" X0lys0$ 0Rm0( 0R00K #LdlH-M # 00 c00R 0 00KH-(M 80 00 00 0 00Sx@ t1#y0V0 0K3 0S' 0(0R000 000 080 K 0y 00N 0x00i0 0$0(0R00[0 000 080 LY L0x0 0 0\ 0x0KĞܞH-M 0S(d $0x(00 K H-M  0  0S 004u 00x0x 0x0K4\H-M  0  0S 004 00tx0 0mx0KxH-M  0  \ X0Vx0S 004 40Lx0 0Ex0KH-M  0 v 0S 004 00(x0 0!x0K8dH- M 00 0K 0S"2x0x 0S 00!1w0l0SK0@t@@@0 = 0S 00\l!l1w=<0 O 0S 000!01w,+0 a 0S 00 0w0 y 0S 00 0w 00 00d 0w0S 008p p0w0000K ;A@FhK4H-M  0S 0SBK0S .0S00-00K/#H-My)00 h%0S%0S0S00KH-U%0S 0S %0S00H-B%0S %0S0S00-0K/H-M5  5v.c 5v 0K 0 0 0 0 0 0 000 00 05 0 ?0 00 00 5 0 0K-<0K 0 0 0 0 0 0 00$0 080 4<0 000 ?,0 040 4(0 <0K-X0K 0 0 0 0 0 0 00@0 0T0 4X0 d0L0 d0H0 0P0 3D0 X0K-t0K 0 0 0 0 0 0 00\0 0p0 t3t0 ?h0 0d0 0l0 X3`0 t0Kj-0K 0 0 0 0 0 0 00x0 00 20 00 00 00 2|0 0KC-0K 0 0 0 0 0 0 000 00 L20 00 00 00 020 0K-0K 0 0 0 0 0 0 000 00 10 00 ?0 00 10 0K,0K 0 0 0 0 0 0 000 00 $10 ?0 00 00 10 0K,dH- `H- M 0S񟗟4Ъ Kt20#8000 0KjW K@200 0K`W K20#8000 0KRWt K10#8000 0KCW K10#8000 0K5W Kl100 0K+WM KD10#8000 0KW K100 0KW K00#8000 0KW& K00#8000 0KV Kl000 0KV K@00#8000 0KV0KȥإH-0M( (000q ,2Ms(0S:(00c(0 (0 " %?0c0 ( 10?0c0c! "?0c 0 (0! / b b10?c020a10c0 $0K  L  06(0,! %?0c0 (  10?0c0c  "?0c 0 (0  / b b00?c020a10c0 $0K  p  0$0K  0S $0K0  00r00Kdų  4H- M  0 0 00 00 00 1rb 0S 1r0_0i 0S 000X `1r  000 0 000 ,i 0S 000 1tr0 00r0 0 000 h 0S 000 0Yr0, 00W0 0 000 0S [00 0S)s00KdLdx|-M   00 0 0 00 K0 00sS 0 00pS 0 00gS 0 00tS%00 00:S00 00"S 00 0 00C 0" 00C 0  0 0"  0 0  000 00 0  0R 00 0 K/H-M  j/K0 \00 j?K!J?K.Pj/KJ?KF80S gK訦H- @H-Mh\[ 0SL H0q0 80S  0{q0KdԦH-M   KH-M   (0 0 c0KH-M 0 0 00 0K KuH-rHH-pH-M  '.0.10<, 0S 00S010>  00m>00 00q>0 0%>p -0n0%>0S0 0 00 0  0p0Ky*dK0H- M( , 0! @20  qu  nu 00 0$1 00 0S 0S (1S ,1S 01S00 ^0K V+R +N>K I0 0K ~($` 0S00 :00!1pc0 d0K  001P010R@ O0.K I/K   + $1.K B0K  ,h 0h0S u 0S u0S Wk0 K0do,08H-M 00 0S 00S0&_ 0S f 0S 00d0S00 00 0S kY0 0 0KDPH-0M( 00 0 0 00 00 00 00 i 0S (0h0 P f(0%>h0 0 f zt 0S00 ]00 Z +q  ( i 0S00 Jh 0S00 B h0 f Kt 0S00 /,F(0>0 ,1 7t +80S00 00;0 0 0S 00{/0o7 0S %t0S  t0S t0S   0S X0S X0KXdhltdH- M00 0 0 0 0a0  B/ b b 00 01o 0:=A0S 50S 0?KP?K00C0 *0S0KE.`Td H-M0K 00K蘻H-(M00 K0KY 0 ? 0 0/0n0S 0Rt 0 0K0S0>0 00 00 0K0eKḑ .hYH-M40SpLXdXpXX00 00 00 00 0KH-M   0S 00 0n0/\ 0S 00# 0xn0! 0S 00l) p0jn0{  0S 00 1 (0Wn00KD`xH- M   00 0Sx= t000p x0}k0810P \0uk0812S, <0lk00 0K蔫|ȭ|H-M00K0[0CS 0  0Bkl l0C0C ?]"SM00; ?008 ?006 ?003 ?00 0 0"K20020 0S 00S. 0  0 20 0"KƁ0S ||"|2d0 0 ?s`KT"?0 0 0"K(20 @K 0%0 0p0 10 p0Kx 72 0S!1di0[S0SYp0S p00p!1d00 Lp0 |0 d |0 ` |0 k0[Sj0[S00| 0P |0 L |0 |0 ( 00 | 0|0  |0}- |0},$ |0 |0 ( 0 0  | 0\0 |0 X0S T |0 T0 c|0 p00 000᏿0K(#įв->H-M ,00(00  0K0> K0 >K00 0-=cl0K 㑾ZC0C ?]"SM< K00; ?<K008 ? 0&K0Y0K<00ᄼ<0080 80S ).080!"#080!jKtKtǎKtŎhKxeKt500+;ic80!" KljKlŖcKle# KpKl5+0 0mKheKh" KhjKd80!"ˠK\Ŏ K\K\#kK`eK\50; ?ZlK F80!ȠKTŎjKTŖgKTejKXKT508 ? 0#KK#KQP ,00,0 Pp*p:cl 800S,0S0,0 (l KZC0C ?mK eK " K jK5K00; ?ZKN5 K008 ? 0ZK A 0 0#KKKK$KQP *p$0 2`K00#K H%$002K00 K%$002K00 K0*K5jK5 0 0ˠKŎ K $$002`K00 #ˠKŎ K*K5 0 0kKeKZC0C ?mKdK" KjK3K00; ?K2 K008 ? 0K 0#0 0#KK>KK$KQP"$002`K0#K (0!<00P$0 2K000 " KKdjK#ƠKĎ K4@4$0 2`K000 "àKĎ K K#cKdK4?$0 2K000 0?!$002K00 "f KdKdjK#K*K4T!$002`K00 "jKKdjK#jKK4? $002`K00 0?0 0 0᥻(00(0 $00$0 $ 0K0R:0 0 P000»(1.l0` 0K褥įyZ(#,\ Nij~Գ0H- XMX \ 00 00 00 X0 X00 0"2R`40K T0K 10040 X00{>C0C ?]"SMX00; ? 0"K0!0K|100 h1000 0SL100Y0G4 KT0K  0S003.0 `/\ 㥺\0 00 G0  K 00SG0  K 00S G0  K 00 C\0! 0 000 T0[ 0R(0000 K0į(#H-M   0 @00<004, 00_  00KGįȲH-M   0 ,00(00  0_0KRįȲH-M  ,00?0/0_0KHįȲ-M   0K/H-M  P00?0@/<0k_ 0 0 k0KhįȲH-M ,00?0/0N_0K萶įȲH-M  ,00(00  09_0K贶rįȲ-0K/- M 0K/H-(M8 < 00 40K 㲹40K$ 0S080S #K"jf#z 80 <0S "K"JF#Z <0 0KO- 0#K"ke#{0p#KᢈჇᣘ0`#K"FL@ LL #FH@ L0#K"T T@MT@ #P T0?40?#K#C\@ X \0!CK 5 0@ 00#KKd@ 0`0 d00p` 08@, 0ጳ( (08 0 80 K̶-00S0cK/#- 00S000K/#-00K/#-M   0  0  0  0  K/H-M  00  KH-M  00 K- M  0  0  K/H-M 0 000 0  K - M  0 0R000K/- M  0 0R000K/- M 0 0R000K/H- M 0H00 00 0 0 000 00C0 000 00C 0 0000S 00N^L^ 00 000 00C 0 0 0R0K- M 0S/0L!0S/0P!0K/H- M 0S?0 00 0 0 000 00 000 0 0   00 000 0 0  0R0KH-M  0S?0KH-M  02 ]0KH-M  00 0S? 0 00 000 00 00|0S0 000 00 00  0R0KK-@M@ @0S?(0 0 0 @000 1X(00,0 ,0 0 T 000` `1X 0H000 000C$0 7$0 "MC#]0:#:{>0$0 "ke#{0$0 ᢈჇᣘ0$0 "L LL #H L00S00 0| 0X$0040 400C$0 $00$0 0H0R 0080 80 0 00 (0RK蠷 H-M  /20 00c0 0 ᆰKH- M  H00 00 0 0 00 -00 0S 050 S  0XX0300 0\00 0S 0FX0! 0 G0Kxɱ  0  ;0KH影 0  /0\0K蠷0L\K-M@ D H L0 0 0 , K00 00 00 8 K00 00 00 D0, K80K zD00SZL`@0S @@0S SSD0pD00SCCD0 "#0:#:{>0D0 " T TT #P T0D0 ᢘ\ \\ 壈X \0D0 "d dd #`  0ԆK  0S R33P?  p @0H"0ᳰ D00S0S(LD0 "l lÌl # h l0:#:{>0D0 "ke#{0D0 HGX0 ,0K8K H"僰 s0S$LD0 "Mt@ tt #p t0:#:{>0D0 "ˠ| |@E|@ #x |0 ,0K8K H|![ K0S L ,0K8KHL!N >0S;LD0 "ᄐ Ì # 0:#:{>0D0 "K@ 匀ጀ #ሐ 0D0  @G@ 壈᐀ 0D0 "ᜐ @J@ #ᘀ 0 ,0K8@K@  HP  0H 0 0K`dhp tO- MH L P T0 0(0 4 K00 00 00 @ K00 00 00 L04 K@0K >L00STX H0S HH0S L00\0 L0 "mc#}0:#:{>0`0 L0 " l ll # h l00d0 L0 t tt p t00x0 L0 "  #  0K 0S R(S$SL0 "  # 0L0 "  # 0?pL0 0?`L0 # 0Ƞ,ȠL0 #  00S W@E@L0  00S DNL0L0 2#"d00c0 ?00\001 0`d00xP $p(`,0@48< 1@0PX! 0"( UL00SQTpL0 "MC#]0:#:{>0`L0 "  # 0@L0    0L0 "  # 0L0 "  # 0L0 "#0?L0 0? 40K@PKP`@  PH ˮ( (0P 0 (0 K`d Qht0xH-M  0 00 0 0(0 00 0 0 0`0 0d0 0h0 0l0 0p0 0t0 0x0 0|0 0}0K0~0K0$0 0S 0S0  00/S 00 0 000  (0R: 0S N/3XU0(00C 0S #3HU000 0 0 80K گX0K կ\0K Я ̯00 u00/Sn 00 0 0S0 ắ 0 c0S0 eU 0S 㼭0S0$0 H 㲭0S0$0 >0$0 ; 0S880K ㍯ 00c8 K :8K` Kd0KhK$,000 (00 X0K s 00cX K XKl Kp0KtK|K}K~K \KxK000 000  (0R:x0 0 $0 0 \ [0 [ [0 ~0[DS}0[WS 5 0|0 ?s``0{>C0C ?]"SMd0; ?@Ph08 ?@Pl06 ?@Pp03 ?@Pt0 ? 0 0 0 0K蠷t>̹hpK-MH L P 0 0 , K00 00 00 8 K00 00 00 D K00 00 00 H08 KD0K P0L ΅H00S?PH0@H0 " \ \\ # X \0:#:{>0H0 " d dd # ` d0H0 ᢈჇᣘ0H0 "fj#v 0 0S R11@!  0L!?0 ]H00SYH0 "l ll #h l0:#:{>0H0 " t tt # p t0H0 | || x |0 ,0K  0ᷮPH0 "  # 0:#:{>0H0 "  # 0H0 HGX0 80KDK , K L< 囬 0L 0 0K h8H-M  0 0 00 bX 0S0@  0W/ 0\! 0W/ 0`! 0U/ 0T! 0U/ 0X! 0M?l 0  0  00  0201 0  00\ ჭ0  `020100000 0S 0K`H-0M0 00S0]00M?000\10 00C0 000 00C 0 0000S 00WW 00 00 0 00C 0 0 00W?R00T1$0 $00C0 00(0 (00C0 00|W00 00,0 ,00C0 0 00U?R00 !00M?00M?00aW0KH-M  0S0 0M?ါ0 0!0M?ԭ0K- M 0S00K/H-M8 < 00 00 00 8401S040K40 40K00 <$40K8  0S040K0S 0400 00C0 u00SkC>K0C+84 C>K0C ;fC>K0C0<<"<2>R8401  CKA3/ 0SC>K0C000/1'R08i 70S000S, C>K0Cp 0SC>K0C0lx!x1 R¬'C>K0Cb 0S $8!81Q08: 08 080 00 0 00C0 000 40KR40$0 $00C0 00(0 (00C 0 0000S 00qVoV 00 00,0 ,00C 0 0 40KR0K蠷h ĺH-M 00 01 00HV000 01 00S0S 9VKH-M   冭T00C 00/S K0  ,0 0 t 嶩KdH-M 00 0 0 /K< ! 0SL/H1LQ0K?K " 0S !0>?K00S?K0 00R?K0 00R?K0 ө0S ?K0w0S?K ?K ?K 0S (8 80Q !0K蠷\^ H-BMM( 00 0 0 00 .K< ါ!.K< z(_! 0S!1P0c?K ! 0S e!0V3S ?K >K( ,>K8! 0S/1P0<A>K0C 0Ce! 0SK0C 0C0 D0SA>K0C 0C0_0 S KA>K0C 0C !>K !>Kc 0S (4 40qP!0K蠷s, I-UM MX \ 0$0 0(0 /K< S>K 0C 0C,\5000,0 0L5 0P5 0T5 0 0 000 040 0#KT( (0S+.5*P,0T (0 (00S(s%5P(0 5 0 (0,0T00(000S(U,8%(5O(00 $5 0 X5 \5S>K 0C 0C 0(0(00 S>K 0C 0C0 $4OS>K 0C 0C( (!S>K 0C 0C,aX5 \5S>K 0C 0CH 0ªS>K 0C 0C8 $ $0S0Q?K$l , ,0S$C 0?K,9S>K 0C 0CQ/K/K Q?K0 ?0S Q?K0 60SQ?K0S0 S ?Ka, ,0S ,#,3oO$ 0R?K Q?KK L=K 0C0C-K B B  ᢩR/KQ?K0 㡩LP%T5QK 0R?K0@/t2?OR?Kh 0S0 0 R?K@ 0S 0 0 S4 40S"1OgL5{>C0C ?]"SMP5; ?T58 ? 06 ? 04 40 X5U??K S0 00S8!0N4\5 00 L5{>C0C ?}"smP5; ?T58 ?H1[AS 0)0 00 00  X06X\0 , ,0S0cSK蠷4h@HP  H-NM( , 0! 0 0 00 00K00 00 , 0S,10!1N0w>K<0Sm0[Sj 1S e>K0 0 S*0[0S& S 0S\d!d1XN0O01 0 0   (0  0S R0[00K0 0 0 S/0[0S+ R 0S 0*N0!01 0 0   0  (0  0S R0[00K0 0 0K蠷*4;H-M 00 0 0 v 0S10|/x0M0000 E?K 0S xE?K00006.0M0K蠷ȻH- M   0 00  0S00 0 00  0!1M 0S 00\d!d1MP00S i00C 0 )00S [00C 0 00S M0  x00 0hMO 0S 00X/`0[M00  0(D D0OM 0K蠷nq(8dH-5M@ D H# 00 00 0 0 d40S?KPH#1?K<,t(40S?K 40S?K 30S?K ?K 0S?K0#3L0J?K 0S \30S L300C <3 $1S 30SJ?K0O 3 20SJ?K0D 2 20SJ?K09 2 22 20KJK 0t"2Lp2 l20hNK`婧\2N/K` ?Ko0 0 K/KJ?K0,嚧?K H 2 ` ?K10{>C0C ?]"SM10; ?108 ? 0K @D#1 K 0 Q 0S$P!P1WL810{>C0C ?}"sm00; ?008 ? 0 0 @3U?,Ϧ/KJ?K0d5P00S @000 00 @DH#%$0K@#D##d##D#H#L##H4H-RM  00 0 0 5 50QKAQ>K0Cp 0S00E?KB/~E?K 0Sv00 0 1SE?K00`` `0KE?K0P0S,8 80KSKHhȼK-RM8 K 0$0 0 0 0(0 0,0 8$ $0S0eM?KB/,M?K$M( (0SH$$\1K "MC#]0K 0 0 0<2/K#>K |K/K#>K$?Ks 0S0<F?KB/づF?K 0Sy0*0 0 1S$F?K00E.0JF?K0| u0S F?K0\ l0S 4@ @0J?K8< pK@(S0H-8M0 #K0 0 0 K 0!K00T1$0 $00C0 00(0 (00C0 /#K 0#KQP00q&O K 0 KQP*0 K!K 0!KQP0 !K00 00,0 ,00C0 0 00U?R0 K!0!K!0KK-MP T 0$0 0(0 0 0 #.K< Ԥ?K 0 0 0?K 0 0 0P2M?P20( (0SP2M?L0>KB/㩤>K( 0SF0 0 ,1S@>K/K?K z0s TƢ0.K T ᛢ0S (PN$ $0S0 0 $0 >K0? &$ $0 $ $0 $0H $0H $0H $0L P$oP$P$(ZP 0/K?KT 4P2!"#0:#:{>0P2!"ke#{0P2!HGX0#K/K?K4嗤P2!#KP2M?ᾤ 0K蔸H-M 0S0 0M?Qf0M?ᦤ0KH-M   0 00 0S 0S0 0S 000 0l 0KH-M   0 00 0S 0S0  0KK-@M@ D H 0 0 0$0 0(0 D0S@0L1,0 ,0 0  0 H00n0S 0D0 0000 00 0 00 @0S?RD0S0H0 "T TT #P T0"0 0"H0 "\ \\ #X \00; ?H0 hgx008 ?H0 "FJ#V00 S 0)0 0H H0  H0  H0  H0  D0H00S H0 D0H0ljD0L040 400C$0 $0080 800C(0 WH0$0 QPU$0 D0H00S H0$0 QPH0 $00><$0 D0H00S H0$0 QP*H0 $002#H0$0 QP*H0(0 QPH0 $00 (0$0 (00<0 <00C(0 $0 D0H0R0KK-MM8 < 0$0 0(0 0,0 0 0 B>K 0C0C+㵢>K 0C0C+㮢>K 0C0C+㧢B>K 0C0C+ 8 <,$ $0S 00"2G08< >K 0C0C( ( >K 0C0C (0;cB>K 0C0C$ 0Y, >K 0C0C( ,0 >K 0C0C 2 0 П>K 0C0C0 00S0l.K B BB>K 0C0C Ả$ >K 0C0C0$ z 0 0SS040  ?L4 40SJ << 40 << "D DD #@ D< !0 0"<< "L LL #H L<0; ?<< hgx008 ?<< "FJ#V006 ? 04 8 4 ' 0S4K 0K蠷BDhlxH-MM $ 00 0 0 00 00 A>K0C0C+̡>K0C0C+š>K0C0C+㾡A>K0C0C+ $, 0S0R < >K0C0C8 >K0C0C 0;cA>K0C0C 0Y >K0C0C 0 >K0C0C 0 0 >K0C0C 0S0$<0.K B BA>K0C0CL 0ԡ >K0C0C  0KhlH-MM $ 00 0 0 00 00 A>K0C0C+A>K0C0C+:>K0C0C+3A>K0C0C+ $,# 0S0N < >K0C0C(刡 >K0C0C 0;cA>K0C0C 0yX >K0C0C 0 >K0C0C 0 0 c>K0C0Cl 0S0.K B BA>K0C0CH M >K0C0C   s0KhlK- M( , K, -4 40340 !-0 4 0#K#K} sm, !`p,HGX@P, &*!6006 ? 0"KK. 0  K8#H-M  00 0S 0S0 0M?ᰞ 0M?0KH-M  00 0S 0S0 0M?ᑞk 0M?0KH-M  00 0S 0S0 0M?r 0M?Š0K0H- M  0"K0(0 00 >0 QP20x!00R,0|!00R&:0p0 p K0K᠞0F0C ?]"SM00; ?08 ? 0"K >"KQP 0gl0K ٟ01S 01lK0\1,0 ,00C0 0000 000C0 0000S 00II00 0040 400C0 0 0W?R0 !0W/0\!0W/0`!$4DT0K ㏟00T0 0*0 0$K0A0K0W?T K % ( (0S(0 s$4D#3D00 0  (0 s;#3DT0K W00T0 0 # 0$K000A0K0W?T K ( (0S(0 s 0#03D  #3D(0S(0S 00 "2DT0K 00T0 0*0 0$K000A0K0W?T K ( (0S(0 s$\",2]D H"2WD(0S(0S 00 "2IDT0K 00T0 0*0)0 0$K000A0K0W?T K q ( (0S(0 s,t!t1D d!$1D(0S(0S 00 0Zς@ 0|!&K0&0\180 800C0 00S 0&KQP0 !000<0 <00C0 000 0W?R0 K0蠷!*̽,6?$AI8QSZTcpeH-`MX \ ` 00 0"K0(0 0,0 000 040 X0S0T0K @\0p"?0 0$K0D0 \00T0 \00@0 X0M?nT0KX0 00S X0M?὞@00!1}C0tX0\180 800C0 Z00SO0 50@ 1@P\0` ?0 0 0 0"KKl 000 0 c 00(0 0 (00,0 ( 0R  ,0R(0000,00 01C` 0X0 !X0M?[0000<0 <00C0 000 X0W?RX0M?E0 00C0K?ؾH-M  0S0:0M?ʛ01S0M?0,01 0W?0S  0B0M?00100 0 C0!01 0M?00K蠷H-M  " /K< @<0 0 0 2  ?Kpp 堝 0/K  00cE?K0S2  "0Kh$H-M` d h" /K< 0$0 0(0 0,0 0 0 <(0 \0K\0 \0KX0 h"\0K` $ $0 s \0K~0S X4$0S$0 \000 000C0 `21SE `21 h20ᕝ0S:`210  !#?0 0-#3#B\040 400C0 0080 800C0 00 00S 00FF00 00<0 <00C0 0 \0KR00 "fj#v00,0 \0@0 @00C0 00D0 D00C0 u0 "FJ#V 0,0 ?QP^(0/K n00S `2 ?K (0`2 ?K (0?K$ ?K0,00$00!1A$0S-00S 0S0`h0 0 00S0`$ $0S $00HX!X1A00x00S 00'F%F00 00H0 H00C0 0 \0KR\0K0S 0'\0L0 L00C0 00P0 P00C0 00I00S 00EE00 00T0 T00C0 0 \0KR0K/0TLhH-M  00 10 0 0 P K@0 ớ K@0 ᵛ0K 0 0 0 KP0K P0K@ 㟛0K000!1@0K /㜙0 00c0 0P K 00P0K0 0@0K@ u K0Kt ۛ 0K 0   0 04H H0@P K0K |0K蜿ؿK-Mp <00 0,0 0T2 &>K 0 0 0?K 0 0 0 0#Kp2M?lp2  p2L1@0 @0 0 0H00S 0H0D0 D00C$0 $00H0 H00C(0 p $ , ,0s00%.K p2$ %>K 00;%>K0"2P@%>K6$00?$00S"00%.K ܚp2$ %>K d0$0&.K?K p20%.KK&K 0Z$0 "MC#]0!0 0}"sm$0 "#00; ?$0 Ƞ| |nj| Ƞx |208 ?$0 "Ơ ʌ #Ơ 206 ? 0#Kp2!K  0?p#K6$D,0S (0$0 (00L0 L00C(0 $0 0H0RS,0S 00P0 P0 0 00 p2S?R-p2  p2M?0K蠷  H- M 00 0M?v 00}  0\10 00C0 000 00C 0 00v00S 00%D#D 00 000 00C 0 0 0W?R 0 ! 0M?ᚚ0KH-M !K00 0!KQP*C 0SLL L0D?!K 0 0U?!K!0K蠷LK-GMp t x$ 0 0 0$0 0(0 0,0 000 ;40 p4S t4S x4S0p4M?T0K 㧙t4 "  # 4:#:{>0,0 t4 "  # 4000 t40l0 t4dK00 0 0Y0KF>K 0C@@#( ,0{>C0C ?]"SM00; ? 08 ? 0&K(0F.K B 4(00clKptF>K 0C-0S 0 C70K 0 l0Y0Kp40F.K BX ᫙( ,0{>C0C ?}"sm00; ? 08 ? 0&K(0F.K B 4(00clKp:F>K 0C0S 0 C70K 0 2,0{>C0C ?"00; ? 08 ?*0 0&K(0F.K B 4(00clKpF>K 0C0S 0 C70K 0 00 0 0ST0 0 0$0 70 K 00S 000 x0$0 $00$0 $0 x4 00 0 0Sp4M?J0Kh$H-M  p 㳖0S0P 㪖0S0 0 㡖0S00K@LXH-M   0 00  070KH-M   00 h w0S0 0 J 000 0S 0 ? 0KdH-M  0 00 0 0 0 0 0 0$0 00 00 00 0%K00 @0(0 0 0 N00 S 0 0RB000 0 0R000 0S   00c b00 0S&00S  0 c0KTK  (0t$ $0S00S   0 c\0K  u$ $0S000 0 000  0R:0S00S A, ,0S0,0T0K0S 0 ,0 ,00w0SC00 0000 000C0 0%KQP%K0 00 0040 400C0 000 0R0SN A, ,0S0F,0T0K0S 0 ,0 %K0 ,0000S-0080 800C0 00<0 <00C0 0%KQP 0000S 00YAWA00 00@0 @00C0 0 0R0KH-(M $ ( ,0 $0 00 00 0 0 00 00 00 ' 0S0 0 0S00 S00 0S 0S   00c ( ,000 000 0 0 00 000  0R:  00cKK-@M8 < @ A0K03K0.0K0 0 0$0 0(0 80S"28< 0<0 0C<  00K |00Kៗ( <0 0C<  00K m00Kᐗ$ <00C<  00K ^00Kၗ 0 ?{`0 ?[@@P0 ?H L 80!?0(06 ?$03 ? 0 ? 0K 0 08  r@, ,0S!1; 0480A [ ,08 Ɠl0 ?P T W0 ? X \ EK%K@P@0 ?80X ?0 0 0 08 ,00@m 0K蠷 p/ H-M   00 0S00 0 00C00 0S 0  0  0 0a;0K蠷N H-M  00K0 0 00 0,0 00 00 02K53K00 0 0 0$0 %57;0K| ϕ0K ʕ? 0Slt%t5!;0R? 0S4D%<5;0D 00 0S-ʴ @00c 0 ,00? 0 00S$4:0 ,0K 00 ,0 00  W0  000  ,4R00x 00 0S$4:0l00 0 QP*@0 0 0K| M0K| 㴒,0Sj@ 00cS.0S00(0 (00C0$0 $0S $0000K 0#03:00K@ 00cS@0 00c0C 0 @0 00c0C 0 00K0 00c0 0 ,00? 0 00ST"h2[:0 ,0K ]00 ,0 U00  0  (ܔ0,0 ,0  00K >,00  .0K 5,00  0l0 +,0 0,0 0K 0[ D d1R@00 00 0S(!1:00K 㚔0K 0 QP*,0 0 ,00  .0K ,00  00 ߑ,0 0,0 |>z>0Ka g Ll y     K-MH L P" 0 0 0$0 ?K,G<,0 000 040 0(0 080 :<0 0$KL20SH2 ?Kh嚔 L20S?K@@$叔 L20S0(0 L"00 ?K,  00cHL (L20 ?K0 #3e9?K 0S(0S L20S, ?KL"00(0SL20SL2  D3?KW0 00S0<0=8 80S0i00$0 L20S4$08  <$00c0 0 0 0S#$  00$0 8$L"P2t4 40SHT"T29$ 400c$0 $0S408  $08 ၒrL20Sn0 ? X \ 0 ?[@K0 0 0  10cS0%10/S 10S 0 1[S >K` 0S 1 0 000 101 !0R: 0KH-bM 00 0 0 00 1S"210u0S0_?K,㓋|0Kh ㎋|0Kᵊ 0S 00! 008"8200l0: S10..205 0Sr 00_00!100el0: S`嘉 0S10h/100R- 0 _?K ' 00H0S 00,0S 000S _?Ko 0S /0}00#c 0Sq10h 0l0و 0S 80000 X X0Z000Kp ,<H-M  $ (! 00 00 00 00 0 0 1S!1+00q 0S0jF?K,㺊  0S 10x!100VL0 F?K  00 0 0 0 01$00T0S0 0 000  (1R00B0S 00:0S 0020S 0S F?K 0S @\ \0/0娋 0S嶉0Kp%B H-M  00 ͊ 0S 0000  0/00KVPH-M 0S000KH-M 00 T 0S00  0h/00KjlH-M 00 0 0 0S0N 0S 00 /0E/ 00KH-M  00 0 0 0S 0S08 0S00 00|0S 00t0S 01 0 00S S0  0  0  0 000K- M  00K/ူ%|-000cK/#-00K/#H-M 00 $g3 0S0? 0 00Sa301 0 00S00O300 "0 " l0 `00T P".@ 0 <0Z0 $00Kd{h{4`{\{-M   0S0 (0 0 0K/`{\{H-M 0S00S 000 00S 00|0  2K-M   0S0 0S000 800S 60 00K/d{p{H-M 0S 00S 000KH-M 00 0S0 0 00G00 0KH-M   00 0S0"00 0  0   0 х0<2 0<"000  0R0KH-8M8 0 0 00 00 0 00 0 80<"0101 00 0 40K$ 880 0 80080 80<200 0 08 00 40K$ 040K00030K00020K00010K0 0$0 8 <2000 8 ,20,0 8  20(0 80 40[e80 30[_80 20[Y80 10[S80 0080 ,080 (080 $010[S00 0 000 80 080 0800800(008#82K0 08#81K000 80 2[<80 1[680 0b800]800X000  80<2RU: 0Kmr00\{`{H-M 00 00 0 0;000000,0000  1 1 0 1 10 p10 00T00 00000  100CR: 0 00 0 00S  0@0 00L2S 00S 0 x000000D <00Kftypmp42isomt{l{x{freed{p{mdat|{H-TMH L 00 00 0D0 0@0 0<0 H L?000 0$0 00 0(0 0,0 000 H0<2 0 0S0 0 00 B 0001?H 0040 40000 H0<2R:+40000.0L 080 4000040000 Lt0DΟ 0 400#100S 00 Lt0͟0 H =0S H =0 00 400#100S 000 40000 4000070 K00L\ 0=0 1004  40000 4000070 K00L 0F=40 100  40000 70! K 00S%4000040 H00 4000040000 H0 0 L0˟0 4000040000 70! K 004 4    L K  bLt˟0=0100 4000040 L0˟0 4000040 40000H000 cH00 40000 4000070 K000H0 400007  K  71 K00 400#4 00 000  H0L2R:H0H0pH0,"H00 0Y/9*0D0 0@0 0<0 00 X 0001?H 0040 40000 H0<2R:A40000)0L 080 40000 70! K 0000 00S80 l 80l0 80l 80 h 80l00C8 h 800 400007  K  71 K00 000  H0L2R:00 H0  1$0 $0S0'0L 080 80 800\ 80 80 800 80 80  80  800 80 80 800 80 0S 80,  80 800 80 80,  80 800 80 80  0S 80 80 80 0 80 80 $ 80 80$0 80 80 ( 80 , 80,0 80, 80( 80,0 80( 80 80(0 80 80 0 80 4 8040 804 0S80V 8 80 < 80< H0l0H000 80< 808 80<0 808 804 8080 804 AH 0 00SH $0 00} S80Z D 80W D 804 80D0 804 H 0 00S 80$ @ 804 80@0 804 80$ @ 804 80@0 804 800 8040 800 80 H 80H0 80H H0  1S 00 00 00 80=0 100 00C8=01000R 000 000  H01R: 80L 80H 01 80H 800 80H0 800 0S80 ` 80` 80d01 80` 800 80`0 800 80 ` 80` 80d01 80` 800 80`0 800 80 T 80T0 80T 80l0S 00 00 00 80 0! 0 00C8000R 000 000  80l0R: 80X 80T 0001 80T 800 80T0 800 80 P 80P0 80P 80P H011 80P 800 80P0 800 80 \ 80\0 80\ 80\ 80l01 80\ 800 80\0 800 80 8000 80 80 800 80 80 800 80 000   0RKl{d{h{mFH-M    KH-DMH L 00 00 H0;=0 L0($0 00 H0 00 0S 0H00u 0S 0H00 0S 0H0@HL 0 000m 0S 0H0@HL 0 000W 0S 0H0 L00J 0S 0H00? 0S 0H0 HL000, 0S 0H00 0U 0S 0|H00 0S 0qH00 0S 0fL0SH00 H00 0S 0QH00 0S 0F(1@K0000 H0 30 K00000 0SH0 HL0008 0S 0H0 HL0008 0S 00Ktkhd H-M  0;=0 0!0 0 0 0 0000b0 0 0t00V00j00e0 000X00S00000KedtselstH-(M $ 00 0 0 0;=0 $0"0 00 0 0H0' 0S 0 00< 0S 0 00 0S 0y 0 0L0 0S 0l00 0$  1S 0$  1$  0/|1v&00  l100 0 0 2 0=0 100 00C=01000R 0 0 0 00C=0100000 000 00 0  0$1R: 0 0 0 00C=010000KsttsDH-8M0 4 0 0 00 00 00 00 00 0 0 00;=$0 40p"0$ 0(0 00 $4d0DŸ00^ 0S 0000: 0S 0v000H 0S 0k00 $4h0005 0S 0X(0l0S (0l04  0HH!H1%00000 (0t000 000 /(0 0! 0 00C(000R 00 0000 (000000 0000  (0l0R:0KstscdH-M  0 0 00 0;=0 0"0 00 0Se0 p0|Ÿ00 0S 000< 0S 000 0S 0y0 t000 0S 0f00 0=0 10000#100S 0 00b 0S 0G000  01R:;0 p000D 0S 0)00 0S 000. 0S 00 t0@00 0S 00KstssH-M  0 0 00 0;=0 0!0 00 0 `000 0S 0S00L 0S 0H00 0S 0=00 0S 020 01 0S 0#00 0 0=010000#4 0S 0 000  01R:0KstszH- M $ 00 00 00 0;=0 $0!0 00 0 0\0r 0S 0O 00<N 0S 0D 00\ 0S 09 0 0l0O 0S 0,0 0 00 ! 0  0F=0010006 0S 00 0! 0 00 0 000  0l0R:0KstcoH-M  00 0 0 ?DK .0 {?pK +0 {0;=0 0 @0ϟ00 0S 000T 0S 00 D0ϟ00 0S 000 0S 000 0S 000 0S 00S0 H0@Ο00 0S 000t 0S 00 0 00 0S 0x 00 0 0Sڈ00< 0S 0g001 0S 0\00& 0S 0Q00M 0S 0F00B 0S 0;007 0S 000 000 0S 00 000 0S 0 00 0S 000 0S 000 0S 000 0S 0L;K0#800K5{00 0 0f 0S 00 0 # 0Rʈ0 0C{0K00M 0S 000B 0S 0 00 0 0Sڈ00e 0S 000 Z 0S 00 L0ɟ00y 0S 0r00U 0S 0g00 0S 0\0 )000 0S 0I0 *000 0S 060 +000 0S 0#00 0S 000 0S 0 0 l000 0S 000 (0 0 l000 C 0S 000u 0S 00 000 0S 000 p0  000  0Sl 0 0 00S0 T0$Ɵ00 0S 000m 0SG 0 0 00S0 P0ş00i 0S 0b00`E 0S 0W0 P0 ş00K 0S 0D00' 0S 090 0 00 0S 0+ 00 0 0Sڈ00 0S 000 0S 000  0S 00  000 0S 00 (000 0S 000 0S 000 0S 00 $0008 0S 0  0 0 (0 0 $000 0@@"@2  0 00SK $0 00} S006z 0S 0s00V 0S 0h0 D0K.  003[ 0S 0T0087 0S 0I0 p0K+  0S 0< 0S 03b 0S 0* 0S 0! 0S 0 0S 0stblstsdavc1avcCmp4aulawesds0KH-$M( , 00 00 (0;=0 (0 , 0ȟ00 0S 0&(00 0S 0(0 ,$0`ȟ00 0S 0(00$ 0S 0(00 0S 0(0@(, 0 00:0 0S 0(0@(, 0 00$0 0S 0(0 (,000p 0S 0(0 (,000] 0S 0(00  0S 0(00 0S 0(0 ,(0Ɵ004(00(00*(00%,0S(00(0000 (00 0S 0R000 0 S,0SD50 (0@0 R 0S 085 0 (0@ Iw0  @ 0S 0&(0 ,,0ğ00 0S 0(00h 0S 0,0ST(0 ,00ğ00 0S 0(00 0S 0(00 0S 0(00\ 0S 0(00Q 0S 0(00F 0S 0(00; 0S5 0(0 ,40Ÿ00Z 0S 0(006 0S 0(00D 0S 0(009 0S 0|(0 ,8000& 0S 0i(00 0S 0^(0 ,<0l00 0S 0K(00X 0S 0@(00 0S 05(00 0S 0*(00  0S 0(00 0S 0(00 0S 0 (, 0S 00Kmdiamdhdhdlrvidesoun 0minfvmhdsmhddinfdrefurl H-M 00 00 0;=0 0<2 0 0S0 0 00 90  1S/0 000z 0S 0$00V 0S 0 0S 0_ 0S 0000   0R0KtrakH-tMp 00 00 p0;= 0 0$0 0(0 0,0 000 00 p0<20 0S00 p H50S( p 45 p,500c0R.5p 5 p400c0 =.Kp00 e5.KK#K P0 $400 00 p 0 0 p000R00 000  0Rp 0 00$0 $0(0 p 0 00,0 p 0 0000 0 0l  0 00 0 p0;=p00  0 0Lß00 0 000  0Rp0 00p00rp0 00p00fp00zp0@$0rp0@( 0jp00,ep000`p00[p00$00 p00000 0 S1hK0000 p0 [0 K000000 0S00 p00000 0Sp00 0S 06pi 0S 0.p 00S$p0p 00 0 000  p00R 0p0 pH00 0S 0p00,0Kp{|{@&Pmoovmvhd l{H-M  00#400 0000 0 00 0 00 00#100S 0S000 0 0000 000 0000 00000#100SM 0SJ00u00W0 0000l000-0 00000000 0000(000@ 0 0000p00@ Kmr01mr02H-@M@ D 00 0 0 00 00 00 00 0 0 0(0 0,0 D000$0 D00 D00000 D0040 080 00 00 00 0(0 0,0 0 0 $00S$000S$000S $0000 0 0 $00$0 $00S$000S$000S$000S $0000 0 0 $00$0 $00$0 w00S00 $00 n00S00 $0 0 0 c 00c(0 @4 l0 0(  40 (0@ 0 (0 )rJ00S00 $  0 c 00c,0 @4 0 0,  40 p0@  ,0  r)00S$0S 0S 0S$  0 c 00c,0 @4 0 0,  40 p0@  ,0  q00 C$0RI0 $00c80 @0L"0001?@ 00<0 < 000800$<0$0$00D0 <0 D00< 0000D000< 0000D00S00 <0 0!000< t250  000 <0 0"00@ (20S @<@0 80@00$8 2@04  1S'D0 @400 D0 @400 @4 0 00S D0 @400 D0 @4000 c@400 @04  1@04  @ 0 800@ 0@0L2 @0L"@ x00S @ h0 @`00@ L0<00#100S @ $00@ 0Kd{|{h{H-M  0000 00 0 000 00S000 00C 0 0L"0001? 000 0$0$0$000 0 00 0000000 0000 000 10S =00 a0  1S(0 00 0 00  0 00S 00( C00 0 000 c00 0  10   t0 0 `00L2 0L" <00S  ,0 $00 0Kd{|{h{H- M  0S 0S0q00 0<2R :00 0<2 0!10\00 0 !l1Rd10HX!X10J0L"0P2R :0P20 ! 10: 10S4 00  00S  00 00 0@0S 000  0 00 0 00R 00 d00   0 P P000K]hbgp{d{h{|{wH-M  0S 0S0000S 0000#3w0N0s000 0 1S# 00 0! 00 00R 000 00000 0,i.02A00  00 00SwE00 0 1S 00  00 00 000000 00 0! 0 00 c02R::00@00 0 !000000c0#3200 02S 00 0001 04D D000 0 0KHMbx- M  00K/Oڃ- M 00K/- M 0048#(00008#88#8K/- M 00K/- M 00,0008 0004 0000K/0H- M 0 0P@000 0 0 K0H-M   0  In0KH-M  00 0 0 ( p000C0 00 0 00 0 0 00 0 00 0 0 0 00 0KH-M  00 0 0 00}0 08#000 0 0 #0 00D0 010100  000 0 00.0 010100  000 0 000 010100  000 0 000 010100  000 0 00  010100000 0 00 010100000 0 00 010100000 0 00 010100000  0101000S+0 00 5010100000 0 00 010100000 000 @0 00n0 010100000 0 00Y0 010100000 0 00c 010100000 000 00 0 08# 0R0K-M  00 00 000 0 C0RK/- M  0K/H-M 0 00 S;#0KH-M  00 00 0 0 000 0 00 0 000 0  00 $000 0 0 0 000 0 0 0 000 0 0 0 000 0 0 0 000 0 0 0 000 0 00 0!000 0 0000 0 0000 0 0000 0 0 0 0 000 00 0 0S0 0 0 0{ 000 00 0 0S0 0l 0` 000 0KH-M  00 00 0 0 0*0 0 000 0  00 t000 0 0; 0 000 0 00 0 000 0 0% 0 000 000 0 0 0 000 000 0 00 0"000 0 00 0"000 0 00 0"000 0&00 0 0 0L 000 0 0 0P 000 0KH- M $ 00 000 0 0 0 00 $0 000 0  $00 000 0 0 $0 000 0 0 %0 0 000 0 0 000 0S $0   $ 000 00 0 $00R:0 0L0 $0!000 0 0@0 $0!000 0KH-M  00 00 0 0 00 0 000 0  00 f000 0 0- 0 000 0 0" 0 000 0 0 0 000 0 0 0 000 0 00 0!000 0KH-M  00 00 0 0 00 0 000 0  00 000 000 0 0 0 000 0 00 0 0 000cS0# 0 0KH-M  00 00 0 0 0u0 0 000 0  00 000 0 0g0 0 000 0 0[0 0 000 0 0O0 0 000 0 0C0 0 000 0KH-M  00 00 0 0 00 0 000 0  00 i000 0 00 0 000 0KH-M  00 00 0 0 00 0 000 0  00 7000 0 0 0 000 0 0 000cS0# 0 0KH-M  00 00 0 0 00 0 000 0  00 000 0 0 0 000 0 00 0 00c0 0K0KH-M  00 00 0 N k000 0 0p0 0"$("(  000 000 0 0X0 0"$("(  000 0 0C0 0"$("(  000 0 0M 0""",  000 0 01 0 "!""", # 000 000 0 00 0("$("( ) 000 0  0*0 *0 00 0 00 0J"$("( K 000 0KH-M  00 00 0  j000 0 00 0"$("(  000 000 0 00 0"$("(  000 0 0{0 0"$("(  000 000 0 0 0""",  000 0KH-0M( , 0 40 00 (000 0 0 00 0 0 0$0 00 00 0 0!0 ,0 000 0  ,00 k000 0 02 ,0 000 0 0 B0 0$ 000 0 0$ 000  40R00S 00 0  20 0   $000 000   0R: 0S ,0  , 0 0! 0$  00 0 ,00R* (000CR0KH- M  $0 00 000 0 0 00 0 00 0 000 0  00 000 0 0 0 000 0 0 0 000 0 00S20 0 $0 0 000 0 0 0 $0R 0S 02 0$0$0$00 00 0 00R* 000CR0KH-@M8 < @ D0 00 800$0 0 0 00 00 00 00 0 0 0$ 00 <0 000 0$  <00 _000 0$ 0& <0 000 0 0 M0$ 0( 000 0$ 0, 000 0$ 00 000  D0R'@0S$ 00 00 02@ 0  B  000 000   0R D0R000  (0R:(00 ,0 0 00 0 <00R* 800 0CR D0R'@0S$ 00 00 02@ 0  B  000 000   0R D0R000  D0R0KH-(M $ ( ,0 00 000 0 0 00 00 00 0 0R0 $0 000 0  $00 000 0 0c $0 000 0 0 >0 0U 000  ,0R.(0S+ &02( 0 0#( 0R 02( 0 08#8S00 02( 0  02( 00#4 00 000  ,0R 00 0 $00R*  000CR0KH-8M0 4 8 <0 00 000 0 0 0 0"K00 0!K0 00 40 000 0  400 000 0 0 40 000 0 0 A0 0K000  <0R180S. )028 0 0#( 0R #028 0 08#8S"K!K028 0  028 00#4 0K 0!K000  <0R 00 0 400R* 0000CR0KH- M  $0 00 000 0 0 00 0 0A0 0 000 0  00 000 0 0R 0 000 0 0 0 0D 000 0S $ 0R02C2  000 00 0 00R* 000CR0KH-M  00 000 00 0 0 l 'g0 00 0 000 0 00 0 000 0 00 0 000 0 00 0 000 0 000 000 0C10?0 0??000000 0 0#000 000 000 0200 0000000 0 0!000 0 = 0S(0 0s0 02000000  0200 0 02000 00  0200000 0000 00 0 0010 0R0 0&0 0H 000 0 0 > 0S)0 00 J02000000  0200H0 0 J02000 00 I J0200000 0000 00 0 0H0 0R0KH- M  00 0 0 00 00 0S00 0 000 0 00 0 000 0 0R0000 0S#0 00 0 000 0 00 0 000 0  00c 0`0S<0 0t0 0 000 0 0h0 0 000 000 0 0 0 000 0 0w 0 000 0  00c j0 0S0 0>00 000 0 0 0C1 0 0C3 0 03 0 0KH-M  00 00 0 0 0 0 0 000 0  00 S000 0  000c 0KH-M  000 00S0  0 00 0 0KH-M8 830 0 8300 00 `0 00 0 00 000 0SR 0 0RK00 00 00C0  5R KH0K0 4R KL0K~& 4R0K 4R0K 4R K0K  p4R  d4R0K H4R KA?K $4R  4R0K 3R0Ky 3R KG?K  3R Km?Ka 3R0K] |3R K=K X3R  L3R  @3R  43R0K? 3R K?K 2R0K- 2R  2R0K! 2R K%>K' 2R K?K 0t `2Rp  T2R K?K 0d (2R`  2R K?K 0T 1R K?K 0=H 1RD  1R K3>K 0B8 1R4  1R0  t1R,  h1R(  \1R$  P1R  D1R  81R K*>K 1R K?K 0R K?K 000 0 C0R0Kftypfreemdatmoovmvhdiodstraktkhdtrefedtsmdiamdhdhdlrminfvmhdsmhdhmhdnmhddinfdrefudtanamestblstsdsttscttsstszstz2stscstcoco64stssstshpadbstdpsdtpsbgpsgpdsubsavc1mp4aulawpH-$M0 `    L$ Q^A 1>! 0011M 00(0 ( 00K `00 d0 (000000@0S000 00 000   0RРKp#H- M 00 00 0 K K 0 P02S9 0 000 0$S $S$S $S$S) $S $S |$S t$S h$S \$S T$S L$Sv D$S 8$So 0$S ($S 000 0 000S" 0 000S K 0 P 0 000 002S200  P3R 0 000j 43R 0 000_ 3R0S00 d00 0 00X0S 0 00O0 0 0K 0 KU0_S_00 0 00:0S 0 0010 0 0K 0 K702S200 0 000S 0 000 0 0K 0 K 0 000S 0 000 0 0K 0 K0s3 0 ? K% 0 00 0R 0 000 0R  0 0 00 0R0 K 0 K 000C ?KP0Kskipwideudtauuidjunkprflfreepnotmdatpictftypediw}moovjp2 jpx hdlrmhlrMPEGH-(M( 00 0 0 0K a;0 (0 0 0 00 0S0)( 0S0 00 0 0 00 0S0 0 0KV 0  0KH-M   00 0S0 S90 @ \a 0 00S00K@H-M  0 0 00 XC  0S0   0S? 00 0K@H-M 0S 00S 000S $ 0K-M 00 00 000  03R:K/H-HMH 00 0 0 H 0100 00 00  KD0K`00 /H 0 00S!H 0 0 H0Ϡ000 0 0SH l0 00S000  H03R:H 0000 H $000 K@@@K-MH K 0 0 0/S /S-/S /S/S /S/Sg x/S l/S d/S X/SO L/SD/SY 00C\0 H2 ?K\ Q0 0 \0R?K1 \0 1 >KHZ00C`0 H2 ?K` 80 0 `0R?K1 `01 H2B> 0d0 F?Kd00Ch0 0l0 H23SuH2 ?Kh 0 0 h0R f?K 1 h01 H230C/I>H"0l0 >Kl:H243S~H23 CH010100  H23 CH2300CH010100  H23@Cl00> H 010100 H23@Cl00- H010100 l0L0S+ H23 Cl0L0#H5010100H23 Cl0P0#H010100H23 CH010100  H23 CH010100  00Cp0 H2 ?Kp m0 0 p0R?K(1 p0$1 H230C/N>H"00J/K*00Ct0 0x0 H23SH2 ?Kt D0 0 t0R ?K01 t0,1 H230C/O>0H"0x0 >KxwH243SH23 Cx0 H010100qp00C|0 H23ShH2 ?K| 0 0 |0R Y?K81 |041 H230C/Q>H"0N/KH23 CHd8 0 P8RH23 CHP8 0 H243SCH23 CH010100  H23 CH7 0 7RH23 CH7 0 H243SH23 CH010100  H23 CH47 0 00C0 H23SH2 ?K 0 0 0R ?K@1 0<1 H230C/Z>0H"0-KZ00C0 H23SH2 ?K V0 0 0R ?KH1 0D1 H230C/[>H"00R/K00C0 H23SH2 ?K -0 0 0R ?KP1 0L1 H230C/[>0H"00.Kl00 H23SeH2 V?K 0 0 0R VV?K`1 0\1 H230C/=H"00.KH23@CH20 H=0 H23@CH20l H40 & 0@N00 0A0 0 0X XX 0 0` `` 0011M 000 00 H23S0gH2 0 0 0 0R 0X0h1 0d1 H230C/=0H"00 Z?K~H243SAH23 CH010100  H23 CH010100  H23 C00408#8H5010100H23 C00408#8H0101000РS00C0 00 H23SH2 ?K &0 0 0R x?Kp1 0l1 H230C/s>H"000 >KH243S0H"?H20 00 !Z0H"0H20L 04 ZCBstsdstscco64mr00avc1avcCmp4asmhdmdhdtkhdvmhdmvhdstssftypdrefstcohdlresdselststtsmdatulawstszvidesoun@@ 0@00 0A0 0 0h hh 0 0p pp 0011M 000 00 H23S0pH2 0 0 0 0R 0a0x1 0t1 H230C/q>H"000 ^?K@H243SJH23 C00408#H010100H23 C00<0#H010100H23 C00408#H010100H23 CH010100  0РS 0@00 0A0 0 0x xx 0 0  0011M 000 00 H23S0pH2 0 0 0 0R 0a01 0|1 H230C/q>H"000 =KH243SJH23 C00408#H010100H23 C00<0#H010100H23 C00408#H010100H23 CH010100  0РS 0@00C0 0A0 0 0パᢞႁ0 0q~a0011M 000 H23S0H2 0 a0 0 0R 001 01 H230C/z>H"0b/K0РS00 00C0 0$0 0(0 0,0 H23S0 0SH20 %0 0 0R u01 01 H23 CH0101000SH29=0$0 7(0 H23 CH07 00SH2I;?$0 \7(0 H230C/=0H"00.K$ (0H243S'0,0 ,02$  H23CH010100000000,02$  000,00,0 , (0R~ 00 00C0 000 040 H23S0_ 0SH20 0 0 0R XH23 CH9 00SH29=000 <940 01 01 f/Ki?K0 40700 00C0 080 0<0 H23S0 0SH20 M0 0 0R 01 01 H23 CH<: 00SH29=080 h:<0 H23 CH: 00SH2I;?80 :<0 H230C/i>H"00k/K8 <0H23 CH ; 00SH23 CHD; 0 P;R01H"t;H23 CH; 00SH23 CH; 0 ;R01H";'00 00C0 0@0 0D0 H23S0{ 0SH20 0 0 0R t01 01 H23 CH< 00SH29=0@0 <D0 H23 CH< 00SH2I;?@0 (=D0 H230C/j>H"00m/K@ D0800 00C0 0H0 0L0 H23S0 0SH20 N0 0 0R 01 01 H23 CH8> 00SH29=0H0 d>L0 H23 CH> 00SH2I;?H0 >L0 H230C/j>0H"00o/KH L0b00 00C1 0P0 0T0 H23ST1 0SKH20!0 0 1R <01 11 H23 CH? 00SH29=0P0 ?T0 H23 CH0 00SH2I;?P0 d0T0 H230C/j>0H"00q/KP T0>s 0KЋ-M 00 00 000  H0 0R00 000  0 0RK/@@H-0M( 00 00 0 0 00 00 (000 /#X(00 0$0 (000 0 $0K00 $0Sh4 00000@0S @4 000000@0S 4 000000@0S 3 000000@0S 03S 3R 03?S03 10$ K0#0 03 0#000 00 0 0 0$#SG #S#SQ #S"S& "SC M"S1 "S7 F"SB "S"S "S' 9"S "S "S /( 2*(0 4#&0 0 #03 0#0 0 0 0 0 0 0 0 0 0 0 0 00 0 0 N00 0 0 00 0 ? $K( 0S1 0S 0S  000 0S$ 000C0 (00 ? 000  0R 00!1(000S 03S (004( 0(084S (0<$(084ὴ0( x0(P` `0Z0K#ftypminfmp4amr00avc1mdiastsdtrakstblmdatmoovedts@ @@ -M  00 0S 00  00c0 00  00c0 0K/- M 0} S S  000K/- M 0K/H-M  0 00 00 00 <0K0 40 0 0 0S00K V043S :0S : 9 90 0 0 0 ?400V$ $00 00=$ $ 9R :Y00D 0 0@00;000@0030070[00 01010000 70[#100S 0S00$ 00$ 0008#8=K0008#8" 0 ,L700R*(0 0" 0LK 60 6,0I=80 200LK 60 6<0KL K70[#100S 0K/0 R70[00 01010000 <0#40 @0 0 0 0 ?:<0#4 0R%50dD bU0 0 <0#4 0 70[00 0 70[00 010100 0 00S0S70[#100S 00 000S 0S0  0S0  0 0 0  70[00  010100470[00 Ϡ01010 00 c$4#3 0 4 0 70[#100 0@ 00SG0K QR000 =[ K  GR=[ 00 0K >R000 <[ KD  4R<[ 00 0K +R000 00$ <0#40C$<0$0$0<0 <0#4 =[ <[0 0 00S00$ <0#40C$<0$0$0<0 0K Q000 <0#4 0 h00Sd0-0K70[00 01010000.0K70[00 01010000/0K<0#400 00K00K-0[3 .0[0100 /0[0C100000K/0[3 09950000K0::100K0020000K00K0 K0 Q000 0  0 <0#4 T043S ,00 00 00K@@mr01@@@@'2 MbK-@MH %K0 0 0$0 0(0 H  30 ?ႛH 30 ?{`H 20 ?S@eK ?0 0 0 0#KK= 0080 H0@38 0c<0 H0L.<00@0 H `2 <0R<0S H0@38  0,,",20H 20 0 8H 0 0" 00#100S( $0s 0$0 0(0 H 1" 0 @0RH 1$$0(0 H l1" 0 @0RH D1( (0$0 00 0 H $1 0RH 10 0 H 0" 0 @0R:H 0  00 0 H 0 0R(0s%K h.00H( >" 00EH H00K@@@@ 0@L@@'@P@H-M  00 $ Sz 0 00S00KH-M 0 0 00 $ 0S0  0S00 0KH-M 0S 00S 00`0S 00S 0  0KH-HM8 < @ 00 80Sr 2080800 0^ 000 0S00Ty T2:40K, R80 40K, 00 0S00 1:s4 1R 4 1R 800 80 800, 80 80 <04 <0@ 0 00 <0 $ <0 ( <0 ,0S <0  <0  <0  "<0  <0  ,0S<0  <0 @ ,0S<0  ,0S<0  <0- <0 $ 80<00 <00 S00 0S00< P0f080 00 80 0Kh8K-@MH %K040 H00 ?ႛH00 ?{`H0 0 ?S@eK ?0 0 0 0"KK@ 0000 H0S H00S 10mH004 K OH000@ K O$[1R $[x1R3[ S< 00R <000000 8141D0 0 0@0K QH0 000100@ K N 0S < 00R 00 < 00R08 H0 H0 H0 00 0 0001 40R:<00 0cS00Khl- M 00K/- M 0048#(00008#88#8K/- M 00,0008 0004 0000K/H-M  0@0 00 00 0D0 00 00 0 0 0H0 0$0 0(0 0,0 000 040 080 0<0 L.0K0r/K< P/K< P.?K02 02 02 0Kl P9@ @0SX9 =0f00@ 0t 00H0 H0S@A0U00@ 0c@0T0 @p0P0 T0K0D0 P T=R$0(0 T0S< D00000@0S < D000000@0S < D000000@0S h< D000000@0S P0,S 0,S (,S $0(0 T0,0 H T$00R:00 H T$00R:0 0 H T$00R:00 @000 000i x;00S00S00, /K@ [080 <0/K008 0101 K00 <00<0 <0/K008 0101 K00  <00<0 <0/K008 0101 K00  <00<0 <0/K008 0101 K00  <00<0 <0/K08 0101 K00<00<0 <0/K08 0101 K00<00<0 <0/K0v8 0101 K00<00<0 <0/K0c8 0101 K00<00<0 8 0101 K0008 0101 K0008 0101 K0 000~ 88 0101 K000SD<0/K08 0101 K00<00<0 <0/K0 8 0101 K00<00<0 <00<0 8 0101 K008 0101 K0000t 6_e<0/K008 0101 K00<00<0 <0/K008 0101 K00<00<0 <0/K08 0101 K00<00<0 <00<0 8 0101 K0008 0101 K0008 0101 K0 000 D580080 8 00RyT $00$0 $0 ?@I@0S 00 0000L 40S 0SL0r/K Nr?KL0r/K@0KL 0KL$Lr?K 0S 400@ 0 0 h 300  0 0  3?K@( e00  (0R 00 X3w0 ?K( @0S 0000 3cl 2]0 0<"0"P"(  3040 4 0101 K000 400 4 0101 K000 400 4 0101 K000 4 00 4 0101 K00 400 4 0101 K00 400 4 0101 K00 400 4 0101 K000SS4 0101 K00 400 4 0101 K00 400 fx#moovmr00 HX(<4d{h{mdatTmr014(4Mbl{*/|{3p{9,LJ`4 0101 K000 4 00 4 0101 K000 4(00 4 0101 K00 4$00 40040 4 00R, (1 @1 1 10(0 ?፼0 ,0ᗿ00y(00 0@zH00(00,00 <2 (00$0 040 00 j@勾0T0 @u0P0 P 2R P00H 200 \T $0 H0R T0$  0H00 200 H4 0001? 00L0 @W L0 L0@@P00L0@@J004 0001004 000100 000 3! K 00Q*4 000100 0004 000100 84 K0 4 0001004 000100 000 4! K 00Q4 000100 0004 000100 ,5 K0 4 000100 000 ! 04 000100 0#100S^ @嬽@嘽4 000100 000@@v0 l00 4 000100 000@@^0 00 4 000100 000 (0 00@@ 㻼4 000100 000 p0 0@@ 㦼$0 ?@"080 ?K0C@ 㖼0 ?K0C ~80080 8 T0R:T $00$0 40040 $0 ?@$ H0R4 8R2 080 ?8 88! K 0 8P8 K00 c800 8 0 008  0|(8c2 8000R *8 0 0 2 80080 8 00R2 <9##2 $ T90c P90 x90 0ᐺ0 90ᘽ40S 000400$00)94 0L"0L2$  0 * : 0$0 ?d 8:00,H*H: P: 0S 00p*:'O/:@~r?K-0&0S 0S 0S 2 00 +;2 00 0S Z@0S @2 0KH-M 00  C=0S0$ C=00 x0 C=0 0SL0 H0 C=0! C=0KdH-M WKH-4M8 ,14K $0 iG$00  00JI00 '0 K 0 80 80@{I00 '0 K 00080@lI00 '0 K 00080@]I00 '0 K 000KH-M  00 \ 0S0 0  0  0< X 0,00KH-M 0S  C=0S < C=K- M  0S00 X 0K/- M  0 \ 0K/- M  0S0 L00S 0 B- 0 00K/|-M  0S0 X00S 0 @ 0@00 00K/-M  0S0 X00S 0 @ 0@00 00K/H-M  C=0S  C=010KK-M  40K H00S' "K0( 12d0c0"0K0!0K0,0$0K0-0#0K0040 0 40K 0媤0 40K(F0 "  # 0:#:{>0 "  # 0 ᢈჇᣘ0 0K @ 0H0` "fj#v0 "CM#S0?@0?0,0( 0K@   0H0KQ,H-(M( 00 $0K QH(00S% ( C=0᧿ (0!!K00 (0( d02d0c00K00K(0,00K(0-00K(00$0 (0 $0KçKQK-3M  $ 0(0 0"K 3S0$30S$#0@0 #C=0S  3(0S$3@0S0 #70S $30S$3 #700cS #x7 $30 0`E/\7E$30S$3 #07 #C=0S #C=0$ 0s #C=0R g #C=0ľ C-00 3(0 3( #60S #C=0S0 #C=0Sg$3 080 園0S0c,0 墒0 80K/K:F240 3 S3F0C ?"30; ? 38 ? 0"K3F0C ?}"sm30; ? 38 ?)0 0"K 30"Kb40 ?( ,# 00 ?K0C P4S ;K +K,,0 ?C8C PC 0C0 <00C 0 @0$0 D0(0 0,0 000 00K\D0KH-M 00 4g 0S000B  00 000S\00KH-M 00 0S000 :000 0S000S 00000D10KH-M  00 0S 0S000KC000  00E0S 00W 0X0KT- M  0S 0S 0! 000K/H-M 00 0 0 0S0 0S0{00S02* 00S0!  0 H0 B0 p 00 0h 00 0 00S0L0 0 00S0 p  0(00  ] 0 0卣 0 0! 00 0 0#5  0 0  0 00S00_]00P0A0K|? @- M  0S00 H 0K/H-M 0S0&00+000P0B!0KH-(M $ 00 0S0r$002 S $000 1X0d 0P00B 000 $000R* 0P0|D0O0K C$000 $000K$000K$000K$000K$00 0 $000 $0 00 0 0K 5 0S 0000 0 0$00 $00   $00R $00000( ,0 0P0+D0KH-M   00 0S00S0S0  0! 00Z 0KH-M  00 0 0 0S 0S 00S0$t 0S000  0! 00S  0! 0  0000 0S0KH-M   0S0 0S 0S0 0! 00S  0! 0000KH-M  0S0" 0S 0S0 0! 00S  0! 00 0! 0 0KH-M 0 0 00 00 K00 00 00S 00S0 p 0p0S 0l0S 0"KQP00 0l0S0"KQP00 0l0S 00 0(KP$0QP0pp0`0l0 00H"K T0p` BKA"#3"K(0S* e0 l T\#\35W00S $4#43 K0 00S #3 <0 0S  0S0 l 4*|"200 0 0K * 0S 0S0S 02 S00 000  0c/2[n000 00R*c0p0S 0l0S000PSڐ0 00BK0l0SH 0p0SD 0 0K 00 0 p0KD A0p0 00@0 }0[l0K0[k0K0[j0K~0[i0K|0`0 t0h0 x0d0 0L p0Kz 0S>00S0 >00S0 0K/ua nqvH-0M0 00 00L0S !10c00 000 00L 00L0SX`!`10N00H0S 00L 00H000L0<00$00 0000 00 00 ? 0 00L 0K0040,0 00(0(0 00,0$0 0000 0 ?0 00L ,0K00D0,0 0080(0 00<0$0 00@0 0 ?0 00L ,0K( (0f0K\xH-M 0L0SPP P0N0 0L0O0 L /0@0K- M 0S000S 0(0K/- M 0S000S 0(0K/H-M 0S000S0p0S 0 0/ ? 0(0K- M 0S00 p 0K/- M 0S00 p 0K/- M  0S00  0K/- M 0S00 0K/- M  0S00  0S 0( 0S 0(0K/- M 0S000K/H-M  0S0 0K @00 0 0 0K0KH-M  0S0 0K ?00 0 0 0K0KH- M  0S00K ? 0S00  0S00 00 0 0K0KH-M  0S0 0S 0S0  0! 00w0KH-HMH L H0S00K ?00 L0 0 >0@0 @ K<0K!>0KH[0KH-M  0S0 0K f?00 0 0 0K@0KH-M  0S0 0K K?00 0 0 0K%0KH-M   0S0 0S 0S0  0! 000KH-M  0S0 0S 0S0  0! 000KH-M   00 0 0 000CSj,d00 0   0SYV00 0   0SK H00 0   0S=:00 0   0S/',00 0   0S!*00 0   0SM00 0   0S>KH-8M8 < H1 0 00 00 00 80S0CqK800 00K ! 0S00K8 ]00 8 0! 00S8 0! 00|000 0SCK"K K!KP<0 ?QP* 0;0S 0K蠆H-M  00 `! 0S00  0  0 L 0 P  0%0KH-M 0S00$0S 0$00 $ 0(0S 0(00 ( 0K- M  0S00  0K/-M !K0S0!K!0  0K/H-M 0S0.0$0S c 00$0x0 $ 0(0S li l00(00 ( 0 01S (o ,00 0 !0K4D`-M  0000 0 00R0 00R0000 <0?0cd0cQ 00K/Q-M  0000 0H0 0H  00@0K/K-JMX \ `$ d4 0 0 X4S0X40S X$00X4$0S X4$X4! 0S  >mX4$0X$0$0X4(0S/ X4 0|1S X4(0#X$0(0> 0 X4(X4! 0S @ D>DX4(0 X$0(0 >RX$0P0X$0P0X4$0SLX4(0SHC>K 0C <=K 0C0C K 0C0C+K 0C0C0 t <X4P0SoA>K 0C0C X4$ X4$0S 0<0X4$<K KP0 < X4$;K #kp0 ; X4$;K #l h$ l4("(; X4$ ;X4$ ;X4$ x;004 \;X4$0 0S 00 $;rX4$0X4 $ 0X4$X4! 0Sk0X4P0SeP4St :Q0A>K 0C0C X4( X4(0S( \:>0X4( P40X4(:K ᣋ000X4(9K # t p$ t400X4(9K #| x$ |48#8 0X4(0X4(0 X4(0 0 0@ h9X4(X4! 0S <909=K 0C0CX0SX4 L =K 0C0CX1X4P0SX4$0S X4$0\`$d4 0Su\4 0X4%P|(0QP)\4 0X4%PL(0QPX4\4 0 0 .8\4 0X4% P0 '7: 0 \4 X4$ 70S X4$ t70 \4 X4$ L70S \4 0.\4 \40S X4$0T#\4$ X4$0P#\4 X4$ 6 \4 X4$ 6 \4 X4$ 6 \4 ?>X4P0S:X4(0S6 X4(0\`$2 0S,\4 X4(00S  X4(0 0 \4 X4(00S \4 0.\4 X4$ 5 \4 X4$ 5 \4 X4$ 5 \4 :R :RB\%5 X4P0SX4$0wX4 $ X4(0X4 ( -T5X4 =K 0C0C X4P X4P0SQ/5:#A>K 0C0C+s:t$4X4 -K B BAK LL;0 0YX4P A>K 0C0C0  x$4X4P0SoA>K 0C0C X4$ X4$0SU/30X4$3K  $ 4 3 X4$3K #  $ 4 d3 X4$L3K # $ 4("(03 X4$ 3X4$ 3X4$ 300,#2c$300W/3[X4$0 0Sr 00`.2LX4$0X4 $ 0X4P0S^A>K 0C0C X4( X4(0SZ/1.0rX4(1K  $ 400X4(1K #  $ 400X4(1K # $ 48#8 0X4(0X4(0 X4(0 0 0!01p100.\1P4SH!00*X4(0P$ =K 0C0CX0SX4 L =K 0C0CX 0SX4L0S \40S\40SX4 L 0K@@@4dQQ54DJ\N[#tosH-(M  $0 00 0 0 00 00 00S0'<7  9 9  0R0000d\ `0g 7D0 0$0  0N6 70K]#H- M   0 00 0 0 0S 0S 0S 0S10 0 070 S 00v 0&00 0 00S0 0 00 0 0 |0 0 00cd `0R000 000 8000 0 0K## @H-(M  $0 00 0 0 0S $0S 0S 0S0SH20 <2 420 (2 00S+20 2 20S0 1 I10 0 0 1 0 00cKS<000 00 1t10 h1 0Tp10 d1 `10S0 H1 <10 0 0 (1 0 00cKS000 00 0t00 0 0(?7 00S  000cS|00 0 x00 0 T0 X0  T0 H00S 40 0K### #l#$## ##H-M   g6K-400S(00S 00K/##H-M   |00Sp00S 00} 0N00 0N0x0+0x ,6K##H-M   6K(H-M   6K\H-M( , 0! 10 00 00 00 0 0 0 0 00 l}5 0S0P>,1S >K5 0 01R *0,! >K 70 00 >K J50S0 0 0 0 >K =50S0 0 000 >K /50S0 0 00 >K 60S6(1S (1  0KH- M  G D 0S 0S 0F~5, 0 000 0S0S0SQ5K H-M   7 0S000  0S 00 00(,5(5KHdH-M   M 0S% 0S  0S 54KH-M   0 0 0KV 0S44K@H-M   0 0 0K; 0S44K@H-(M  00 0K  0SA 0S g0 z0S\0 o T0 g00 0S 0S 44 40l {4` w4 A8m4KhltxH- M $ c50600 00 0 0 00 00 2 0S 0[|1 4 d10SM 0S   0R41 B  0 c$0R  ! 123000  0S000 0S /026 0S000  0S H/P020 0 50K##R(Pd-00K/#H-(M   00 0SH0 000000)0 0K#\ H-M   00 0K| 0S  0a3 0S000 0 0} 0S 0< <0J(3$~3KxH-M    i3K H- M   00 L2H1 @} 82000 02S!1 00S00S 0  02#00/0R 0S  01xH2p00Pp p005`3 5L 3K## PlH-Mx | p0K` N4p0Kz 0S xx!x1xp2U0p K p K  p K0  0,8!81 0S!1x28p0K 0u0  p0K@0l0    0S /.0gx2 x2x|2.20xh 2x\ 2U K(@lH-M$1069S1 1066S, 006:S' 006;S" 006<S 006S 0062S 0063S 006S p006S \006S_?0@@ @0_?001. 00Ky* <T-M   0" 0K. 2062S p2063S \206S H206S 4206S 206S 0 " 0" 001  I9>= 0o1069S 1066S 106:S 106S 0! 0}/ 001  =9 = 0J4106;S 106<S 106S 0. 0/ 001  =9 = 0*006=S 006S 0. 0}/ 001  =9 = 0 0H 0/ 001  =9 = 0K/y*H- M00 00 l  0S 00HH*H:D U308:062S $:063S :06S 906S 906S00 0K0K 0K 0K0 00 00l/x90/0K0 00 00(<)<900 00 $9 0 0K0 00 00(801 >0/0Kζ0 00 00x(8o00 0K̶0 00 000\(\801 >0/0Kᦶ0 00 00 (7G0/000 0Kᡶ0 00 00'7m01 >0k/0K{0 00 00,l'@7W00 0K0K 0K e0Kq0 00 00'6=0@/0KP0 00 009.6,0/000 0/000 0KG0 00 00/`60/0K&0 00 00/5k00 0K0K 0K 0K0 00 00l%x50.0K0 00 00(x%<50K0 00 00@% 50.0Kڵ0 00 00/44069S 4066S 406:S 0/00<0C0 0/00z:C>C0 M4406=S 406S 00 0/00z:C>C0 9306;S30< 10S A?0 0/00z:C>C0 !306<Sp30<10S 00 0/00z:C>C0 0/000 0/000 0Kp0 00 00 #3<0?.0KO0 00 00|"2+00 00 h2062S T2063S @206=S ,206St2 0 l2 0 0K20 00 008"201 >0-0K 0 00 00p!100 0K 0 00 00(!T101 >0-0K0 00 00L!00/000 0Kߴ0 00 00| 001 >0-0KṴ0 00 00$ 80 00KlG#y*]<fkrw~4D H- M   00 ,0S 0K )x0s 0S `` `0MH0P. 01(4 40?,w.K# Pp0H- M  / 00 8?K A 0 (-00 >K 0C,/` TT(T8P ->K 0C0  0S(86. 00C.7$ $0S'7!.00  020b2 K000 020b2 K000 d020b2 K000@ <020b2 K000 020b2 K000 V020b2 K000 ==K 0C@  0/( (0S D&6$@-K A 020b20p0(8 ==K 0Cg0( z  020b2 K000ߍ 090( d 020b2 K000ɍ 0#0(t Na0S, X020b2 K000 ,020b2 K00 020b2 K00 0R  020b2 K00   020b2 K000d 剌0,0  `020b2 K00 8020b2 K0000C,    0#3,[ 00(  020b2 K000E 00(x  l020b2 K000/ 00((  020b2 K000S 020b2 K000?-K B202~0(  020b2 K000 0P0(P {K A 020b2000W0( j 020b2 K000ό 0)0( T 020b2 K000Ṍ 00(l >$(000   0RD$ 0S F.1$rR,N,K,+0 D, @, $Y K0(, L4p`abcde>hpQ$x,4<HTdl|H-(M  70 0] 0S 0+10K 0S 00 0.+00h| |0t+l+0` +0 /-@+5K|4L H-0M(0K -0(0 0$0 0 0 ?0 10 00 0 0 (0KD 0 0S00 0RKH-8M0 4 0(0 00$0 0 0 ?0 00 400 0 0 (0KH 0 0S00 0'0KH-0M(0K ,0(0 0$0 0 0 ?0 00 00 0 0 (0KD 0 0S00 0KH-NM00K0@0 00 00 00 =K0C0C+z,n , 0s#30#303Kx)03K*080 <0K0 T, @0K  K+0 0 <0K 0 G)$ $0s ,@#@3+43 0#3 3 m=K0C0C+",0K(0 00 (0 000 0S02 K   " 1K00 0H0 0D0 0 0KHK 0*$ $0S #)00,00!1E^$0S!1<Q0"0!K 0 00R30SC 04 M>K0C0C =K0C0C M.K B B +0, 004!410S (00,00!100 00 S=K0C0C, ,00\ 0h00SX4 0D0 *`0K0Phm# $&)17,H- M   00 0 0 00S 0) 0K 0* 0S 00Td d0\) 0L L0 0H,8)K#E@P$1LQH-M   00 $$ $0h)K#[ ,H-XMH L P T0 0 0 00 P0S"2J 20s7 S+ 1 @0K *@0K *100 1 @0K (0sx!1#t1 @0K| (0s<`!`1000 L!L1 10s> 0K*02KP*00 T08#8'01K0 0H0 K*0( 0S0:0 L 00c SX00H  L00c K 0( KlX#CzdB|}H-M   0 400S $00 I0K#x#X#H-M   0 400S $00 00K#|#X#H-H00S 800 ,0 $  0(#:h:H-4M( , 0 00 00 00 00 020S -2W((~,0dS y00 0 02 0S 0" 02 0!1:(r(a 0S 00S 000Ph!h1#d )0@00'08 '( 0S 0 0S 000 00 0  0S 0 0S 000l 00 0 <(((0x0+(0x 0 P00 K#(DdhX#xx#|#H-M   0 'K#H-XMP 00 H0K@ ?)H0K@  0S 0000 00H0K0hp p0H0K P0 P00S,00$4 40v00K0 HH-,M $ ( 00 0K 0S q00 0S10xb.t1LW0d2@X 0D K0᾽ 0S!120ᇷ:& 0S%00)0 0c.00n&0 0%00 '0\ @&0T $@ @0 8/'Kd?)=H-$M $ ( 00 0K, 0S 00 0SB0@0 0B 0S0*t& 0S0}&0 0%00 6'00S44 40 (&K ?kH-M 00 0K 0S 00 0SB0U@  0?0 j0ݼ 0S0᫶&& 0S0ᠶM&0 01%00 0S<< <03&0ᆶ3KH-0M( , 00 0 0 00 00 00 $ 0S 0(4  0S 00$4p2(l4 0& L40S(0S  (0R4  0 c,0R#3$00 000 00 0$0 3 0 30 3062S 3063S ?0 3 0 01 =9 = 0 <d3069S P3066S <306:S 030 > 0 01 =9 = 0 !206;S 206<S 206S ?0 ? 0 01 =9 = 0  01 =9 = 0 $0Kᗫ0 00 00(L"L2c 0f$$0Kv0 00 00"2R$0Kw0 00 00!1C 0F$$0KV0 00 00do.120$0 0 0 10 01 >0 0 $0KJ0 00 004!41 0$$0K)0 00 00 0$0K*0 00 00t 0 0#$0K 0 00 000 \0'0K$##8xy*Tdt -00K/#H-(M   00 0S0 0(@#0S"& 0K     )l0 0S f#00('0088 800 0C'0K##\DH-z{0SG{H-M   0S XTV-.K/$$$KH-M  0SW $00 $00 00 0 0 00 D0 00=S 0  0% 0  03 0  0D %0 00+S 0  0% 0  02 0  0B 0  0  000  0RKH-~M M  00  0S 00 0T0 00 0 0 0X0 <0K f%D0K a%=K 0C 0C Z%=K 0C 0C S%=K 0C 0C L%=K 0C 0C@ E%P0K @%=K 0C 0C@ 9%D0K, 㣯D0[ C0[B[@A[@[?[<K@ %=K 0C 0C-%=K 0C 0CK$ $0S &6n#=K 0C 0CJ>9#=K 0C 0C-K B BJ. a"=K 0C 0CE>'# PK=K 0C 0CE>R"=K 0C 0C=0#-K B B=K 0C 0C=0 >"T0K$ <0K#0 6=K 0C 0C0h ,P0K0L $$0S7SiT0$ 0S 0 0S00 00 0 T0 0S 0 0S00\ 00H 0$ T0] 0S 0 0S009 00 V0 M7SJT0|6 0S 0 0S00 0l0( /c0 &7SW0 O0 zG0 r 7S;0d f 嬲'"0  0("(2I=K 0C 0C"@"=K 0C 0C-K B B X K   0X-K B B=K 0C 0C -K B B=K 0C 0C=K 0C 0C!0 =K 0C 0C0 D!D1& 0 (  =K 0C 0C0   凸 L00 00S """!0 " "t "K@l (H-M   E0S 00 0 0K#H-M   10S$ 0S  -.0S  P0K/0KH-M   00 0 0 x 0S* 0ԁ 0.0 Yͷ 0S h~!`{! !0L t!@ p! :剱 h!KHPH-M   00 0 0   0d0c 00ݧl00 c`0 0S L00# 0S 塰4 100$ KD#$0K0.080 /K$0K ! 0S(2";Hl l0!4dY  P P04HO K08|#HY4DH-MM +K B; !;K0CT) L& ;K0C00  ;K0C  KxH- M  00 0 0 00 0 0 0 000 t o0S( L d0S(  0KH-M  .0Sdd"d200 00 00 00 0 0 42K t0 40K !0S 3"0x0+0x 0Km00 0S "0x0+0x 0KX00p 0SN02ỵ 0S 0x0+0x 0Kr!; Ǽ 0S' 00S# 0@0004 K &40K!00 0 0 40K fF0x0+0x 0x0+0x 0K7RKX ,08DLH-M  |0S$4(00 0h0 0 00 00 0d0CSb$f$f$f$f$f$f$f$f$f$f$f$f$f$f$f$f$f$f$f$fbcde00 $400 W0S 00 000x0+0x 00 00 0l#3Xx#x3 0S0 0S 0S$#$3l 0S 0' 0  0  00S 0 0 0 0 h p"2I 0S 0  00S pp"v0x0+0x H"H2/ 0S7 00S 0 0 0 0 0R !V0x0+0x c0 0 00 0p!1  0 000 0 0  0 0 0 0 BAX!X1 0S8 0 0 00$0 00( 0x0+0x 0 h 0(0 ( 0 00 (0\ 0H 0(U 00f d`tK ) ,> ? H 8Z Phh s | <  H-M   00 0 0 0dS 0 00t m0S\0 00@ ^0S 0 00 N0S D0 00 >0S ]0 00 .0S 0 00P 0S |0 00 0S l0 00 0S F\0 00 0S L0 00` 0S <0 00$ 0S ,0 00 0S 0 00 0S  0 00p 0S 70 004 0S 0 00 ~0S  0 00 n0S 0 00 ^0S 0 00D N0S 0 00 >0S 0 00 .0S t0 00 0S |0 00T 0S l0 00 0S \0 00 0SM0 00 0S>0 00l 0S .0 000 0S Z0 00 0S 0 00 0S 0x0+0x K (LTdlt$0@\lxH-M M  & 00 00 05 05 00 0 0 (=K 0C 0Ct l7mK A 0 c0$0 60 00 0SY>K 0C0C-Y>K 0C0C|B$ $0S m>K 0C q.Y>K 0C 0C$ Z>K 0C TA 0S=K 0C 0C X괈0S d1:#:d1 Y>K 0C0C0 Y>K 0C0C?0 d1z{ 0Ժ0x Y>K 0C0CE>0P Y>K 0C0C=0պ0$ D1V{ 0᰺0 ۸Y>K 0C0CF>0Ἲ0 ϸY>K 0C0CN>0᰺0 øY>K 0C0C<0᤺0p ᷸Y>K 0C0CR>0ᘺ0D ᫸X0{ 0s0 ីT0 { 0f0 ᑸL0z 0Y0 ᄸP0z 0L0 wY>K 0C0CU> 0X0 k 1S$1z 000, [Y>K 0C0CJ>=0  PY>K 0C0C=010 DY>K 0C0CJ>%0 8Y>K 0C0C=00l ,20<0 "5姷 0S 0 0S00z 0ݹ0t Թ0P 5mz 0ǹ0  =K 0C0C  $ $0S =K 0C0C p5[ 5[[@[[[K A@ =K 0C᰹0p ÷]>K 0C0C L010<0].K B B]>K 0C0Cᕹ0 ᨷ 0S h0 0 咻=K 0C 0C( ٩y00 +0Sm00 02 0S8=K 0C 0C ^X,y*@0  ,D $X 4h Lt8Lt `tǶ 0S 00S 000 0 Y>K 0C0C#屶 0S 00S 000 0 Y>K 0C0C? D嚶 0S 0 0S000 00d1 剶 0S 00S 000 0 Y>K 0C0CE>r 0S 00S 000 0 Y>K 0C0C=0 <Y 0S 0 0S0 00 00D1 |H 0S 00S 0@00 0 Y>K 0C0CF>00 0S 00S 0;0 0@00^ Y>K 0C0CN>0H 0S 00S 0;0 0@00A Y>K 0C0C<0l 0S 00S 0:0 000#3M0@00 Y>K 0C0CR>0G@ѵ 0S 00S 0:0 00X0  0S 0 0S090 00T0 寵 0S 0 0S090 00P0 垵 0S! 00S 0<0 0@00 Y>K 0C0CJ>000@|%|5000 0 1 u 0S 00S 0;0 0@00 Y>K 0C0C=0X 0S 0 0S 0<0 001 000,X&X6嬾`? 0S! 00S 0<0 0@00m Y>K 0C0CJ>000&6刾000 0 1  0S 00S 0;0 0@00D Y>K 0C0C=0oh 0S 0 0S080 00L0  0S 00S 080 0@00 Y>K 0C0CU> 0A0S 勧00 =K 0C 0C@(2Y>K 0C0C;$ $0S =K 0C 0C S(8J6x0+6x AKH-M   0dS   w0x0+0x KH-M M  & 60 83K t0 3GK 0 00 00 00 i>K 0C-e00 s0S=i>K 0CH> 0S G?K ȶ 0S0K\ i>K 0CU> 0ᔶ00 ᧴ 0S g0 0呸0K ڦj00 ,0S^0$0 02 0S0Kh QX 0S 00S $08$0 0@00) i>K 0CU> 0U0S 0K ~+嘦00 =K 0C0C ?i>K 0C$: 0S 0Kd cdd d0"\Z6x0+6x <QKX,L0tI `tH-M   00 0dS  0x0+0x KH-8M( , 0 000 (0h0 0 000 ,0d0CS܅ЉЉЉЉЉЉЉЉЉЉЉЉЉЉЉЉЉЉЉЉXp؇܈000 #3弼00 g0S 00 00((0x0+(0x 00 00 0Xh#h3嘼D\#\3哼 0S0. 0S& 0S#3| 0S 0' 0  0  00S 0 0 0 (0 h \.2Y 0S 0  00S (PP"(0x0+(0x ~}("(2? 0S7 00S 0 0 0 0 0R (!f(0x0+(0x ^0 0 00 0\!1 0 000 0 0  0 0 0 0 =<8!81 0S3 00 00 0 00( +(0x0+(0x (0 h 0$0 $ 0 00 $0H 0Ի4 0ϻ$e 00v tKo ,   8h   <4  H-M     KH-M 00 '0S0+0S 00S 0 00n 0Spp p0vX` `0p00S 00  3/0KL# h |H- M  00 0h0 0 00 0dS 00 00H 0S m0( q0x0+0x K,H-@M0 4 8 <0 800 00h0 0 800 40d0CSddddddddddddddddddddPȏ800 00h 0S 00 000<(00x0+00x 00 00 0"2ںo0S 0 00x0+00x 0S:0 0 0S. <0S x"2幺$0Km 0SD\"\2嬺 0800x0+00x  0<  0 $  0  0 0  00 h lk 0S 0  00S 0!00x0+00x WV 0S+ 00S 0 0 0 0 0R 0DH!00x0+00x < 0 000 0 0 Z 0 0 0 0 '& 0S" 0(0 000 000 u00x0+00x 00 h (0Kt 0 0S 0_(0K,: #F K h<xH-M     0KH-M     0KH-M     0KH-h% `0Ѻ\( T0̺L < 0 $ 4V@lV,H-M  00 00 0 0 00 $0K M0Sڬ0S 0S<h00 0 00 ~ 0$0 0 0 0K0 00 0 000 0S02 K   " 1K00 0 0K$K 0 0S <0004 0E0S>0"0!K 0 00R30S+ 0  0 0S00S00  000x00S  00c0 0 0 0 00S}ʰ 00cKPdH-M  00 0 0 00 0K 0Sڬ0S 0S0j00 00 a 0 0 00 0K0 00 0 000 0S02 K   " 1K00 0 0K K 00S ʎ00P0^0'0 9 0sy00Spc0 0 o00TB0   00c0 0 00 0Sʰ0KH- MM0K00 0 0 0K ; 0 K00 0 00S " ;K0C0C + ;K0C0C  + 0S qT0 q 0@ 8 , 0 bK,#0#H-M 0S, (0,0,0K8@#pH-4M0 00 00 0"K 0"K00000 0S00  0 2  0r0S00 W0S  0  0 Dh2 Kp 0"KD2 Kp 0"K0`C(2 p 0 2r 0@P1  1rq 0p 0 1r 0@  T| 0 d 0 000  0RK 81q 0@P00C q 0q 0"KK 0q 0@P00Cp 0q 0"K0@CK 0q 0 "KK h0q 0@PK H0 q 0 @@ 0X40 V8#P0#L0A @h@#,#H-M3K3K3K 00 0 0 00 00 00 P3K ; $3K0S 3K0S#30 00 0s0  ) 0  0 2 2 K d2K08#80 h0K0 $2K <0K0 0 0  ;K0C(0C 0  0s0  u K0K! 0S 00t.1孶|1  K ;K0C40Cl! 0S 00H!H1嗶01 10S M0S00S0 ;K0C0C +  ;K0C0C +Xl0  0.o 0H r0|0K(8#0#,#08h7`@H-XM@ D H L0 0K 0 0 0 040K 0 0 0 0 0 0 0 00<0 080K@0S H0SZ 1q0S 0S 0S 0S ` 1_D0S D0S de h1SD0S S 0KD! 0"( 0K(!0s 120S$ԡ44 K00040K  0"( 40K  40K  0"( \@ T00K4 K L  H  @@D K(TH-M  0S| x0w0 0ST T0m0 >0   g0 0 0K @H-*M  " 2 P L1K?K,?K@ ?K@ ?K + 0S00 0,0-?K: 0S 00 ?K0cK/K d 00/K/K?KK0 200SS B>K0C 0C0 @0u0SH F>K0C 0C0X @0j0S= I>K0C0C00 (0_0S2 U>K0C 0C0 0T0S' W>K0C0 0J0S =K0C0C0 0?0S Z>K0C0C0 040S Z>K0C0C0SXX#X30o?Kb/ o?KG4 40S 400 # 300,0 0(0 ( 2b$K 00So/K(0b0?.KF0So/K(0b`o/K(0b0 PB>K0C 0C @o/K(0b 00po/K(0b 000 B>K0C 0Cp /K  05p5 `5P5 500S 50000@?Kv  Z>K0C0Cp =K0C0Cj F>K0C 0Cd W>K0C_ ?K050Z>K0C0C0 =K0C0C0F>K0C 0C0W>K0C 0$ =K0C0C(0 0I.K B B=K0C0C 0S00(00(0 ( ,0RT0 K (,04[<chhH- M   0 00 0K   0s00b/ 1$0<0K   0s00 00(0K   0s00pe/x0000 0  0s00 0 0000K8H-M  00 =.K< k ->K/f 3,300 ->K 0 0S00"2峱2 2 0t|"|2娱2 p20R2S00e 0##3x0+3x 3, 300{2 7 0S 2 / 0S!1ve->K 0St!1h800  0S00 000C-K 0S@4!41K00  0S ->K 0S) 04 0. @ 00"=.K * =>K ;"3x0+3x 3, 300YKt,xVDH-M   0S KH- M   0dS00 00di'0S 00Ha'0S 00 0O"0x0+0x KH-0M $ ( 00 1 0 10 $0dS ~ 0  _M(00 00, 0SJ/00 0S0000S00 0K  000 K 0K  J > 0   4 0   0x0+ 0x K H-0M $ ( 00 00 $0dS o(00 00 0Sd0 0 I 0S!1'00 } 0! 0x0+ 0x M K0KJ0i 00  0i 0ݨ0 | 0S 0F00 } 0r! 0x0+ 0x  0   ݪ, 0x0+ 0x K$5(dlBtH-M  " 2 00 20 20 2S0 S*0r?K E 2Sr?KGQr?K2 2S 20S0x80K / H0K * X0K % j?K 80K k7H0K 6X0K 880[S0P80KA0S80K,%H0K70SH0K%X0K-0SX0K$40;0 KN 40< KG 400 K@ |40<0.K8 \40 =j/K1 2S\4}  0S v  0S 00~/K$ 01K~?K  80KW0  3 00 0KF0  p3 0 X0K50  ,3 0 0  2 o0 A 0S Y ا 0S 0K᭧0 \206,h 0ᆧ0L ᱥ 20=0ᓧ0$ ᦥ0Kዧ0 ឥ1[S >Kဧ0 ᓥ0Kx0 ዥ80Kp0 ქX0Kh0 {H0K`0p s>K >K h$ 1[ 1[[@[[[bK@ Q b?K:0 M30 Fj?K+0 >岝( (0S (- ( 0S y00 0Ky*P$(48@DptH- M   0dS 000 0 0  ㍲ 0S  00x0+0x *00 00  0x0+0x yKH-(M  10 0 0 0dS 5 00 00 0SF00 0SF o0  P0x0+0x `0  A0x0+0x KH-0M $ ( $0dSg(0 0 }?0 00 0SZ00 F0S0000 q 0S, f 0*0 U֜0  0S50s/05}?0 0s 0*>0  0"}?0 0S s00 00  0 0x0+ 0x 0x0+ 0x K$ [$_@H-M00 8s0S @@ @004喪cr (0Kvl H- M   00 0dS Hr 0S00 0O 00D/@0弬00} 0@0x0+0x KH-(M  00 0dS Cr0S00 r 宥 0S/0匬00} 0 ە0x0+0x "e 0S0 p ~  A0  "0x0+0x e 崕K H-M   00 0dS F0 0 0 00 30S s. 0 00 #0S  0 00 0S  0 00P 0S L0x0+0x K , 8 D H-M  00 0 0 0,0 0(0 0K 0K 0dS 00 02P 0S  # 3Ы00} 0T0x0+0x V 0S 000 L 0S 00 0 B 0S 00S 00, K0S 00 ,0Ki0S0S0S 00 00x0+0x l,K K0K0 K0K K 0S 00 00x0+0x O0 K ფ 0S0!01R00} 00x0+0x 3 Ӛ$ $0S 0: 吔0 0 00} 00x0+0x $0 $  v0 0 $!0$0 0x0+0x KP     ' / H-`MP T X 0 0 00 0,0 000 0@0 L0K T0dS WX00 02[ 0S88%85۪00P} 0_P0x0+P0x <a 0S 00 0 W 0S 000 M 0S 00S 00< K0S 00 <0Kt0S 0S 0S 00P 0P0x0+P0x <KL KL0K0LKLK@K, K00KJ 0S 00P 0P0x0+P0x @0SHd#d3_00P} 0P0x0+P0x @ ,0$ $0S7#3D@0S" 00 @ 0100S @ 0100ݮ@ 010 000 00 R@0ͮ0@0 00P} 0P0x0+P0x $埙( (0S;"2$\0$0 @0S" 00 @ 0100S @ 0100ᛮ@ 010 000 00 R@0ዮ0@0 00P} 0`P0x0+P0x =(0 P( $0$0 @0S" 00 @ 0100S @ 0100[@ 010 000 00 R@0K0@0 (塤0(0 P0x0+P0x KfL   t x    H-M  0 0 0(0 0,0 000 040 080 0<0 0@0 0D0 0t0 0K P0K 0dS 00 02ʘ 0S@@(@8J00} 00x0+0x П 0S 00S 00` K1忟 0S 00S 00p K 0S n00 p0K0S`0K0S 00 00x0+0x `K0 K40K8K<K@KDK 9008#89K4000K8000K<000K@000KD000K000 040 080 0<0 0@0 0D0 pK0 K40K8K<K@KDK $ 008#89K4000K8000K<000K@000KD000K00 á 9[ 0[[PK9[ 01010!0[ 020b 0[9[ 01010!0[ 020b 0[0Q 9[8K0[0K0[0K00K;00K;00K 9[8K0[0K0[0K0[0K0[0K0[0KKKt K(0K,KH 0[000K00K00K00K0[S00K0[000K0[ S00K9[08#89K 0S8 0s3 0 t0S" 00 t 0100S t 0100ʬt 010 000 ,0 Rt0Ậ0t0 00} 00x0+0x t0S # 300} 0z0x0+0x (0S t (0ᤡ0P K t0S" 00 t 0100S t 0100tt 010 000 ,0 Rt0d0t0 0S!1孧00} 010x0+0x a(0 0 0 0(0 0 S#9[ 01010!0[ 020b 0[9[ 01010!0[ 020b 0[0Q$ $0S 0g彐00 00} 00x0+0x $)0 $  壐00 $N0$0 0x0+0x K , 4 8 x v T  H-M P0K 0 0 0 0p0K 0 0 0 0 0 0 0 0 K@0 00 00 @0K, 0S!10v,0S !10j@0KQ 0S 00!1Ѧ0Z0KxE0KὟ0l НP0K@1<P0Kᱟ0@ ĝP0K<%<P0Kᥟ0 ḝP0K <P0Kᙟ0 ᬝ80[ 70[6[@5[4[3[pK@ p0K~0 ᑝPD _ 0W0L ႝ0KJp  O U  48 Dp H-|Mp L0K 0 0 0 0l0K 0 0 0 0 0 0 0 000 <0K, p0S!1)0[9,0S \h!h10O<0KQ 0S 000!01 0?L0K<y;L0K0p L0K8m;L0K0p L0Ka;L0K0p 40[ 30[2[@1[0[/[lK@ \l0Kƞ0pD ٜ0K{ < D  48 DpH-M00 00 ̞ 0S0CŞ 0S 0:꼞 0S 0/h2  垜  嚜(,0_ 0a0 p ጜ0KU0^ 0Q0 4 |  Ž0K    H- M   0dS ) 0S 0N00} 00x0+0x 0  =00 0x0+0x K H-@M0 4 8 00 40dS (0K (0KF 0S 00xx#x3 000} 000x0+00x  0S. 3000} 0v00x0+00x  0S 00"2٤/00 000} 0Y00x0+00x (0[:^ 0᝝0T ț'0[-^ 0ᐝ0$ ớ&0[ ^ 0ო0 ᮛ%0[^ 0v0 ᡛ$0^ 0i0 ᔛ 0^ 0\0d ᇛ0] 0O04 zP 0S!1_嵍00 000} 000x0+00x !0 0 囍00 0S 唍00 ?00 00x0+00x K T    $ ( 0 < H + H-0M $ ( 00 00 00 $0dS dd"d2 ! 0S<D"D200 } 0 0x0+ 0x }K K0K = 0S 00!1600 00 } 0` 0x0+ 0x Z0J] 0ᤜ0` Ϛ0=] 0ᗜ00 š00] 0ኜ0 ᵚ6 0S 0坣00 00 } 0 0x0+ 0x _0  @ٌ00 儞00 0x0+ 0x K[P ^` f   t H-8M( , 0 00 0 0 00 ,0dS p000 02ǒ 0S!1G00( 0(0x0+(0x U`͙ 0S 0 0S000 ,忙 0S 0 0S00 0 屙 0S 0 0S000   < 0S  0Y00(} 0(0x0+(0x J00(} 0v(0x0+(0x KT   H- M   0dS *00 00 y0S Z00l k0S  00 060x0+0x K,$H-(M  0dS R0 0 }?0 Z 姛 0S, \ 0`0 ዙ 0 0S0 0s 0k}?0  0s 0`>0 l| |0X}?0 0S 婋00 00 00x0+0x K $@H-8M( , 0 ,0dS 000 00 000S6 0,0S2 0,0(t 0S 000 k00 0S 00"2} 實"200( 0(0x0+(0x 0 0 02SE 02SA 02X 0S 0"02ء00( 0\(0x0+(0x u ^ 0S 000 00!1庡!1崡  0 0 00( 04(0x0+(0x M 0S 0 0 0s0 C  0S, dY 0ᾘ0 j0Q 0S00s 0ɟ}?0 0s 0徟>0 l| |0嶟}?0 0S 00 00 010x0+0x K$. 1 $5 @H- M   0dS *00 00 50S 00l '0S q 00 00x0+0x K,$H-JM  ! 1dS 0K >K .K0K 0: 0S 00!1500} 01x0+1x `@ 0Slt!t100} 01x0+1x I0[S 0K0  1[S >K0   剎 0S 0 F0 0 00} 0p1x0+1x 0   ,0 0 י00 1x0+1x K , X H-8M( , 0 ,0dS o000 02# 0S!1壞00( 0'(0x0+(0x T \) 0S 00S $0K #00$ K  0S 00S $0K 00$ Ko$0KM9 0S 00x 0[ 屇0 0 00(} 0(0x0+(0x 00( 0K  $H- M   0dS *00 00 0S b00l 0S  00 00x0+0x K,$H-(M  0dS P70 000 0S!100} 0h0x0+0x 50 o0K> 0S 00 0Ý600} 0E0x0+0x 0  j0S U0x0+0x K+ P4 xH-MM  ( 00 8dS $$"$2初렖 0S"2~00} 08x0+8x m;K0C 0C+;K0C 0C׮ 0S p!1[屆00 00} 08x0+8x F;K0C 0C0 ! 1A;K0C 0C10 DŌ 0S 0,傆00 00} 08x0+8x 0  h00 00 8x0+8x KU X a i (n 0H-MM  ( 8dS xx"x2 80 02V 0S<D"D2֜00 0Z8x0+8x } \ 0S 00S 0 0 !1嵜00} 098x0+8x \00ͭ 0S Pl!l1囜 0 0 00} 08x0+8x >>K0C+!>K0C 0S  0v ̅0 0 00} 0 8x0+8x >K0C0X 0] 峅0 0 00 0 8x0+8x K |     H- M   0dS *00 00 0S ,00l 0S y 00 0 0x0+0x K,$H-\MH L P 00 00 80K 0 0 0 0 0 0 0 00@0 03KL0dS  0S44$44˛00H} 0O H0x0+H0x 30ᯔ0 ’300ᥔ0 Ḓ30<ᛔ0 ᮒ30 =ᑔ0| ᤒ`30<ᇔ0X ᚒ830<}04 ᐒ30j> 0r0  ᅒ20q>0g0 z20m>0\0 oU0 h@0K @0K ] 0S 00 \"\2F@0K @0[ ?0[>[@=[<[;[8K@ 780K 0 3@0K - 0S 00`!1@0K @0[ ?0[>[@=[<[;[8K@ @80K04 儊 0S ! 1A00 00H} 0k H0x0+H0x 0 H '00 ҕ00 H0x0+H0x K 0y*LT`p  D<   H-M  0dS ~00 02 0S!1厚00 0 0x0+0x c>0  0S 00S 00E0S<H!<1h 徃0 0 00} 0 0x0+0x 90K 00 KQ0K%/ 0S 0@ 喃0 0 00} 0 0x0+0x  元0 0 00 0 0x0+0x K% H- M   0dS - 000 0 0x0+0x |x 0K 2+\0 0S 008 80ޙKX0<Ph|cH- M   0dS Iݒ 0S!1廙00} 0? 0x0+0x 3< 0S 0壙00 00} 0# 0x0+0x  e0  F߂00 劔0 0 0x0+0x K{T  H-jM  ! 00 L0S 44"42b1dS 1 0 02̈ 0S!1L00 0 1x0+1x eҏ 0S 00S 00E/K3h 0S 00S 00e/K"0S p00 E/Ke?KpO 0s 000 0 1x0+1x !0S x 000 0w 1x0+1x 00 0j 1x0+1x K0H- 8M( , 0 00 00 00 ,0dS bK rK 0S70S4 \2C?0ce0c"R 0("(2RR 0@P 2C?0ce0c R 0!10 00e 0J0x0+0x 00 0=0x0+0x K`H#p|H-M  K0 40dS -00S8500S000 |0 t00S p0l0 Kd ~0KG0 K(0x0+0x KL#H- M   00 00!1M0dS f0 0 0 00 30S @N 0 00T #0S > 0 00 0S . 0 00 0S  0 00 0S  0 00d 0S D0x0+0x K4D@L\dH-MP T X( 00 X8 0 T8dS k=K0C0C+^L0K@ Y!=K0C0C+R 00S 0 00LK 02S 0 0"=K0C0CL0K0=K0C0C0 0吏LK-K B B!=K0C0C ;㈤!=K0C0C0 0{!=K0C0CK00 0 ?P0S!=K0C0CP P8x0+P8x KtH-BM0MX3KP3KH3K 00 0 0 (3 K0dS 3K00#342K00 0S "2(2K00"20K 0 00S0#K a0 00K 0<T"T20K0 C0K 00/S 0K0 C0K 0 00 0Se0K 0S00n00l!1ΎP1 K} 0P,1 K0x0+1K0x @B=K0C 0C*QB=K0C 0C* 0J00 @0S0 K} 0'0 K0x0+t0K0x ` B=K0C 0CK 0C00 K0x0+0K0x Klhd$#,H-PM@ D H 00 50 50 D0dSfH00 00 0S00Sf00 0S]Y 0$0 0Sdd%d5500@} 0@0x0+@0x CV, ,( 506CS 00 0 G 00   }$ $0S$4 00@} 0@0x0+@0x $0 @$ @0x0+@0x $ 0000SD0008 K t80K 00$!$10S00 0dSd00 006CS0/000 +0 @ @0x0+@0x 00@} 0v@0x0+@0x K`|$RT y*a s, H-M   00 0 0 06S (( (0庌$0 0K3$D#H-(M00 0S \1 T3H10SJ$0K?010$ K !\ 0S!1刌$0K[5000 0|0 !000  ?000 0 1S wT00S$$0K/$$0K}dKD#8#NPS|#H-M@ВE46 ,0&0K 0KE0F-0 0K/@#D20@-PPM, @@,,? P]/  X.2@PkI3Ѝ0l l0 0`  @0sЍ0@ @0 0 4  30fЈ`|lDP1P0G-@` @M蠜쐜pP $(,0p84P1 ЍS@-@ M, R 0000( ,0*1 ЍR R R R xx00  d  \0\L@ @  8  $0J$|4O-@LMPP@ @$@(@,@ QR R40 $崔崴4崤0 d 0 4P@0 0p`0@000104P8@<@@@D@[ `  0D b r` R8)'Pq 0Sn #0 @ 004`80<0@0D00 1@5  000  -0P T @s b(0P0T'0LЍ,3,S0P03 嵷00S02 0400@@00<@@@@1 ޾@2 0jR0P00@4 00108@<@@@D@ȾL"L2 0 @" 42x020B0@P400D<@D10P ߾夾!1 0 ! 1T10 P400@D@<@@@D@10P @0 Ỿ倾w\!\1 0 P! H11D1DA0@400D01<@D0 噾^U P0, 01$ @ @ |A03z{zXy pngxX@<x\w8hTwpvO-PdM@p$P(P,P0P4P8P3C0@L0 0 H0\0T0X0\0HI 嶻dЍ<@T]|R|P00S0X2Xb0`L0 0HH@\@H I0T@X@\@û刻@S 40#0dЍ 0 1 $0 24 $0P !A @`PLH\TX\H`IP 0去S0< \ h VX  L1@ w HP  C00S p  )m0 0 Ѝ . 0p`pO 0 0  |0AHpl0`00 X05TܳL(dHlUc,hķx- M00`@P Ѝ***A-0@PM0@P`0p0P *`P*pP*0P00 0`Ѝp000P X0۱ЍH000P ?>ϱЍX*G@-PMp*`@n g ;P QP0P 0 0,  0危T Ѝ` `  X 0 `pP 40v@Q,1Ĝ@\0@-M1@ N PP& 0P 0 0,  0HT LЍ0   0 P h028X X0 0 L  @0$8/06`ԭ4(F/0@-M00!勸 P  @PV Ѝ0( (0 0   0Ѝ0T<ȶ O-((R0 ! $ 0(@,@0@4@姷4_0# @ G-JM(,cCc pPF 0`PP 0P P$P$剷(p3 R@ PzX#X3Z(P 0,D# w? 0H @@@@@ @@0 dP 1 # \Py 2Px  2B @(P0I $ 0   $ 7P 1 # eH20.8?0P3"0 cAPPP@@*QJ0P@@@@ @$@02Jߍ!1 0 ! 1@奯랻|1Jߍl!? /T!T1 0 H! ?㍯@Jߍ0瀻0  z0@ 0 0  0q0  gĀ0G (P@ PP P$PL@ֶ囶\ #*ȲtT0t #[>,Z(max2O-䲟㬮<Ѝ0 000墮U 0$ 0(,04ֵ<Ѝh@*0`( $(,04` 0꼯8OW#S0g#̯̿x_maxC-SMHP@`,x30p0 008<@D0 104`塵!$0 @ S 0 N Dp# ”D” $R/"?PPl,Pi @P @T5 ,@P `i@P>"2 0 " 0 ," 00P4P0 108P P` 4 %0@0@@ @$@`q&0 @p0@@ @$@`厴S JߍPPG- A Q@M\`& 0N0$  p0 0H0  0 ( i@T t0t0  ЍP000 80Ǭ"ئ$ O,"V@-M0 0">@ЍO-PdMQU L SJ 儡儑儁q@`"(H0X  p  0$`D`弴 0@Pp4@CT@E8%`P dЍ0  0h x%p囷W000 0VdЍ 0 0 x  0H\000P p <0;8ĩȩ̩ܩ\xPԨZC-PtM4 @ ❿#  1dpPp@` U@ @ @ 0  TPPt t0 0 h  `0tЍH H0 0 <  00,"ذСO-B"@N]`$P$Mp0 ` p`̑W1 0 P 0?㤱岫O=0 400 0;h1PP= }>P PD1 0 $Ѝ,100P 1勫$Ѝ10 00~ P0 0 0pPP 000P 0e00*H0 `0`U"dܡP."C7X=2C-Bb@ MRP5Aa@!N  0p$PP p1O 401P`7 }>PE P l!l1 0 `!` P1Ѝ@@1 0 ,!N$ ?p F1!  0( g 0 0  0Ъ 0P 0 0 ? Ὺ p0p"l".D$P8u0p@-ADM`/0O84$0 p 4Aㅪ0S l4l$0O-0 ( R@*A!\$ B#(4 0 PQ$4 0SpO-0,  #0 0=CSs@ 0  $000 00 Q00t3 0 8dCdSd@P 0 <3P&4`P $300P  3DЍ200S1Br@R   000 000"2 0 " ?DЍttB@ O-0$@,, i<"<2 0 0" $2ԩ >$P!2 0 (0SP1 0R!1 0 !? 㳩r1 0 100S 10!aQ%x!L 0 bR`A`Q`1@0P 0H1P㊩`Pl (100P 1|ao_ 0 0  0m,P̮@$" 8" D"D H8$h "tȡ@C,DB"tDB!0B0"8Ъd` O-QPtMp@`P SR U (,0   (,0403D0408@HP@!"0Pc#ß #( $ $0 P K?0 ("("\r0 S R P P 2@P0  EVhPX`0Td!@P4R夂(0P 2 㸨P (!@(!TNX200 Y?㦨0"02 0 $"I?   ?[tЍɳdz!1 0 !1 @ ?T 1$ 0 0 >p x!x1 0 l! `1b嘳喳D100@ >R ! 0 0@ 0 $ 0 0 04j 0 $ 0 0 0$ <ؚ4ZxL`RY|`\68=E8@-[4P@T0 Q- ?RS88@-{4p@Pb X>pnLR1PI10S  ( pa ( Z'Xd$pT$040pP(040pL [$ uY810S  ( Zdt0 40s4p.!P  ]P~ 0<S*$!$1 0 ! 1 < 0Xh  u[c`"ȕ0" !<)""XX"D"(<0'""~\{"t""|Ć " "0{@-{4p`PQ=0@@T? R  BR?d$0@U@R\@-{4pP@`Q= 0\? ^AQ/R"<0Q?\, 0`-)`Tq 0 Q͌ ?\  R/?$00S Q- //P@-{4pP`0@ Q- ?R @T?T$0PO-9YiM0P`@ 0`d9#TY  ) 0 S1< Q$) pW 90 YO͎,pOmO-<ğ<  0 d $` 04唟P0 `@h@`0a0l@p@t@dPȦß #  03u孪$嫪``|3|ß0x#tS ;  X#P@P D3@X (3  0P U3 #3 0,"4r 2=u`Q20 2 .0 `@h@l@p@t@a`dP`0u||0P hŸ0 ` L2D200` ,2 " 2 0 " 21$/`100` 1 0` 1ޞ!1 0 ! 1ў``^꼂wu""$(,x"{uȇ@"0sPE"@"dt@t,"0t"`"pr\p4Drr"X"Pq}Lq|p}D"}hn\pLn|o}m$q_8y$z/tz$(zn5yy8ny 0 /P"00@-PPM+A@P [0P0 CU0P Ѝ0 0 0  0I    0P 09 0 0,|  p0,d d0 0 X  L0("~yly|~kH~4yk~8ypkO-@AT PlMP3#`p*R pßp l# K?0P `p <3lЍKS$ P $P 30S&"Ÿ  " 0 2̝"2 0 " 2"2 0 " 2崝ꫩ댒H0 2 $00HPH I0TX\LH" 0  HHLPTX\`d'( ,0(,@P 5 00080 10<@D4@廤p@0 YpP4 (, lhH0 (`(IV 0@ j4 04`0 10Ť劤 0 0 P p o>9M 0 0 0 ,0@ @3000垤c4}yj0"0s0}$j}wi|riHw@rizvgzDqgA-0`p(M0`p0P p0P 0@06 0@P 0@@ @$@.hh0p00 P0Ϝ(Ѝ@0p00 ,0Ĝufex"0usO-<4<100 1|1 00 d1X1 0 0 D1p  80HLPTX\H0O0000 0ƛ~000 0弛t0 000ᱛ 90@L@P@T@X@\@tePd "0 @t6rmddsDl0q q r(ojTk1p@-l1lAlQla M0@P0` Pu>yP? QPU dL@@ 0 0  0V Ѝp 0 0 @ 0G@;0 P0a PPPPP巢| ЍpX0P00 D0.q`r"-Pr|pL`brTp`fPmS`  -P M D D  <  ,0  Ѝ Ѝ"l<^_oꌷ"C- B`@MPPY $Pb 10S6QCqЁ1p0 ` 01ךc`P ˦@,t! 0 PYPAH!H1 0 㴚ߍ!  !0 0多 0 0  0嗚 0 0  0勚 0 0  0d000 x0t8t"0t^]ne`]\n]g]]0\mP]\j ]\e\`fC-Ap@MPPJ $PS |10S'Q``Q`V/TTT1 0  081p/ 100 1@ Ѝ   0 0 0 0  0 0 0  0| |0 0 p  h00"0[LZdl@ldY8[0Ydk[`YxhZ0YdcZ0@-0@P M0@P0 P0 P $P 000P t0$宙 Ѝ0d0P00 P0夙 Ѝ0D0P00 00嚙 Ѝ0jZ$X"jtjg0@-0@P M0@P0 P0~ P $P 000P x0$l Ѝ0h0P00 T0a Ѝ0D0P00 00W Ѝ00jY\W" jie 0@- M0 0 =00P$ -l@@ ⢬P0=H H0 0 <  40ЍViW"h"4\VilW@-M00 &@P&غPP4 `PP 00p `  0 0 00 0Ѝ 0 0 x  0јط\X X0 0 L  0Øʷ$Z" klkLj\lj j l8jiC-A@MPX 0S !1 0 t! 0㙘\1 0 @LEЍ@Pᑜ 㟜 Ҝqp P @` TP @ <@PP 0 0  0c 0 0  0TЍh h  `  0FX"p"htj,i""bhXiPhP"gDihhggQ0@-@M@a@dP0  0T  Ѝ0O-RPEMp@`8Q<$ US Q   P | 0 n Eߍ` `0 0 T  60ݗ8 80 0 ,  A0З4fg8ffgfC- $MPp`@P  0 0  0㲗P# @堣> 0Ϡ,Π l 0\0@THP   0u$Ѝ"g u03/n0P00 0- d0P00 0# Z03/SS4adbba "K"aaTaa$"8a ശP/ pஶPG \ਸ਼P7 H1p0P00 0 p$1Ŕ v0@ 3/qЍP  0㰔0P00 A?㦔0P00 0㜔0P00  >㒔\0P00  H0刔_\]`"O__8^+L^^$^] G-1AQqM0@P` 0d1pPc4PJ @/`PE 0Y5 1P0000 1IP Ѝ P'  pP" 0P000 00` '03/׵ Ѝ`0P00 H0 ]8[_SD"[k=hM\}x\gA-l1lAlaM0@`P 0L1`@µPE ,ཱུPP@ 10pW0 1`000 00ד@૿P ॿPP s@0003/ЍP d0`00 L0娓[pY]K|"Z7[[t["DWZ3Pp@-M aP! =@P 400PU` ϼ Q5/ᱞЍpX X0 0 L L0 k< <0 0 0 00 `d"V Z4WVZW00/0"00 /"00/"00/"00/"00/̹"00/ḹ"00/᤹"0@-DBD2DR@M6 0Py(2K0 0Pc2R) 0PM2# 0P71M 0P!A 0P !  !0 @ 1!1 0 ! u?Ѝ0M/pp l! 0 L1ג.@@ p卑Jߍ"V_ W5<;^VVJVp"U:U"]UT0@-dPMb눽@?#> 0c 00S0@TЍ00N0@-M00!Θ P c @Pᙺ Ѝ0( (0 0   1>8Ѝ0tRH8xS`1C-@QM`0F H!P? 00010 0p a0V 00H0 0e0 022D л 0\ 0 P, 0 0 j0022e 㹻000ЍL L0 0 @  \0ېS[SSP[ShRZ,RO-T1TTRPR4M0DP ` 0~0 P@p㲐70@`0 @$@(@,@pΊP`  ᵻ50@ @$@(@,@pP04Ѝh0 00P0ㄐ60` `$`(`,`pP0˗4ЍRQdQ"QP- M  Ѝ$ $0 0  0 _`O*PO-Q4M0 LCLSL3@P0 0 0PD0prrp0 0P p4M`Pt "0  0"20 ໹0嬂Se@Pm!0D0 0PN@a৹0S]]0LBLR@P0@S0  2 00`0PB   0pP 1 000Pޏ4Ѝ10 00PpϏl!0 # 0p 0$0(0,0 4Ѝ(1 000P峏 1 0 #@0`,`$`(`,`@  0 0 0 ᓏ0 0 00# ,$(, 0ӖOHOpQLQlQ,QLQPQN,NDPP4PD"HO(+Լ"xL`NLpNT"0 O-`Q4Mp ȓȣ3 0 0 3O0PRR\0 x3 P?X@P 00L#L3 0ɸ`P (#`0 aླྀv#3 0ß 0"2 0 䲟e \Xaࡸ0SW!0I0 0a0 SG]0`R`bP`0@=D l42 00@ 2`ݎ, 0pP 1 001`ʎ4Ѝ10 01`p廎!0 " 0p 0$0(0,0 4ЍP1 00@1城8180 "P0@,@$@(@,@P ޕ 0 0 0 0 0 00" `,`$`(`,` 0忕K KMxM MMMM0````````E$I %@II0@v` ȉ i Tpݍ4ЍOЍ/\( ጗/ 0%?@0 p @ص$4 0,$ ?7ᆵ  ( 0,@P/b`^$4 0 $ x4MލЍ0-  T$O `@ 0$04 0 $$P  4 $ 4 0$ 3'%#30 `P0`P 'MލЍL 0` @ $<8 4D0@$08#v> 匠 0 @J  D ɶ@020 0`Z +㷶D@/<0 "v⌐ 0 0 #$|"?O0 `p@ D"D2 0 8"P  (2q8 " 2 0 " 2f20Ѐ @"Ƞ0䀍܀@ 壒MލЍ!1 0 ! 1Bzx10 0 0pppp 08!81 0 ,! $1 X10  @0PPPPP@ ]((D&DE|E4?Et?>dE>&DH>8D> >DT> "L@pADA4A <A\<;t@0<`@"\;@;?":x?;X?"0 00/x}O-錄RQM`pP| 0SU@@v PPğP4 0  004 P嫊 $` 0`  `@d@h@l@p@t@x@|@$@(@,@0@-#$0 &\`P0`S `!3 PpP 0 p PUj@0PL#L3 0 @# 83hЍ4@4`8`<`@`D`@ 0³PP3 2 0 ҸP7"2 0 " 2920-P@d0`tlpt`Pa@` wЍ424Ÿ0 -@L0H`\`T`X`\`H@IH `!1 0,! ?1!0 L00- HH0\0T0X0\0HI ?|x!x  p!0 \1݉T1T!0 L00- HHP\PTPXP\PH I0` 10 00`ᾉ00H@I-P"ȠL0\@T@X@\@HP H><}d98 @i @?7?886>|7e>"H>"6=6>"=x56=|"<r<"O-4vRQM@`Pp RS 5 0  0? P ^hlptx|倐儐,048P%h0  @ ܲlPR XPL D0P900%p * % ş , @P' P0T0PQX0\0`0d00i0<@ <0@0D0H0L0吱P 0 ㋷PU0P\$\4 0 P$ H4Ѝ$4   t$,0 p Pr`0' <@P`T0P Q0X`\```d` <`@`D`H`L`$`(`P@$ (0)PP$( 0l  0 :P$埴D30(@T0P`d`\```d`P@Q  "2  "000 ?㌈20(P@l0h|tx|hPi@h ʏЍx20 0  = jT2T0PQ(@"ȠT0d\`dP@ P姏b"2 0,! 1G1!0 T00( P0d0\0`0d0PQ 冏A!  !0 |1$t1t!0 T00( PPdP\P`PdPP Q0d0,!,1 0 ! 1 100 ? 000@ ?x44<::;0 <";:X2"9Xx88t90`74"P7`7"d87/$7$"670/6"X76.66 p@- PMU@ T x0000ЍpЍpTTs`P @ @0 0 4 ` ?㕇"؜"L4 ,|5,@-M@ \0S 3/Ѝ@-$M@`pPL\ 80`00 @!@1 0 4!@ $1.t!1 0 !@ 0 f 0 0 @ 0X 0 0  0L"ԍ""""Y%+0)$`)(^\$0)'y($ )'~#(@'#('h#(&0#p(&"`&ZO-PMP T301Rt< 0#03 0,$# 3㽁P@ L0DL@P@T@X@\@`@d@h@l@p@U p>ŸU@Ѝ(8 1Ѝ 0 0 p  p p0h""D'@%&$'"$$"t"T&a%b$<$D"O-PDMP@pA 101W<1QHʌ` 0`` `$`(`,`0`4`8`<` 0 0X % M @0p P/@  @ ,0 0 0 00DЍ 0 0  p 0匀| |0 0,p  d0X X0 0 L  @0rꌁ"b"l"x #D " O-|M@똬T70Q1U401 <7p0npW& .㶫P&6 04 &6  p6&0` 8 0 `Lda0hlpt` 倶p> \@hƟhh P8XP y.00 00 Pp` .嘾d00 p ` Ph0TX\l 0S+5?cd0U 1PS㌀  0SZzX p zR -0 ͟ - =  x0匀S ] 0P = x=0  >xh- 08) `00000 1S d`0S 0M70,0! 1S,0 ,0 0 S)zW:(j^00)0  ) 9lw41S000 d` 0`3/ d` 0 `3/ d` 0`3/(0 ( x8?wd`0`3/TT(0 @( 88+w0`3/00CS730' /30'  '0 7w ,p00`/Wl'7 0 t' h7vwߍX 0HǟD' @7 v0S2o` ``0`p8` 0````p~` ` 0Lp>0LS SL#Ld6` `0`8`0p` 0````p}h `` 0Lp0LSV25` `0`8`0p` 0````p}` ` 0Lp0LS*`` 0 00`0LL>_`P 400  0  0LfL"0p0L6/L  0L, ` 0LL4``0` 8`0` 0````N} d0R q h3/ | 0`  `0>S4 S H#H  @#0 (3u`` 0 `  ``0 0LFL0 d`0S "0 @" 2Lu0h3/LPL0L} 00PLJL0  d`0S 2 "0 1  Lzu0h3/L L1PȞ0LS| 0S @"L{0P00LS6 t1 DX Q<g $ `"XX G H xV4 Ds  P]"P \""X pc L4H *x l 8+ `t dY"X"X"$W"LV"@4v  4Xo08| 4d  h{ 4L"(4 xQbh   \f @N $T $(_ H b 8  0 S| p0 d`P 00CS! L0P0Ll !0 !0 0 1Lt d` 0 h3/0L000 d` 0 Lh3/0L00PLpL`LV tP !Lbpr0`p 2 pGtdh03/P嚝 0  0P0 3p /tL%0` d`0S @@#0 @T# \3Lt0h3/LPLi 0  0P彟#0 # 3sL 1``M #0  # 4 s000 ` 0 1`` X$0 ` d$ h4 s000  1``  $0  $ 4 s000  a`` 44 8% D5 s00`5`08X! "2 0` ,0L`L` 1``] %0  & 6 Ts000 ld`0S L `3/LPL噜0P00||&0 & 6.sL$0 |  d`P PLz0LS PLΞpPn d` 0 `3/ 0  0P廞L0u d` 0 L`3/0L000 00|  0LjP=0`SL  PL吞pnL`LV t0S PL(0L 0 0 0PLwLd` 0`L3/0L 0vH1! 0L3/0L00 002PL0LS 0S (L宝d` 0 S L  `3/LPL9Lz0Q d`0S L `3/LPL˛ 0  a  ) 0 9L\rLR)  )0 9Mr` 0LL90h 000夀  h06/`V4 00a`A}pP   㦚00! L坚L0  L`VV"+; 0@t@x |0 `01x|  00t h;qT@Lם}L+  +0 ;LqLd`0SP $bVMhLp3/```L0(bQ` 2 ` 0$r`L6L p0 L6/L  0%L` 0 ``  , 0 <LqLxVt  - = 0@x@| 0 | !0 01   0 !00 01   0 !$00( 01,  0 0 !4008 0< 0@0 x ,>D/qt @T FV@:d>dd0@t0@x| `x |01   0 0t >qT d` 0h3/00 d` 0h3/00'0h d0` 0h2/\\\0p p? p01 F LN1LS ? 00?p嫜LK LיLP] K:1' d` 0h3/00 d` 0h3/00p*p  h*0 T:LpLD*D  <*0 (:L~pLt L{LP` )0 )9 ip{`PLZ Lz{LP`t)0 ) 9NpL{L`PLl)l9 0 `) T9L TT&0 @@& 86LLod`0`3/0L00%K [zLPLP`e%0 % 5/oLk e %` 0` 5LoL e %` 0 h5`oPLP%0 H D% 45LnL$%$5 0 % 5LnLzLP{$0 $ 4nP厚LK yLPLP`o$0 $ |4nPwLwh$h4 0 \$ P4LnL@$@4 0 4$ ,4LnLttp0 3Ln300 3nLDyLP#0 # 3unP(Lix#0 p l# \3LdnLZL#0 D @# 03LUnLK # 3 0 #3 Jn00Lr0p 2 p8n0vo 2  pH&*nd`03/0L00e|r|b|0`p d2 `nT0 @D2 `nd`0`3/0L000  D btp<  $lxlE ="Pp%0D <"| Th@<@c|_@0X| <|l DXu$xp-0M Ѝ4 4  , 0 0cmЍ=p@-`PMMP' @*k U* 0 0 0{ڍЍpl l0 0 `  T02mڍЍpD D0 0 8  00%mhPQPp@-@M``P  QPЍp` `0 0 T  H0lЍp< <0 0 0  $0lЍp0T8QPA-PHM@`` pwP `@ l Qp0@ p]l0 @3/HЍ4 40 0 (  0lHЍ\.\X- MLP Ѝ, ,0 0  0l&0@-M00! t P  @Pؕ CЍ0( (0 0   0wlЍ0D$O-鸉sM/먘)9ɟ 0 ) ɟ  9,[l' 4,01SuD `890pN?M_4aHa4@aDaHa5q8 s;M@PJK81S 42S (8 0 ( 8hp@Pld 

l/"/"/"oD `}T 4|(xV4+"t ,"*"<  X)"(" |00l@p'" &"8H3 $T O-qMP` 㸔 0000p000`F0 @ 0 @ T 墕  Ꮤ  8 (Ѝ,D Q`P@-BAMG@(< "(#4v`P DP `Q ǑhP d03/LLL"L2  00}0SI 0SF " 2"2 00A1@qʠ+`p000` [GpP3 PᴑA|! 0W@6T+D!D1 0 8! ,1hAߍ!1 0 !1 h00000 0 0  0h 0 0  0h 0 0  0h$HDlT""FvĽpK8TdL s\6(=O-PPM09 \  R pN `,刓01 <01SO Ap@T AP,< 0 x, l 0 600< 0/dfdvdd6`p0<  0 86`f(1 6 {f!\P@08\@d@\0h@l@p@` ]m1pEᦏ%@ 0!廐`ᚐVhhh5 0 0L5Dfᄏ0% 0 圐p{W!5 004)f0;Dp8l3aHpLpPpTpXpm8^mߍB@><4 00h4f0;D`8l3aH`L`P`T`X`xm8=mP Q兒R倒 Rߍ300p3 e01#  #0 3e(0Sy# 01yiP$ |3 00d3e08@d@h@l@@]`\0-m8lF$3< 0 8  3 e 2 00 2e08`dhl\0l%"2 0 " 2eP0;DP8l3aHPLPPPTPXPl8l` ab4"42 0 (" 2_e2p00 1Ue!1 0 ! 1He!1 0 ! 1  b  \" 0 ᭃ$3 $ (0ȣ7p@-0P`M0P`0 0`X00@T l0`00 T0zXЍpD0`00@ (0mX$\ș!8 VO-BM M\(@ qo0(0 g T!1尠Аp ! œ $ pȁT T0 0LH H0 'X Bލ ЍD!@$( 0@-0@@塀!0p@-0MQ` TP T  0@ 0P 0P 0@x  p0W,3l0 N3/ЍpH H0 0 <  40W!xh!4p0,'C-`4MPpb@P*   $(,6W  0PP"P 0   PP}Tb p34Ѝ0 00 0 $  0W4Ѝ@!4O-AMMC?c  S  S@/? 0 /? eWo吏吟吿`p ,塯Q?0P(0E\ H? @O@\@ @,? =W( ,  ",3d03/P} _+W _^nĎP`"⊯zψ|P`1^n⬀xⴠ!DP8`P`<娐ŏƟ0Pt`儀刐ǯ2΍_oˏ3⌠P`圀堐N@0SA S S@ A21P ".0[Pj^ A΍"!00QnA "R3 X=XM0@0\ 8M@0S S Sv ^d^$33,03/l|1P`p  0<pPVoP% -~P  <0#x, ?{VX,X< 0 L,L< qVvYt!;(0"(D0]PH[#[P0S〠 S+0  00b[P xڬ;0 Q :;0C   0 $(4 ,|8<"|t(l"t#l,d8#d>aP0 V񏐔DC}_$W5  @~j0 48<,zL#,$8#D`p0@ pUT00 @wPD Ti T T TN 4:0 0 :p@U t a0S{IQ0 @ 003b9[P ڴ  Q :0h#WTWi0G`0  P R \)\9 0 P) D9U `4i`0S? $)$9 0 ) 9U `(8 0L( 8~U `e8 0d W]z0 0,}(8 0 (8 aUJdP?]b  XWK0G0  P R ,(,8 0 ( ;AU y`g PZ7 0 {7Ч0 0ǟW P0LpP,@p7p0  Wc ,An1R 3 LUAi U U U`@,7@0 1S > P(Q (pC̠<!̌Č8#Č,(,40 ,̠Q 0  QD,(4D( 4`` )  )&H) ))H(*)(+ %04<44( )$ (,& ,5 .  , h&d ,ĉT`l<"l%< $ 4 dX(%446(,P' ,70,#Ƞ( $.T.!d4.,-P""X.Ѕ"  1 /#l#00̠#"̌ Č2!4.\X3 إ# ((̠"P8(T0))`9P*d*X<:;=)>*+Ġ++A`BP,`HP? @DCEFG|($3    0P; <@?ABCDP(``@#<%$4 0 $P 4Rp`@r P 0 4 8<,#,$8#4 00  V$0  CWP 0P:0000# G @P1 $3 @@DG$ 0@ "P00+; 0 (+ =>P L[H;p00 0 P.d+d; 0 p+ ?O 6[~; 00C?pO0Ú; 0\    CdDtt20  `" U0pI00( 00 S0W $O? )000 0$! p@2V  ;r!1Z 0@@ ! @1 I$Ѝ10  !M0p I(00p\!\1 0 P! D1I8!8  0! 0F0p sI00!1 0  0fI    0p 0VI 0 0   U?IIL!upTmذ!atpl0!`tolsnksnkY@ntsGx 0 0   0{Gkȫ!DlfglԪ!ت!8!dkehdjhec@jdtcf|d8c|h@dbhcbLdcXbDH1O/05#@`b(!(1 0,! ?DdhLЍ 0 0,  0xD 0 0,  0kDdKL    0 0YD8!М!'h!T!W<_pXV_0X|V_W|!,VZWU XTWUd^$Wd^pUVP0@-M00QO_ 28P00 @P Ѝ0   0 |0Dp p0 0 d  \0DP P0 0 D  80C긙!YTU#T]U1TVLUP@-0M$Q1O  \  €0 @800 0Ѝ   0 0CdЍ@K   x 0 `0CЍT T0 0 H  80CЍ舘!WS|TETS8T:`SWT?P-0M Q)O/  R   0 0wCЍЍ   0 l0dCЍ\\0 0 H  <0TCЍ4!UDSTS]SRSRRVRW`0-0 MR Ѝ< <  4 0 0 ?,C!TP$R/8@-4P4@Pyl(0@0@@@n8\!^ 8@-P@gl00C08@n@-fl`P@Zl0jͅ0 S p R  R 0 Sn^MCPAl000npDn|A-@ol`xM $2$"0P P0`PdP4a:`p^8%E 0P 0  P  9 x! 0lPPX!0 l@Pލ441,!0-nA1@!0P!1 0Sln0@0@0 00 0@l@+smp+0p 0@`||0t 0&lh]Ч!DD(ZX\YY < `83i0dd0\ 0KLL0@ 0A!d!dc`c!QSQR8@-@PᛴP8T0P8 T0P8hlp@-MPዴ@P `^T0T 0P`D8 P0 0  0+ЍpdRPp 0C-H M0@3P00#=(S 3P c<P 2P 2P  P) `?S# `p@P P % l P "lP 4P 0`?pS P`k0<$BP Ʋ00 BP v00AP o00AP h00AP ^00AP ^00AP 0<2SI 3/p1  hAP 0<2SA 3/D1   '$' P 1Wc 0 1A ЍCk00S00S] 0P 0PT }RJEb =^ %4&t00SC ˨ukǨqkhPRt HSbbbdccPbgP 4 VF 200p% R& S$ KP #EP 助 Ư00 0㧯ㄯP2S쬛`P Qip᭨pPP7p4 R000 0S  %PH2 &PcL0Z 0S} @ %Ps$gcT ,bbcNc L$LL$KK_K8,IJ ILIq@-(qolP@M3gP00`` 0aKgP~iЍ QiP!0 0`f` V ill0Tp0` `K?h00<<04 0?Ji,g,F|H EpH EG 4040@- @ 03PH O-MBPPE (q(a(((̕p` @ 13/ 0  lR0! P[01 P 1 0 0  0[̅ 0<Ϡ[̅@f`hV ЍЍOC3DG3C-pM0@P`if0p`@ 0U 0S `V Uf 6/ЍPU If 5/ЍHH0@ 0Ѝ,0$ 0ChFWBFbE\p@-@MP#fLL0nP`< 0o 0P.ЍplBLEQO-M@4MeTK (h*gD#D3 0 8#83 03fe 0KZ0`$ 0CŸP `2S"/P? p Rb ˍ00 `bPe 00S||2t"0ld2S ۍ4ЍL"k0` RN R $$2 "0]P_POU M[aQ p+:0 00P ;00$ 0 j,P 0;Z0 ( 9P (1+0 0S 10 02Ss ˍ03/m9_`)_P 1_p,_`_P _P  0DE`EhEE,EA@D @ @TD DH?$C ()BO-0LMP(, S0S@s@R:(p0` *d0 b8"#4@ _ dXd+>L0"L0P -02fp@fTO- M`]pP) BT& 0堐0 0 Z \ \\@T ]P]  r0q][U   ЍDP?=O-`STM`pL R98@P@TPA 5 R@5 @ @TP@ R@&@P@TPA!R@@P@TPB_=@T04 @TPE]P l.]=SXU ']$],!]4]8[ ]0]< v]]@k\Pg\@c\_\[\/\ \D\\^=0pH?$L;Y[0 ,0QP $$3#0Ŀ TЍO!Y8 4PR <XQ @ UR PT  RQ DQP H LPR S t 0[` [P , [@ 4 [0 8 [  0 [ < [  [ @ [  [ [  [  [  [ [ D [p H [` L [0L  [ C[@P' b 0 ;vegO\@PP0 0TЍO 0" 0! 0! 0 0 0A>>>=7< D<rH<D<<<  <<<<<<<;;;;;;$59 4;( O-(`Pp\@[B[P[[T`, PU'  [  [ [dPP |dPPP ZZ440, 0P㙾o`:X:L:39n00@,[p0[4`~[4{[[TYMT`?SP lP`0S 0S <0`?P@SP\匿THT(0 ̠S =S 080<0\[$T[R[P[N[L[J[$0[S 0QS 0QS P Z`?S 8UVP YWM HZEZBZ?ZY2(Y2`Y2pYYU0n [Zk  QRf  QRa (QR\ WVY PW X  0XD X4 X$ X X X X X X( X X X 0 X$ XcXPP _ 0 [bU001(!0C1!0;1!03,6/07u xbbb525xj30$4-41dD4<444,4$4$4t411hlgd0`0X0<080,0$022222)1 )0 t)2 1O-霁$M00P >0 |0 `00L P*0D0 0 K  B+RSe@P/ xA$2 P (0PP1H!0 K040010A(!02 P   0  0 P2 P 00 000 -0ٺ0|x0p 0Ϻdd0\ 0Ǻ,cc$- $-`c4$X-9$P-#X-G#|-[^=0O-SM@ P <S ^\P`p߻PQ P0i s Xd50SP7L`<0 00<S6:S ,p\0 `l0<z 0H]4aPP ?]  bm:]ğ$4`pc p` `8LLğ$+HH4HH P4 p<` e  ğ +4f Pf͠p ` ۋ0؋̳ß# 3P p``h,g< ,⡆Pk0✆PU3blP+P`h,P4 $+PdX\+P 3P30S 3P 0C0S20SڌЍ <-P 20S2  Ѝ2 R 2x"0೹0<`" <-PBP2@@"0ࡹ82800/] B 2@6.0200!] `\0,pl0<z 0V\ 1h!0oD1  100x!]t1tt00d!]`1``00P!]L1LL00/]414400$!w] 1  00!n]<|$ 0l4|88tx|@)t :8)f)D)H)bdP(,#!%''!\(xO-l2MP`@ 0`H"0t03UPPU ЍEPP 0Sz rvUpU`UUUU UVZV XYS R[O PM  T0l T0X T0D T00 T0 TU@UTP`"  TU0@P  T T~T`P  ^`0 ^Ql 0  0)Ѝ a&0\ H"<"VX h\!O-M M@R@ ]HP+] ]@`0 G]P 0sP6[ b@P0 00  ݍ Ѝ0 0@0@ 00 0Px0`l 0\\0@P 0޷$$p####  #8@-PP @  }PP0 R  0<080(<0 0 0ଷ8X(#O-LLAMT $M) ^=@T1S Z2S ?  ?0S>P 0C0S <-ʸP >0S>0<嵸Ο 0  xN \-l>R@\N@TPP LiT=S`84aTp^T[TXT啻ETQT@ vMT JT=$᥻6T( AT,0S 00p)T 04Lk$T 08HfT@8T<6TWV0 YX ^\$$=-0dP=Sb =S 4BT voZ^pZ 04/P!00<,0 0̟\g`@ 0pp`tdhpl`Y> 0 Y]$▣PV 80S|8  Aݍ$Ѝ8vo_`P $,h H[ D[ @@  05( < P0 @`8`(0@T൵H80S @T 0h`@T BSP+SP  `@Ag P PBT @T7 0 ^X \To $(^\j ,0^\e 48^\` @<^\[ PY HQ DPH`LpPT@<`p P QQ PH2U*0瓹LR 0獹FRXP@||6t&0DP70P \ yQ0H sQ04 mQ0  gQ0  aQ0 [Q!R`Qp,RWX P  HQ CQR0pP  ;Qt 6QPP  dH%^0 $[:N5%0Ѵ4 R/3 90(4$03 R  0DPH`PT@Lp 0P P| Pl P\ PL P< P, P$ P ( P, P0 P4 P8 P@ P< P0 PfP@P X 0 ^ZIPP3H#0HA 3 00#oX+RZ2P/0&200"WXB2@"0200"FXB2@"0200p"5XlBl2@`"0T2T00D"$X +0WY0+z0R2P+.0׳100!Xx|:`"! 04"Dha!]l,,D@dPt$H\!  XL,(Hh\D8  HGtl h; (`KL xHK ,KxJ4|J p J0S =clS  d>P 0 , 08“\ 8~8.p P@0 @<5,Pl Pb PX PN PD P: P0 P' l%p0幰8 `QP= 4$0ৰ4$04$04$04$0pp4h$0|0dD$h0r8844$0kV? P P#5@PP ;R V3#0Q3ꔱT<n 30L0#3 0@PTX \0,@t`<`VE @TB (<Zhv Zc$0XN:JS 01#11S20$0KSK?$0; S 0H 0 00  0"0TX0<3   ,0PU 0!0 壍P 0 0X"0P0L2P   ,0Ut`P ~ 0 0"010\ίl2   0 001q.0໯$2   1 Ÿ  ?強 z,c|HHER@P 8R@Pg 2R@P @ލЍIIII lIP[ hIPW dIPS nIPO p0G # 0@QGP  0 &O RH0 @ \ P@@O0 @LO 0O2 0P GލЍT`P 0 0DO+>L0"L0P -02QQ1!0@~I`HPG QP 1 R  1 R  ލЍfl` Od1j0S 0S *RL RL0SPQލЍ0 08@70 0/@.0 0&@%0 00 0$ ,T Ȫ h ix d @D  ' 9 O-@@MMHptH )  P yHPtHoH`jHeH`HpHHP DHP @HP}  0 0 0 )PPP#  #PPP1  PPP>  PP 5 Rp||5t%0ө XGP $` D5P 4pލЍDGP 0$`  pލЍ1GP  $`@0J$<0O0#GP 00OP0D0 H22,"GPo ,EP DD 0@ )mM OH2 @2 0@H<_M @0LZM댰 $0TM (0@ OM 40sJM 3<0C@PA (tt3l#0Ip\\3T#0@p DD3<#07p,,3$#0.p3.0%p2"0p2"020" F  FF Fp F`$ FF YR@ 0WS [V P 4/E, *E %E   E E EE`EVPpw   EE`Pp  E DD@P @ 0NBXLL1D!0P$  `:\D|$$99l  !0! p`| dT  D   ` < 8 x ,,(  XD`T O-MmK뉩N XㆵT#  P  P Ѝ !( 0 C 0 2"002@N 0 @ $0RU20SS bP 2 PpMRPH  p`PL 0hRhbh2h"hr0 P`0  00p-00"P0p@ާp\ \CP  F 1ACP   'A ㍹PJh10S p0@d!0尧 \" #P ' $ #PolpJK00  0"PP M@ 0冧0@ L@ "3$#48#80t00h nyM 0Pmh}!lo(gLhLx Y g \4/p@-@C`~@P p$J6#3 0M~2PP vM@v J`0S d0S h0S l0Sb H”L\#  ^# 0H„LHRP%p% *p“P \ʠ3 Q32 \2ʠ#2 Q2#pƒP R02S?3257*0!o I@娨P7 P< PA @I-Lfl+>22I Llalllj- 0  00AHLpS>2(1((0<!J10E?!J10E? J00E? J000 J00< J00< JL#! (X ,g g$gD!!T pO0$L} ((0(M| N@-0 0L||0@-M,0>oP + KD  !ۍ@-@0@M 0JP + K`  ۍ(0 0&((p@-P@#00P# 08`P  SK=p000P HP}= L H0 PH000pp pP _8@-@|00P p 0@P =S <;PU 8$0P8 8 bp@-t@M`P@P XX0P 0`舥D0 @0匧Ѝpf 0@-@0M M@ 0PgP @+J` 0 GII!ۍ Ѝ0(0.0JT,n\O-@Bp<2BMMP@!$"03d Ph 2P4`KB- @  @@@@@@@@è@*J!0  p`HKHh10p宏H+^-BT D0@DS@ LDwHP @T oKT K T G 0  $KJ 0RB- @00 0ɤBݍЍ|0t 0࿤F0X0T0L 0ತT4l 0pO-A1@0lM|!啤t10PO h!hd1 0 0T I`_2H+-~B T$@ T! D0SL`DT LG  0  JsJ@T0S0@ 0XlЍJ | 0Lhh0` 0BP0H 0:  ! O-M@pU20P "0j`P =S 0|000l2Ah"@0 Q:HB i < =S8 0```!ہP @$P@  0pWp!@ Fp `@O``&d d0@X Ѝ ЍO  bccO-M`P@@+10PA !0@ P K }W8 `?S7 A<V(@P 0㠧P3Y``p0  PVڝEW Ѝ@PЍ 0xx0p 0@奢 W<<0 pp, 0p  N@5^O-$M00`0@pHP10PW !0Pa YN`?SMt1,B  ᣣP0O  0i pPU 5  0v $Ѝ0 0o 00$Ѝg$Ѝa 0@@08 0T x @Bʚ;w@- M@Pp`/ P 00D@P) =S`?S<QWR 囦V 喦" Ѝ 08800 0P̡  ܿQ0#3S /0@00S 3/ #1Ƞ4,< 0/p@-M P@U`7 pD0##R# `"!!U `5:20 R; `0VS! R c  Ѝp000t 0a0o 0X00  0M``0 P~ 0B<<0 09pxD0hO-M @ 0 TpO C@D$A@HHP p`( a8!"$#4,<`$"a4# X W0Wd"dDh#DgH`$H U ڰ0S 0 Q  R 0@  0P@@H`$H\p Ѝ,,0@ 0̠Ѝh@A-FMP@,.F0 #   #3#    ! DP`/0  p ČȌ̌ 0l,`( !"$,l!`$"4 #48#8f qDPhh0P 0xFߍHHH0 0D4440 0DPHdx(p@-0`M@P 0P4 N0Ese%  eT 0 E4F 0 Pb(00$ $$ Ѝp!F`8 #4<`T#HM8@-@P  P2$#$$0  $ b8"#40P `h4l4d$N`Td  Rb.0  e,0,&0&$5(5000l40@lDP0P(0V 8  0MA((,0 40ꨱq0qC-P|pᔪ@P l` 0`  2A 04,0 $0(0p8A'AR> 00050@0EpA-P|p`m@P L ?R> 0000ŕ,(p0`40@0EA-P0p`N@P D 0  @b> 000(p,`@0Fo@-PBpT` @T C PC$@P @ 0 @P2 0@B oC-M0pP00`  p0ොhDFT (0S(\ @TЍY \ 0  @X B0W B4Ѝ040402 nA-MP0p0`  0z,ER T (0S(\ @TЍX < 0  N@W B4Ѝ<pJ,mO-CM到,< @ $PA$C T$ x`p$P @` T @f 0@PCߍ@/ P0<@U00 ģ Pl$P Zh Ο (Ο 0Ο 8Ο TΟ dΟ X0-BP= 8(BP \00S `$ Z : @(BP LA,BP:}hDFn`TpP9P@PT3 e (0?P *A|,APd},ERn `TpPPw@PT e (0?Pj-  4?Pa<< 0,<`0 r??\0S@/ P` ,m?0 ]??U0Sh0$l0Rp0t0x0|000@P`h0 R , ,0 0;??U0Sf+P`@0 .??U0SY@d4P`S S SS ST x;0t+ ??U0SAP+A>P` 0@0P0 ??U0S0+P`@ >?U0S #,Pb0AP)hDF~pW6 @WP`.  (0 0   >?U0S M@,T AP0z,Fbn `TpPP@PT e (0>PI@  \5>P5s P` >PyPw|9< 0l)l9P0 >?\0S@/ `` )m?0 s>?V0Sh0$l0Rp0t0x0|000@``h0 R ( (0 0Q>?V0S|p(``@0 D>?V0So@(5``S Se So Sv 80 d \6)>P 7< 07`0X >?\0SD/ @` 'm?0 >?T0S1T'@`0  =?T0S#$'@`0  =?T0SP,$@PeP,Fb~ pT @TP`  (0 ,   =?U0S G. 4 $  H& =?U0SP` E 4 & =?U0S P0050| Cߍ50% =?V0S%``N>@0P0 ~=?V0S`%``@ r=?V0S 0,p`b?P,ER To ğ 4ğ @ğ\ Dğ` Hğ LH4F=D 0ϠV 00`pS p(08=H 0ϠZ 00 ``pSb(0*=L 0ϠV 00`pS T(0= $8 0᣿Z 00 ``pSD(0 =?V0Sp``:@T3 4 @? (0P4  ,  @  89!m 0 T9! x! 0 H9 8 H!0 <90! 00 59!  8d 8  8|PxYXh`XԶXP(D .XV8̲X`TLXTЛ0xdXH<,)QHQD`QPPO-Mp&;P hF X3 hFn`ZR P [L @ b8P000 S44 Q,`("G 4d0 P8(4`0G 0d 8,5R S 0 ,5 R^ P00U `@ )8P404 S U X @.0X(0!\h5d `Š80A n8S0  h84 (0 h%\5 80`ŠA \8S0 V8,E,La U` :P, \5R( 00%5$[P TP {:P0 40@%5 T`%$5`P@c%$5`V 7c\F`V 7\FЍ P0 7CT-  R@T%R^ P @,ꀘNMȪtq-xMdd@d`$@d `@@` `d0  dPdd`0/P@hs`*u'|'  0 P0 @ ,` peQ ` V%p ` k[%8 tP <0@ d@/ 0 P(<`PP% 0 < pkad f& ) kk& P Ƞ)`̌p >T`p $,p 00`@P "g  pf0 `,P *p0P,` p0 *)0P 0l) 8 Ā p,Dn$Dp0)4p0`hS800# `4`40U%gq(  v'\%$Pc{'(`( p PH8,0H`X-$P,P*( (@4P( (40`0 (P $``1ls&#u'0 |'e+"@@4`$L08pL\ 0,(,pP8 P "(p$ 4 $0P$p Pc0 (hg(`C | Pp0E$$L$@h  lh@,,P$p`,@ 0 eSiU%80@ `(pP 0 + `0p, P (8@\%g( |`pD!P44l@lp`;,@04$ 0@40 p `$@ 8`) b 84p#`(j(*8"Pg*,(p <`JT ,`0 "(@ )4`(@$(pP4Pp0@(`8% l8p'PF,c&fK$( ( @$@ Ċp)$ P,@(P(+8PT P$k4(@# P,Ƞ`+ P8* PgcTe& *0l&̌ ` ,P$@T(Tt,P P'P$ -* ,/ P .df)4,) f,X P X$ 0+0 03,1$0,b  ̉ b 502e,*( * \ \8\(0%p(0 kà),,,0 p(4 p(i1 6# i;#976, $ Ĉ`0,0ħ`p$080 +( @$, (is,u'|' @@ p j;0(,pj(:Lǟ0` p)@ pf p'P($=P(<0(p$P0   0?0d>,d, 4 v4tp pP & 0b3< !5#<#pp 0hQ!V%+!3h[%l9#D1#(P0 m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[l*hCᬡ*X `E$L$`e`P@  e PȠ, ,<@ XX (@`` i @**@ @àT f,, ` h\i&*e&@ a` \`a  \p 0@à `d,,@`)@` js@X`&u'|'xy' u'Dbap`pf&4pbk&`@b @0g *`  0p +  pcàp\,l,hdi&,+e&Hd, p (Pp` #0`  (` ( e  `kS``U%% 4PȠ,(,LgQV%g[% `4 `$,Si!P!+ PhàP0 ,, Ƞ(,),P  f( ,f (P쓠 Pl) ( ଑)$ *0 0 b 4! !0 * Te !$e!$88 8i @ 0"  0d(0#)) ꘠,0)*)X l1 6#,l;#,4 p<080k  $  0 g0$)** 먠*+*\a )8a)8 0T0`@ @ h '    f ,*(( 눠<(+(` c*1?  M7R#l##Ġ8 bx b t0p`  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#400000100#4000#0020 0#40 000S'0020$0#40$00 Ѝ̅@-M@`Pp I~ .Ѝ@RC-`$Mp@!h6@ .\@ .V  h0 !h PP#VP @ $Ѝh 6@ e.\@ a.Y @ ``@-P$M@p 4UP P@   #$Ѝ@-@h@ @@-M@Qp` 1  !.ЍO-dRM M00T3p00H3 00<3`0 003<@0J_03V#ƿCӋ0Wlc  o[" 0k 0 !  !?.PW0S 0`00  .a/-/s[.0S W+"2  "0 0 1!0  0 1_#[ 0CQeQe``W Pe20ES701!0!01 0!20U   f! -PP3WZ  .Z +Rލ Ѝf x.0ESJ? b- 00 12 !WP XPm.Rލ Ѝ`@CC/0PC0@-@MP@0 0&PU 0,#,$8#40T0#$40Ѝ00P0>#>CC/0@-ML#LD8#D,T0@ ą0 @ $Ѝ00P0#>CC/R # 3@-Q@@TP`pSU d0#P@ 0 sp U BU0@-$M P00 0 0@%PU  <"<4("$ T1#$40$Ѝ00PC@-@MP0c00P- M  0 48 Ѝ@- @ P P p PH P( P P P P P P h P H ~ P  `YDY,YYXXXXdXDX$XX8@-@0@S0 8PP0h00P\0\0 P  PP0PPPPPPPPPP8 ! / ! !-lPO FZT!vL1Lq ` dPNS| 0S ̲a a S v  1?cd@ Z% Q ڤ0 @ @D0J  S t0lP@2c#  0@0 /3c0Zsp.Q <pC-Pp !A1@ad0Ts1U:@Pc@4?c2cT a  001U*D0r03`  !1U:!`Pc`0S10`` =  b0 0P0VVD Ƞ,0R0`FQ,92C3p0 0h Ϡ@l`0`RvND"b @D0 A@0,Q p<S$IO-f@PDM` 0P,S$P(P,P0P4P8PC@ 0C 800,( ivPr P4m0 Sj 3 R 00` [ PX S pN :PK`F PA :P>9 3  P0+ & ! @0 R 00 B0K00d00J/2"0I 00@Gp)"0H00`F0E0L0PGH$. S#0Ay.B B$8 ,@($00 @ IP1p0P0 `00 0-S+ P40-S00 0 P   :P   :P     Q P0L 00C<#0pGS80d00`F80 @0b"0C0PD 0Q!0 0J0 K0I0Hⓢ"#@ , (0n{ 00*PTQPM8@-pPQ@P `0X00 R:R@1400,0800$!!!!0@-;S30;S00S- F0BS)0 S&S 0CS  3 0S0CS@ 0xv. 1?cd@ R   R 0 S3c0R s R 0 SQ0P/!C-0䀟0`̐ @PUT:00`Tp/0@W%ᣁ00m `p`Vp/0!400 `pH!H!" @-@PM 0# PЍ@-@Tt0(lP 0  T:TR0(00 C-0`0M` pp@PUT:a@TPP 5#@PD X/0!40 p0T T (  h1C-0M H10 @PUT&:Y /0du'100 X 0/du'ـ000 0 0@ЍC  0`A/0`㤀`00 /0㙀0 X P F0PЍp000L22QPp@-PM@0 0 Ѝpl0l`d0T0 `@@ 0  @RP00Ѝp@ P 0@-0@lP 0  \TR0(00$ 0 @-M@ [P0>0YPЍ@-@KPN-M0 $ 0 0$#! 0 RAd20 $0000  R$$" cPpBN0c  b! # c,`,c  !` "00 S X4匁qDDTLa 0 p0@ @P ĠȌ, ̌UA2  @ P ğSi喑TePeOɣd j@ jϠ˳l kkNQ ɓ`HX傮 ii  XT% P%\% 0 S P ލ/$ X  p 0@-@M@dP0  0T  Ѝ0F/?P/F 0S /C-SP0`S@& T  T& T 00  000P"0 A q@ R Rn R RE 00000b0"` 耈`FP!p!L! P)P%X%@ \%T% @% $,p$@, P(@P t p p@%P L$D$H$ $, 0@4<8 0SDQDP਀PE @"p""h@)``@$ H$L$D$ $, @ 0SppȀpG `"P"L" `)`&h&P@ l&d& P&@% $, `P @$, (0S@ ( d 4 p O-IM@`P0 0&P@ 2 "00K 00Y0 0 J0% p` 0 "T@P""(P  AQ!nD$e\$b(% 0SY`pG k0B 000000 0 0Iߍ | -0 p@P 0  `Hp0MɐD 0 @ |` @ 0  @D < (PT@ ` p' 0#PX @A"' @A ,k,#Pd,@Q  &LAP%#&#401iT%''xd p"D"(q !a\%c  0 &h@gX% A`b a# i!!k,dL)fH$q` a %,! `&bd&,$,!0 p'$$H @ 1at'( A0#$@ @@Ta4#@,%D,Ƞ@ i|'A   ll& "(%XPi$,Q$k<#d,"lh&ex'a8#`(" x  ~#@@SP@ A#(##40@1&D'@A 0*̠0 '̠'x ,@ @p!)&<&ap  "'4 0 ('Ƞq 1 Aj" a( "(Ph, !g,c,e h!,P d!@ p@i*k*e f P `Pp@`0`0$`, l 00` d`@ `0! `0( `$),XPp',*D P&*!l*! @@ <# ) \% 4#8#T%|' %#(#L` @!$!H t' @@') x l#Tp` P`Pp ),,,!,0  P ` p 0Ѝ/ L \ -0P@ 0 X pT@P 00M`ɐ p@ L0  | P0C '`S 0 @$ (`T0 `Qa! "`aP%iT% f\% `$ pq,#lap'$#$D@Af,!d!ht'`|'"d,@ "(#8`a, a 01$!@ h AiX%fl(b('ch&01@"Lq,D0#@g4#&tp&LAq!%d!$p@&h@ , `a`D$""( ` ` qi<#h!%,,Ƞ%X!`V P ` a P(b$%$PgL$ pe,"g8#f!lH$`(" z0~3H⃒c`$0 ̠""1pP$$D@pQ(A # 0("( ' $P ,@'T @q PQ Ƞ+"D"( @  P AQ` $`g pb! & (`g!,pb4#f,! `k,d,g  e P i!Pf<#h8#p`@`pP@P@ @ # ,! P&@+` , &( !l,x #Ġ!#80p p  0 \% L$ D$(<*$ 4#8#`!L @#H T%@@%(!(( l x!T #$ p` P `Pp,,,#, 0 P ` p 0Ѝ/ P Q gG-M`0p4P7QR  ?  0 00" 0\  .XpPЍR @ 00"0@T 0   XpP!@-0S 3/@- 0S 3/G- M(@Rp`pj,P0 W 0j \  pP0 P0 `' @@`X@1` \00@S\0 Ѝ! \P0Q 0ACC CSt0d00?X&@ P@@ @@PE 0R0BCCC S P?U@0H ?0@0 ?  t\ Ѝ P G-@!? 08S`p<? b \P 0R0BCCCS 8   0S @CDD DT0TpXH0@ 0"̠"" CCCCS7 b \P @R@G-\MPX`.@\p$6@$p@ ^@\ \ 60 0@\@ @ `  @ y u sЍPX`0@-@P0 Q l 00P  ( Ƞ R LB`@/@/8@-00 C Q0A CR70Ca CR4W0C 20B@ T0 ABQ7 B0aBQ$W B020A@ T0  0 C@ T A CR70C a CRW0C @/A AR7Aa ARWA@/,0@-0(03/@P ( Hp@-`,,000@3/PP  U p8@-P@P ( J 0, 0008O-PP Md @Tf p`@T P`T@``TL1003/pP 8"0@\`f rtn00S "SS \S 00@S" 0  Ѝ` U R  R R@ R  @"R \R R@ @@b00@@ ЍOo4 8O-0M"SpP` 0S"S \S0S"S2003/@P 2异0 0["[00 \[  b0@SSMQPOEMLKJIHG8EDC/A( 00@"S0 0Ѝ 7;@PSp56;@S40\S0uS  7;@S?  00 000010 ЍP 0  @ pp@0P0?≜ᩜ'sAA;#6 {xl0W 0? 'sII? 0'sX  O-`P$Mpw 0S}Y, PP@Y@ 03/P 03/PL  ]  Y0W000[w 0W @ @``P j  0PY00 j P g 0@`T0@SPJ wP`p0`S 03/0PS 03/VF@03/03/$ЍO$ЍOx$ЍOlp0 l H6QWnP` ,&,6PnPY  6NnPR 6003/P  8}$ЍOY PP@Y5003/0P0f  Z 0`C0  W00Z``  PeP`0PS 03/U4003/74@003/P/   0k t4AQmP x$x4mP l 0  L$L4mP 44mP5 ( 0  $ЍR4003/P W{00p 0S 000 pAp S} 0 03003/P p  ` 0  p@3003/ 3003/P  `[  ^ + U0 W,  00 03/X 2/]  X2003/P W{0 0  000 A@ P  `@ P0WG 0S 0E`S0P :  `  R,0 0PPW  P 03/03/0X03/03/W 0Sp 00Y}00" :0z0Ch(<A(dDDcLư>eAlX`0<0/ဿ P  0S 0dS T  0/H0@00040(0$0 0 /A-@Pp`p` 0P  P 0 P 03/ P 03/03/U@d`\O- M-Z 2 0Z10JS@P`@P h2j@0JPj 0i0`0 C R@P.Z`p; ߠ EZk +Rd -R 0 B0 S0d100 A Qzj 0i`p 0j 0@PH5 0jk0 0 Ѝ00J S`p`p 0j@0JPHj 0i 0@Pi00 C R`pl0  m  0oi`p 0 fi`p?$@@-@QP  > P6  7 P,  0 P, 0"S 0C-S P,[S {S$0` 0 0S% SF@ @R R`T` }R 0 00 0040@@Pp 0 AQ0S  l P 00CS 00AQS 0 00:S 00CS 0 0 BRSo@P 0 CR 0 CQ@R @,P,S`P  `p 00CS 00AQS   P 00CS 00AQS 0P 00:S 00CS 0 0 BRS@P 0 CR  0 CQ@R{p0` 0 0S S @ @R R_`T`0]S) Pp\ 0S  BR0@PM 0BS 0 0BQ@S? p,R5PP8 Pp 00CS 0 0 BRS@P" 0 CR0 0BQ@S|00 }S`00 0]R @00@ (00@, ص t @-p@P0 0 `P( T 00CS 00L\S@\@P W0 @R0 R @S0SU @f 00@_, `    P@- 0003/0S 0S//PQ/APQ/8@-@PT@T P8Q /R/ 0S /p@-@RP`p P $  03/  p@@-@'@8@-@P 8@ RQ00ASQS Q\S   /@-@@-@pT` P@PT bP@@-@@-\Q 00ASQS Q@  S    @/A-@T`pP@PT )P P (0003/ A@-P0 0@-zP0 0@-tP0 0@-@mP@@ @p@-@Pc`P 0A 0hp8@-PU@P 0 0]8@-JP0 0@-DP0 0A-p`PW P`F@gT@PWPA-p`PW P`F@ gT@PWPA-p`PW P`F@T@PWPA-p`PW P`F@T@PWPP/ 0Ps/P/ 0Ps/P/ 0Ps/@-@P`3 pP0 !P ! PP P PP  V @T `VP@`PT` PP0 S S S S /S "S 00S0/ /R. *R0R 0 /R  R0 *R00S"S  \S 0000"SS  00 0  SS 0- CRMЍ4 4  , 0 >0 D`QQP@-@MP; 0S ! a90S  Y9!0S  N9 0S  F90S  >9Ѝp`` ```T` 0 ,9H H0 0 <  00Ѝ|th|h(pZ0A-SMPZ !1 0 ! 1pWF  0S" @`0 T`* d 03/P@8A8!81 0,! 1sЍV:@P# 0S 0b@Ѝ@@ 0 0  0D@t t0 0 h  `0p7oP@j@,H-\D#PT\60-S: R-PP%`20p @A@DT0@C T-@C_ST~S S @#2`00@S 00/@00S \@00/`p@@zO-ğM M$p@ro ,0 @< S\#P;` 0P; N?G 74 x#P?]P 0 H`FBA 6 4ß(<0  @@@ # 0 0 F@F`R0HP$0 T_M@+"A 0 XŸ`Rh0  ````````i2 0 p⤠ d `Ȑ0 !0`0 ```````{pGp `0 ``!}p` ``` `0````pI !``p`` ` 0` ` `` 0````````:$H ` %@HH0,p _Tpݍ Ѝll_}XpP|jAWS4 zyO-QPM,M@PP` %5 0 % 0܍,Ѝ|%{0 7hhh50  00@<kPPA (epP _0P3]P 0<000000HP0E Q  &R$4 0,$ 4^|$|4 06h$0 6܍,ЍH<(0 PC(˄3̄ $@ h, J ,v. 3̝ ,,0 1  # @ ̍#0 x6x#̍(Pl#0  X#ύ<0 0 (00(#(3p 0  p$A 0$p RŸD0(@  P PPPPPPPPP"@000@ e|"0 ,6h"0 &6܍,Ѝ誏hP@ (2R( v " J0 @ 5 A ! 0  0D(PE(ppp 3=`0G , D!PP0   ! 1 05 !0 5 0 5 ; 5܍,Ѝ000 0M( 0Hw`ZhX0<0H, @s@s (tO-t4M@PP,@p x$x4 0,l$ d4 \4\dp`_1S 1@S P TC $ 4 0 $ 34Ѝ3C/04# !,  $` d`P% , |3` @ [K\C? PQQQ,43 00 34Ѝ,Y$` ,0CŸ Pr !,020 0吲P  O|"|2 0h"_? tT20 P UCo) !R T 1X1R1S P1 0 0 1P `@L ,\,G4Ѝ|!|1 0 p! O?1 4ЍL!L1 0 @! 81"8,!,1 0 !1 0]?,% 0 0  00C00 ,Lꐲ,L14 $C DS ([l H̘ H@-TDb @-|0| 0pPh@@n`1S 1S P COTd`P4 QP@-@ 0P !@OO-SQPM@`P h3TXp@ PXDPY 80 CkS0D0H0L0P0T0?#>0c0h0S0 [P\ w,P 0(b@ ,0.>t,0l"`  P0L2@` P5@ l@,0 @0` 0 02# Ѝ!챟  s RDP+PT %!cP$D)PR UP|!|1 0 $l!l1 D PL D ,! h $ !K:  !  0 0 0  00 0  0 0 0 0 TPbdt8Xp N,_P` @ (X](O-܂lMQPP@pp`w 2Q(@ V(/ "2 0 x" l2e,p Y$p@Ds $0@@=((" $0"0`2  E$00lЍ1q`p0S)hD0 DbP$(PS yP!1 0 x!x1 $!XT $8a`!1 0 ! 1 K:  0 0 0 @ @  0 0 0 0 @dYxfX lK[I Й 0\%  *,jdZBO-0M@PT0 T_PPTqP `#P44^|pp88 †,:<@吠唐嘀 0`TFP]   0 Pb4P UT3P@ 2X`0 0=D0=H0 T|!|1 0 p! d1 `T<H!H1 04!4  ,! P 1 Ѝ!1 0  0 0 0,  0 0 0 0 l 0 0 ? @0̱Hpux<otO-MP`,p@BH[00Z0SoWVl D2STf Xd :P [ [ [ [P>  -! p 0  :! 0p    1 p0`0D"0Pd@Z:`P1H!H1 0sKߍPPtğ4 p0 04` $|P[4$0 0h4P P$X4T0 0<4 D4lP U*}* S `P LXo308<Uß4 (ß ,ßp 08$PU\ژß Uß}* p* 0&,p0( T3 P T/R 0 p0@ 8@p0P RrPp0 2p20@p O> Kߍ"2 0 " `  I>@Bh208T"T2 0pID" <244Pp  "(`XaH $DPL@  @ @@X  1 [  0 W$(` x1$00 `1t\1$0@ O>i01$00`  1^@ 0 0  0L!Pp8<xpH \'h0xLd.<0`0LLp\O-Ѝ8 80 0 ,  $0Ѝ0dб(L@-MPP4A4a@0q01 0`p 0 1p00CSЍ 0 0,  ~?{Ѝ000 0pplW0P00pQ0P   0 h0Y`0 p D0NTl ĮHLhHk `0@-MV@P$-PP0P   0 0!Ѝ0x x0 0 l P \0Ѝ0P P0 0D  80Ѝ01԰|Ȭl,p@- AM⑕@Qa1 0P` 0 s?`00CSЍp000 0`l0P00p0P x x  p 0 X0P0` 40i $ خ(i t0@-@PM 00 "PP0S RЍ0Ѝ0, ,0 0  0dh `| O-QP\MpPP L@P 0S K[;0@P 0; pPTm`Pf 0S@  @}S 0 S {SP1 0S PtP3TPUGP 0 @0>@ \ ( @ 2P< PU :ʟ0 $0(:ʟ0 ,0<:ʟ0 `004CO ` pdP000D0`V(@0< 0+0 0 b ^PP $P 0S 00D(P p,PD <P000D04P 0D 0DP ,P00DD rPD pP000DcP paPDUPl PPt pNPD hG0PIT(L 88D` p`DL  0 p 3VQ4V  RD'V V!0D`0DTP1@ Tڬ'7 0' 76n70:\ЍD\  W[ `pDP 0PQ Pp0 0DP\ 000 0DP P&6 0 &6 `@[60 0Pp6l60g\ЍT&T6 0 D& <6V\ЍD`   0 0DpP, zP P. \8`D `    P Y dP`%`5 0 T%T5 `HEH50P P \Ѝ$4 0 $  4 @h402`\ 0S D@@ pPY |$|4@ 0 l$ `4G@T$T4 0 H$ @4`:8D4$44 0 ($(4 `.C$4 0 $4 `"C#3 0 # >``C#3 0 #  3`,Cw#3 0 #3 `Bk00&6 06vP#P3 0 <#<3 #3 0 # 2P@="2 0 " 2`@08`D"2 0 " 2~SO"2 0 "2 `A`hBd"d2 0 X"  P2`TA@"@2 0 4" ,2` A"2 0 "2 `x@!1 0 !1 `l@g x 0L+DDp ,ȫ 5h\LH`T b x4̼T(  la \̧ X( ` Ⱥ$ _ P_ @( h ع43 & xР@z dh  X4 $ T<  hh Ğ 4ܣ \ жH, 10@-00|M@PS_  {P*0`!e S01$TD T S 0!  R;S91 0 8P P# 00 R 0S 0 0 |Ѝ0U T T 0S  RS 0 0 Rt0 0 `0 0 |Ѝ0H0 0 <0 0 Y \Y ,Y Y X X tX XX @X $X X 00@-M@PUkz0PЍ0@^l l  d 0 L0XЍ0@ @0 0,4  (0KЍ0W xLܙ1t+P8@-P% @@11S U 0Sd0 0 X@@'zP 8<0 8@8@ 8V V V P@-M Ѝ0@0 @R1  z0P6S 3/Ѝ8 8  0 0 0 V V $C-@PM Q (RPX1`P/ " 2 0" 1QЍ`/P`!kpP?@Ѝ!1 0 !P >ЍpP5   ` P&6 06v 0 0   0| 0 0  0n 0 0  0`x x0 0 l  d0RXU . plS Lț<D x 8 ؗĕc 8@-P@P' P PQ{  /w @"0\X `01!R0PP8G88R O-į<Ѝ>刞00 0P.n P5 T.T> 0 H. <>8.8> 0 ,N,.@ >P  90 6<ЍX-= 0 - =k-= /PC w0P: R RNh-h= 0 \- T=KL= 0 @<-S4-4=  0  - =6-= 0 - <*v,< 0,,< k,< 0 ,  <|,< 0L,> U :0*m, 0 t, 㽠P p T2$  6 HD1 S CP2SD &6 0 & |60otUyP X&X6 0 L&  P <6R(&(6 0 & 6 L & 6 0 &  5j5$00  56 \ "R0 5$0 0 @ 5#ꈥ 0zPp501[t"R "R "R %R 5S $%$5 0 % 5彿 bP]P WPgPd  b f ]aW \hg V[D!0Rp284011S 4Pf ğ4 0 03g$4,( 4V{40,0$ 3 PY -\hP t3 0 0 $ >> v{D1S4ß p2S d兿$ $0"#Z *00P  1!0Rp2<^Q ILQ ԙ8DSP P ̫xВd P  $И(^O XYL,Tv d$!̼*ȐklDX8$LM B ܎B ? XH> H : ؉V vؘ|,̇@@[T|@@{HP APr;P @@{  r 11S0p2m?Y 100$ <1 JOL!L1 0 X!  `1Q ;t40 $ 1DP3D1S!  wP?[!1 0 ! 1ؽS*d\ 0,",2 0 8" D2*L"L  T"0  t2屽8@-(@P@*OP/8< 8@-8@8@ PhP8d< p@-@PP& 00`P \ 0S0@ R @ T(0L00p@40A0p@@QO@< ; ; t; 001P/QP; /,; p@-M@0SE TW PQPQPN  O  AQa1@NO/0 P`  0 0`0 @P 000`@ 0Ѝpۏpp 00@t: : |ؔ|9 p@-0@SP@ Q |`p! A !  Kc R00d0P@o ">@9 8 RPA-`MPpr v@P{ v  mW! @ "dc d]uPP|a`00CS'PU Ѝ8!81 0,,! =>lЍ ! 1 0,! 0^Ѝp䀟0p0 00Ol60P00p00P   0 08p0  T0+ 8 l,zt yy0|7 |ؑ`yt|A-0`pM" 0`pP  0 i?@p =  UPPP0PЍh0 p n?Ѝ<000p  0׻Ѝx@5 @xT3A-0 @MT# @P0P P* @0P; "S- "  "0 ?㥻Ѝ㿃0P "Ÿ  " 0 2咻Ѝ"2 0 x" p2冻Ѝd"d2 0X" L2y&0PsƑPP<(B(b@$r$21!0`p 0 2pa11SUX@100 1pR8 60P 0 p 1B!1 0! t16Ѝh!h1 0,\! P1)H!H  @! 0 (1 1 0P 0 p 0 8 0P{ 0 p 0p5 4 whzTv-$4v; `vB3 v,ajmxTu!( u]xxt'useO-NM,MD@@ ` A TI \E Ȱ  PW ,PP pP ύ 0 *8#$ P,  `R>0P : "J>  ZP6 "2 0 " 2m "2 0 " 2aP W U iNݍ,ЍP"P2 0 D"  (0  ,00 v   00 N͍(   0 !0@ Q?0l1$h00p0  0P%  xEߍ@0`00 ,0Eߍ`ed|rl|" Dr|qq@-M@% P x00@ 10PЍL L  D 0 ,0϶ЍЍ@! nh}c@-M@@`60P0SS 0;S00Ѝ0SI 1 0 Ѝl!l  d! 0 L1嘶Ѝ@Q@a@1@P`00 `@1凶0 1 `}~@P00Q p~0P S 0 ` 0bԛP 0`00 t0Vl000`p P0K pybbtytpp lllhl<0-0 MR  Ѝ 0y.0 p  0  P  0  , 0   00o  ~ 00q v 0@-P@M@Pi< <0 0,0  (0PݵЍ0@c $w4n_ C-M` P$ @@ ?PP$ v将6p00P6 ẵ6U ?U t60  R ?U  Ѝ4640PpPb jP\ dPV 50D1S 60S E@D1SPE @Q_`BlPPD1S|=pE @_0X2? '8)CC[nPP/;5 0P $ğ  $ 0 f>8j@;$4 0$ 4'Ѝ@1{.xp$p4 0,d$ X4lP400 @4 @`P^ 400 4TP Pd!@#3 0# 3޴7300 3Դ30< 0P& lß0  P3´HC@P 0SPP C@P~j> Pr  mnL c[0P "  "0 |2兴t"t2 0,h" c>yPrpGqP $"$2 0 " 2`gP  q "W 2 Gw X"0p t0@P Ad!d1 0 X! @  H1,^@/,!,1 0 ! 1t_PwmN h mm   t m mtm]Du\]u$l]tl\XPkTktkhksk[0j4 jjj jixrZ&Lrg`Zxiq|iY8qh,YHpgX0@-MP P) !1 2!@0R@Ѝ0!1 0 !1 ṳf0S' P;PA 10   R Õ@Ѝ0@`A`!@\1 0 L!L1 02S00 Ѝ0@u1>101Q Q,  @0P   0 0q00< Q0S   0 t0Y@ <0   phg`Wq q \pfV[ VoDV a`oU@-P@M@嵷@強4 40 0(  0'Ѝ @n8eU& 00D/d O-RQ MP`0pW WU `4Y4a!@PM a/4G,4 ; 1 O/xZ 0S%0\180S8;xx1_/ PP 000@ 0av`P Ѝ t0 04' Ѝ W I_? 4004W Ѝ  d   G-2RbBM0P` 0@p `2噲YV᝾P `"2 T2 `㈲@"D1 42` ~2S+ @T4RPDaV/X+Wo`oPp !1 0 ! 1` p\ &pB10D ЍG7D1S p10pPЍX! P10pЍXW 8P 1 00>` p(  pB{O@P 0 0  0@ p  px0`00p d0@c Sjt (cc ibQ@   a|haP"`@-PPMD @@`V`P!0SSpp*0CS@@yPPЍ 0 0 P @ 0弱Ѝ 0 0 ` 0孱Ѝ   x 0 d0垱X X0 0 L  D0咱f`lOif\0OT@`lfN\@f_NJp@-@PM" ``yPP 0 0 00 0kЍpt t0 0 h P X0\ЍpH H0 0 <  40OM_(NHMd_M M^M00/ RPG-PM@`` prpp2p0 0T2$H2 0082(2 002@WyP@! 0S S R  Rqȁ1a0p 01`= PH0S x`p! A  Y 0S)(1 0 }Ѝ a q 1`0p 00p㼰 0  uP 000p 0婰 @ q000 l0喰 ,Mpe^^x^ XLd^ | ( KcH] K@_? }@@@@ X18"!x 0 0:P4 200p  6=_? 0  3/!ctH1 04'0Ѝ Wh7P |!|1 0 l!\1 0 X1P10 p8101p0 01߯q@p`ΰT `Ȱ@  @$@(@,@W  5P 0 0  >㸯 0 0 x  p0嬯b[In a[Ix LX[ ``ZHHv Z Z L|_Z\Gl_Y,G @-0`M0`P`01P@ 0x0} qW 0P_?} Ѝ@40` 0cdY]F: Y= 0S/|O- QMP@`p@D?d80bSb0À1<,100 cR>!aQ20   0 `P0 0S   0  4 7P 2 ("2 0 " 2Nbr`p_8J2 00x2p7h20 0T2p-H20 0=p#$2p0081 02<* 1<@ 1p00<1 00 01=XC100S 3/x0 l1p 0S< L107S7 3/40!0  (!01 ` έ=1S<L5` 0 0L  0巭007S 3/Vt\@Cnl4VUZhUALAZ(U UTTTTPTx SX?XdNX?G-MP @@!q8PP0S7 8E@EP up>P 7P 1P +P Vn`P V/g p    DP 0 $4 0 $ 3CS@P*ß 38  3 003P 3 003P x3 00h3Pp X3P0081 0<3 ݬ4<3 0P0<1 0 2ɬ200 S 3/0 2P  㲬0S 207S 3/t2t0X d"d2 0 X" P2㕬D"D2 0 8" ,2剬 2 0X i"2 0 " ==vЍA@X VP !1 0X ! 1_a1!q`0 pP01`PN X82l1X'0 0` L1?D!D1 0 8! >4$!$1 0 ! <)0`jQT@PPUP<|<\UTQHQO"|O*|mSP:8\SDO:ISOT:RF9|R N9H`F>RML9QL> 900a|00fhC-@PDM? 0S< pPM P`:PPPPPP P$P(P,P0P4P8P0':MJ4tM0J44M0J@4LI 4IL3>|L3LLHIX3C-MPjPP g5@Pz0$S @ OP/ JP  Y> PEEEA6ᅷc尃3`00P 3pWW| %P @P  PPcD@P 0c03`0(S`00P 03052`00 2$+ЍB@` P "2 0` " 2 br2`0p0x2@ pd20QʎHBH20p<$ OD@@@@2` P 1`'0 0p 1ѩ!1 0 ! 1ƩQPZ^P!,!1 0,t! <㪩_\100p P <1垩z4!41 0 (! 1哩<!1 0 ! 1利b 0 0  0}2|HpH1K$HH GDKGL1GdJ=00dJy*$F`<IE/IdE(/DHE.HPE.dHDp.00/00/00D pƒ8@-,@P@O@x8P@- @ @7S 73/8@-P@^P d0  " ! Q#4"6#;#24#5#1#3#6#118Fy7@-@p@PgPAT 0`@T P(PPD@-h0@00`p3/PP  g000$ @-@P000A-S @pT `@T PPcPDP @@G-pc@PxgP'AT$ `0S @PV6PX 0SPT `g(0003/00C0 D @-@P 0003/0003/  A-pP6 00R#P/S/ 0 3/PP" @0@ 0@ @@@@@@@@@@2/P`  p000  l P/BO-q$Mw 0@  Wi0 S3  R5 S g 00R0 @P`T@ R  Z# `\ 0 R8!81@ 0(! 1宧$ЍR 000 S. $Ѝ k\Q P$ЍH0 01R `p W 0 S  R S g00PH00$ЍWFtFQ  vT ᴬ0@-MP@> l 0  00 @P Ѝ0p p0 0 d 0 2 ѫ@ @0 04 0 # 'C EDCDPDO-@,MPP.1吱001刡0 01 0 p$0 q`PJp9 p ٫,!,  $!P ` 1,ЍP `p 0զ 㵮pW崫n 0 0, +>  00$0ph \0㳦d㓮㔫CCTTDxDD0THCS(DBO-SM@p< 1@0 0000000P"  S`V * !w3pWP PPP!@TЍ0000 0fP  Ы`? AQXC@-M\@p` 0 0 lVPP P` 021  1PQЍ0 0D D0 0@\0 [? ЍQB@vPA @p@-M P0`P@ 0 0  00T1Ѝp 0P@ t P0T1ЍpL L0 0@  40ѥ0T1Ѝp|OA?kNA?rG-@PM`L PPQZEpWT&T1S"( 0` !0>P 0T1ЍU! `01P ` 0)P  0 0 p 0~Ѝl ` 0PTqD D0 0 8  0e@xN@= hN?P=QPC-@M``pP S R <P00pPr # 3 0`# 31@@@/+pP@ 00:$/00`V< 帒2p0 p 02@ PIp2000 0T2/@PpDD 4"42 0(" 2 @Ѝ:`V!1 0 ! 1פ/pP "@ `!1 0 ! 1p100` ?㴤T!T1 0 H! ?㧤 (A(Q(1@P0 01Pᗤ100P 0厤@P0@P0 00P000P ?v?L?<#<LL(??p?MK>l;ihK>;OK=:'=J=X:4:J<~<98JH<w4<O-UQPLM@ppP YYPB Y/R RP` Z p P**80@P8P `P L5<@ 0 00@Pn4ZJzu J0S0 édğ4X 0%X` 0> P@`$ 4$Px4`000 0{?ڣP@P @$@4 0 < 0 0@ 0OP:bß3<@# 0`Tp@3 a P㭣 < w00 LЍ4P #3 0t# e?㔣 0SP#P3 0 D# 83兣ᵩ,#,3X 0%X<# w?v`P P0`1 P 0 1ᡮ0 0LЍ"2 0 "2 X@0PS2@02`P P`q P 0 1 LЍ`P`5`P P` P m0 1i0 0AQ1@P0 0?P100P 1l!1 0 ! 1`P P`q P 90 15RH!H1 0  00$Ѝ萆lꈆi q0 S*h  qL  q0  q  q 0 S*  q  q  q { q0 S*`  q{D  qs(  qk  0@T1Z dp 䤟䔟`$H 0  p Ap> 0 S2*\ i q2@ a  a' VT4P0  ?Ġ30 3 Ạ00$Ѝ q0 S* / q| ' q`  qD  q0 S*   q  q  q  q@0 S*  qp  qT1  q8 $"$2 0 " 2; q xqp9qp6!  ! 0 1! 0  110 |1  00z`!`1 0 T!00 ?k(5 /.5a66h58XT-3."-5- 23@3 433 2P2\|*)00*00t00/H/T$(h.(%d/PD-'8($.fl'.H','C-2r倂M0p@P0 T2嗟UT``@ 0S=aaG8 0\aS? S Pa a葟  ԁ100 1 01g q ``0VL00CS$ 0 ЍL!L1 0 @! ;FЍ P0S 100 05 0S ` 0P 000 0 000S 000 A> d000 L0x-8&%$ %-u$@,$, ,x++zO-@PDM< 0S S R,+,; 0 + I?ڞ* Z a p p 0)P 1 !0 0 a[K P+ PU|J|j|:@`0 0d:`娞\: 00L:`៞@ʟ0 0`  :唞 DЍ [   DЍY9Pp0q 09z9 009`p/mPQPpaU |eP PYP U 8SP + PFP U  xp$PP  (Q}PPf UPQ0 S PC 0 S `(`8 0 $0LL(L8 08p(, 00 I0P8qPP @1S  '7 0 '7 0@1PN P~ PvEP R/4P54 0 H10 5_0@1z P{8`0 Se50`U`01P 0h5?P!0R0, L1< R<G/ S0T1DЍ%5 0 %5 $0@19 P$4 0p q $ 4@qLqW04 00`40@!0CR\q0 00h$h4 0 \$ P4@D$D4 0 8$ ,4ޜ84400 3Ϝ@샟30 0 3応300 3嵜@34 0 0  3婜@p#p3 0,d#d3 8圜IT#T3 0 H# <3吜00(c((3 `0  0G>8{200 P2q"2 0 " 2e"2 0,"2 8Z"  "0 R>L`"`2 0 T" H2?00L10"02 0 $"  2/"2 0 " 1$!1 0 !1 "p+(#H+t"$"*N*O*Q!<2*)t(H *))$&)/)\X)**%%|(((((?t(<,|&HD,8%'Ahd&h++%4L&:d%"d%#%3*#,g*#*`#X#q)"P)#$|!H)!)!x, L(#p@-@PMP`* 0C\̠  \0S 0 0ЍpP Ѝpd d  \ 0 D0q8 80 0 ,  $0e!x&H&p!PQPp@-@M`P0 R. 0 CR"  R0S PЍp`0 JЍp@P Ѝph h  ` 0 H0"< <0 0 0  $0 4H4 QPO-@DM R  0BSDB;:P1 PPE00SLQUA T1SB S`P 0  pPm0V0v 0S`sP` UL'L7 0 @' 47ÚPXQ 0T!0T1SP 70  & 6媚PDЍP1\!S  b R1 &0 6吚0 <PP\!0 \!0DЍH&H6 0 <& 06v0@!0CR000\Q0DЍ%5 0 % 5_ P S>Х5@ `P0 5p !`EJ PPX||5 00P \56XqW&PP <500 ,5& 500 5PqY 1 !0PP=X1\QU0T1 dt4`p0 0Ppn>4p00\1 0X1 0l4Fd$d4 0 X$ L4P9@$@  8$0  4֙P* u u&$4 0,#3 ř0T1#0 ß #  3嶙P ub u#3 0,#3 ख़00X!\1tctst0cY!`p 0 P3p㎙ 0:PP%\!3 0\!(3 p{2p00\1 0X1 02n\!X1R]PV0\XT1 u7 u"2 0,|"x2 R0T10 SLBLbL2@`0 0`02>,"0  `00 22P#P'0\XT1u0 S Pwo0 SL!1 0 ! 1PL100p p1PZd100 L1PO"!Wp"dd $P d!L8F!< ]PXLp8,TP ` TL+ $$  X  tl, M8@-@P囝`P F0`1 P ң0 1Σ008QP@-@@M R 0SS00 @@Ѝ@.` `0 0 T  H0rЍ8 80 0 ,  0dT EL KQP- M0 R  RR  ` Ѝ\ \0 0 P  D09 Ѝ4 40 0 (  0,HV(l\SPG-@@MP``V QT p 0PO `PX]@Pc `Pn @@4` V# XX Y  P0<08010 d8`04$<, 00(`$5/@.@ЍL!L1 0 @! Q0` ŗ ! 1 0 !  /0㲗 0 0 `  60㢗 0 0 @ =0㒗x x0 0 l ` E0゗T(t 1$4>=H<`9]QP@-0M@  0  $(,@ ,0ЍA-QP8MPp@@P`7 V @$@(@,@004`   0 0 `'@0 8Ѝd d  \ 0 ` 00C 8Ѝ`,DQP@-4M@@`P P0H0T0 L0p0# (@,@`P$ p4Ѝ@-@P4M`P P0@00H@ @L@p `P$@(, p4Ѝ@-@P4M`P P0@00H@ @L@p `P$@(, p}4ЍPp@-@KPᰡ`Pp @0 `  P0pQPp@-@PP` ˿0("80ppQPp@-@MP`5 R3 00 0?S  000  0` `P圿U hUЍp0 Q 10PPPЍp l@QP R / 0@-|0 @0TM Ѝ0XXPP @ @0 0 4 P $0(H4o 0/ሥ@-000S 3/@ x@-000S 3/@L00/$ -00@-M M@ 0S A> 0P 00 3/ۍ Ѝ0@Ѝ/p@-@P`P" 0S 0U p0S p  0U  000L0 0@L0 0S @8 t Y% 0Va  `Ri bRf0Yc  Vp$ `p    Bd0 0CYd00J0J,0(-DЍDЍHp`DЍ$DЍ00(0cS00cS0  b\Q0  0 0Y 8uL0LL0D0< Ǻ0@PDP@`|0O-PS4M@f 0h @ 00Q bP  PPSP+P P `p R!P[ `嶐p:  jP 0 00 ` j R 0S 08  bR 0c1cS1S0$ $0 H8 0V3H0S 0 H04Ѝ`p j D Q  R# PaQL R4 R L  LL  0 Q  0P00S p `P  L1L Pj P  Q P0PP T0p `P   j <0D Q!0R$L0H0Q!$ $P0`0eS0Q  $PdPl`0bP,`F⠰P(0 F S `pph\Q00 p  (,0P4P(,l`dp0x S0R0p0ppP` U` ``0p.0 4 , ($  jP0B   L  L   L  $  $ R&4 Q# % WP U 4 R ( aQ%x\Q 4 0 \,0, /  ,  ,( 80ڷ$ 0 0 0p0P, 4  0 ($P0S0$0P m L  jP PP a0 008 p` ꠰TWX)|0@-SP 0 X|0T0@ b\X X X (0b'L@ TX S@/N|00-XPS! 0eSS@0S (  aR(  aR 0\ST0a P P0/0/1Qp@-@P ځH`P 0D@0`ppp0Q Q0 0T0/Qxd4R0RTS0\/ R P Q<RڀR 3@ /l d/p/t//0A-SMPY  0`@S @O7 0@S @ 0 d3/P!1 0 ! c>Gp쀟0p0@ 0@0 @70S000 0+Ѝ 0 0 | |0 p 0@ =H@XT8<D$5D\O-M P`W ǟ pP g@P &6 0& 6WЍՙ&$@ 0i \Q  Tpp& N R TGH BV 0 ;U  4@T  0S D` P=㘹`P VBPUPU`P 0 0 ZBUR `=P `P0Vh`o0 USP ᮶ r n0[\ 垶 b4┴ 咑D 3CP ᾸXPdP00c @IP 0S &P ࣹq 0Y 0   ⒹID @P\ T `Qmt#@0 XSXX30P  0836@P \ 4Dhlpt(P 1 #V`D 40@PV4`PM 4  ׷ >D4 ]D`2 0 L2婌4" @@  0 @P1ЗX̗!1 0 !  1僌@!1 0 ! 1vD字@!1 0 |! ?gd1 00@ H1\ tP  l !0  T@ 0 0  0?^@ 0 0  01N(b/&HP 24d5(@|@|d v@D0V4dC0O-S$M` p0W@J 4ß44 p0 b 0 pQP P0 /  c 03/PPEp   0ĊЍ`kpP P P 0Sh Y P0 9㠊ptx|倠儠删匠吠唠dP \)p`0 (DW0P 000O0P0 P,048v ノṳ/ |Ჳh` t ᪳  n,⡎L07P0 ϵ[`L\`PPᏳXP ኳ N u> 0 0  ? 0 0  0ن 0 0| x  h0ʆ4tD\@pHP\G-PM`pP8ㅅ 0 0  0u 0 0  0e00 p@4<H<A-@PM Q 0S 0S 40S 0S 0S 0S| 0Sy 0Sv ,Pp rBP`0P k PP`<P d PP`)pPj  " 0   0S`: R 0S:, R p`0 R h`< R ``8$ (0W4 0  ``! p P@Ѝ0>`8`\` 0 0  C>㣄 0 0 ` 0善 0 0  0凄 0 0 |  l0xHtdTDD,D<|P,dt+0P-M0 Q R  00 000 IЍ0 0  07 0 0  t0(h h d `   I>`  pG-PM`8pB Q_ RM W @@P, @P  ! 0 ိpp!0 P0 `@p PЍ,!,1 0$ !  1Ƀ!1 0  0彃 0 0  J>㮃 0 0  0垃 0 0 |  l0參HX(pd\D$pG-PM`p8O Q> S 『@P, P xD! 0 ,,!0 P00 @MP჎Ѝ 0 0  08 0 0  0, 0 0  0x x0 0p l  \0( d8|XlC-PMPpE Qb RP S" 8@`P+  !0 ott!0 @00 p` @Ѝ0!01 0( $!  1市!1 0 @ 0嫂 0 0  0圂 0 0  0匂 0 0  p0},,(T\Dd(O-PMp`@DE QR R_ Sm X! h@P- P `! 0 ֫!0 P0 p`@ 4PjЍl!l1 0d `!  L1@!@1 0 4! ,1 ! 1 0 !  1 0 0  0 0 0  O> 0 0  0Ձ@Tt0ȼD܄LxlO-PMp`@DD Qa RO S" 㾌@P. P 㶬!0 +pp!0 P00 `@ PῌЍ,!,1 0$ !  1t!1 0  0h 0 0  0Y 0 0  0I 0 0  p0:x H HP X  O-P,M P @$XPp \| \ S T\I  `PU ,l"0 \\ H @ pq 0@ k\ T$ T0 `]}p!\0 @D p ` P@,Ѝt!t1 0l Td!  T1寀H!H1 0 ~ 0 0  0~t t0 0l h   X0~H}yLPpq (,xo8nC-PMp`B Q_ RM S Չ@P, P ͩ!0 Dpp!0 P00 `@ P؉Ѝ,!,1 0$ !  1~!1 0  0~ 0 0  0r~ 0 0  =b~ 0 0 |  l0S~4 \{XhT,8~ԵlTvC-PMPpC Q` RN S! yF@@`P*  9!0 ᰧl0 @00p` @EЍ(!(1 0 !  1} 0 0  0} 0 0  0} 0 0  0} 0 0 |  l0} P$4`hp td4C-PMpP8`J Qg SU V( 㯈@P4  㨨X !0  !0P0 p@` zPᰈЍD 0!01 0( $!  1_}!1 0  0S} 0 0  0D} 0 0  04} 0 0  t0%}hrбt0ȩDPqȴG-PMp8PN Qk RY U, HF@`P5  Y !P 0 |!0 @00 p` @ЍH!0 c0!01 0( $!  1|!1 0  0| 0 0  0| 0 0  0| 0 0  t0|ȽĽz ! 1 0 !  0z 0 0  0zv̷ ܷ4ti<Hb rܪ԰i]T\h\q (aدF_XX`h^P-ME Q4 R! S @00,! 0 0 0 EЍ!    03z0 0  0"z 0 0  0zx x0 0p l   \0zꤴi(nlTep0Ȝ4DP-MD Q3 R S @,,!0  0 Ѝ!    0y0 0  0y 0 0  0yx x0 0p l   \0yh|dĦ$Dpc8Ħt @-M(3@SPO ЍH H0 0 <  40ey0Ѝ$OЍ<ȥX- M3S2S Ѝ8 8  0  0;y Ѝ O-M@pD`HPֻ@L?p `P  0ЍO-M@@T# _Pp%`P,   ϣ뮻@D0O0H00  0` P@)Ѝ虻PD0_0H0 0@ @  0Ѝ( (0 0   0xPlxp@-M`Pt@mQ?` 0|Ѝp@- M`pPd@]Qτp 0 Ѝ@- M`pPR@KQ0/; Ѝ@- M`pPB@;Q0/ Ѝp@-M`P3@,Q`0/vЍpp@-M`P$@Q` ?Ѝp@-@Q/@O-e$M `N_P@ZP Te`Ppp#11S0Q/0 0Pp` VP X P DUPP ,e`P upP P 䔟 P ޙ4奯0 0濄 ΢љ_P Ţș In ` ἢ忙 Q~ p᳢嶙 A ᪢ 孙 ᣢ妙P 塙Y>  ▢뼓3 0 03w3 003Pwp3 00`3wP3 00@3`w03 00 3pw303 w11S'化$Ѝb`Pb`("2 0L" >kw$Ѝ > P0 : `!ZN@T"pL'P PP  P,"2 0,! 19w8`P4 2`P< ,`P টI  㠟|!|1 0 p! d1wP DI  ㅟ{( }I  wm oI  i_lȭTȭ|ĭ~<d@$ ԫm x|`04lTl4X̧0O-dMX @ @ὡw?0 0""2pQWob_ ]τ 0:P`,@\<dЍ7X@3LPx x {? 0 rp0kk@? p8U<B A|XhE XS|G-M‸P @P+ , Jtb?0 C\\! PW?0]/`6D1S`<2S!0] p CpP,IQ/0PҀU 0 0,  0uЍ蠠 pW0 p 2X`ᬀ@D{?0 `ؤHhLh@` <@-L @֝4Q Н Y ʝL C-Mp0P`@Q P0/Ѝp@-ط@P,}Q/0p@p@-Pʷ@Q0/p@p@-Pῷ@Q0/p@?p@-M`PᲷ@Q` ?WЍpp@-M`P᣷@Q`0/Ѝpp@-M`Pᔷ@QP0/wЍp@- M@ᆷp& P`P   LoQ/0P@ Ѝ( (0 0   0t+ @- M@Tp P`P  ᴟ =Q/0P1@ Ѝ( (0 0   )=~td ,@-pPM7 @``$PQ0/}@p0T@@ 0T@@ T@  0 0  0OtЍ| |0 0 p @ `0@tЍP P0 0 D  <03tMaďppl 4h P|jU G-M`Pp04ȶN@P P l `@@PX@@7 0Ѝ$@@@@긜_P$@-@ 00HP-ME Q4 R! S @00,! 0 0 0 Ѝ!    0s0 0  0s 0 0  0sx x0 0p l   \0sTO8T܍ ȓ̎ |dKP @؂T @- M@pẜ P~`P  zᰜ Q/0Ps@~ Ѝ( (0 0   0Ds8D A-M`Vp O~@P+ P G 0 ᾜ Q?P0 @ `PS~Ѝt t0 0l h  T0sH H0 0 <  +=r̛DMDI|T P$@-@M♵T Q?ll 0 @   Ѝ@ @0 08 4  0rp` `0 0X T  D0pLtP@\0x4@|A-PM`pL Q; R {@P) P 㺛8!0 1$$ 00  `zP{Ѝ 0 0  0}p 0 0  0qp 0 0  0bpx x0 0p l  m?Sp@(CX?\,l|lT>@QG-pM@ Q- Q  Ѝ蔡 WQ T? X- sP9{`P  2 < 0 `P @B{Ѝ 0 0  0o 0 0  0o 0 0  0o 0 0x t  `0oܓAt`HĄ=܏ȐD,<@-`PMpPD R& z@P2  㹚W!1 0-  P0@uPzЍ 0 0 0 0  ~?ro 0 0  x0fol l0 0d `  P0Wo9܈?9,;0X|d:Ď@-pPM`PM R/ Sz@P;  LV V8!81 0྘  P0@PTzЍOzЍ 0 0ࡘ 0 0  0n 0 0  |0np p0 0h d  T0nh T9(X(88@-@Pu 8@Q88@-@Pk 8@Q8@-@Pa 8@Qp@-P@`V 0p@Qd@-@L @Q0P-M Q    qЍ| |0 0t p  ?ynP P L H   00in :D7L6~ c@-pPM`; Q ny@P) P f 0 0ܗ 00  `%PsyЍ 0 0  0)n 0 0 |  t0nh h0 0` \  '>n p}6 qt}܉wX}@50@-pPM@L Q; R A`yPP&  f$$ 0 `@yЍ0 0  0m 0 0  0m 0 0  0mt t0 0l h  X0mt<8@|4`|P{{x3؇QO-`$M@pB Q; Q $Ѝ́101ı001 00 @ 1cmVB TN W& ᬖ rxPP, k  0   p/@}x$Ѝ10000 00 0*m000 0 m0 00 0mtt0 00 ?m2.0 TD1.0`(y2ydyL1,yp@-@Pᙯ 0p@Q^p@-@PᎯ 0p@QSp@-@Pჯ 0p@QHRPO-PM@`` Q pwP  ϗ ဗ_p`  Q?0Ѝ\ \0 0 P  ?l4 40 0 (  0lLЃ @-@0 @Q9@-@'@Q@-@@Q8@-@P 8@Qf@-pPM`; Q tw@P) P l 0 0 00  `+PywЍ 0 0  0/l 0 0 |  t0#lh h0 0` \  3>l{|u.$1u7puX-<A-pPM`= Q w@P) P  Q?0  00  `PwЍ 0 0  0k 0 0 x  p0kd d0 0\ X  H0kꀄlzPt,~K~(thRs+~,J@-pPM@L Q; R `vPP&  㤖 $$ 0 `g@vЍ0 0  0ik 0 0  0]k 0 0  0Nkt t0 0l h  X0?kxyr +} g}r~mXr}~fr*P}d~eA-PMp@K Q: R m`4vPP%  -ᒗ   0 ` p@>vЍ 0 0  0j 0 0  ?j 0 0  |0jp p0 0h d  =jTwp0)|4}`|p}p||Dp,({|@-@_@QIp@-@`PUT T T pQp@Q p@kQ p@H-M  0 0< 0J K@BH-M /㙓 0S000KH-^ 0H-M  0,00S PPu L100,0 0, 0  000CS9ꈎ p Ď ܎ | 4 d ܎ L @ X Ў ^(+jG(K%V"d%q&~'V1 + f 8( 0LK @  P H-(M  0S 0S0500 S 00S0`0 0 00S0\0 0 ^000 00S0K0   0: 00   0ד 0S 000c0KH-M 0,00S`` \0冓0,00S D8 40|00 0( 00  KT @  x -;K/H-M 0,00S 1X0,00S |p l1N0,0 0, 000CSܑ ܑ ܑ ܑ ȑ ܑ ܑ ܑ ܑ ȑ ܑ ܑ n;8VF/0(0,00S0,0 0, 0,00S 0,00S 00  B 000  0000  0 0S 0 03/KT @  x P H-M 000 0 0(0 0 y 00 0SK- M 0,00S000K/- M 0 0K/H-M 00S 0$00S00S00 000R 00$ 0$00R 000S 0T0K- M 00S00S00S 00K/H-M 0KH-M   0S0/TY t%R#00 0S0S 0S  O$M0ST 0S 0S 0S 00S 00S 0  0KH-M K- M 0,00S000K/H-M   07; 奓 0s 0)_00S Z000c 呓 0sM000c  0S  0S 0 0KH-M  0S0 (岑 0S 0K H-M 0SHHH!H1垑D10S  (1< 0s 0;00S400&S 000c+0 0 〓 0s ߏ00Sُ000c  0S X 0S <0 0K @  Ԅ)H-M 0S 0=몏00 0  0s000c0 0s 0ss00 哏0  0K @  H-M 0S$$$ $00K @  H-M  0KX [ 0sc00S 0S [000c0K!TH-M  0S d0`07 0s?00S 0S 7000c0KQTPTH-M  7 0s 00S 0s000c0 0;S00 0S0000"0S 00S 0;0  0;0   0s00S 0S 000c0KH-M   0sӎ00S 0sˎ000c0 00S00 0S0000"0S 00S 000  000  庎 0s00S 0S 000c0KH-M ڏ 0s000c . 0S 00KH- M  10S& 01 k 0s 0X^00S Y000cN W 0sL000cA 1  F 0s;000c000S 0*00 S0000 00S0 00 00 00 00000  0R:嶎 0S 0K؄)H-M  0S 0S0* 00ᘎ0S000c 0 00S 000C 00/S  000C 0 00 C 0 0KH-M y0S 000c0KH-M00 Z0S 0S000 K-M  000CS $ 4 4 4  4   0`00 0\00 0P00 0 0,00S0s00  0K/H- M 0$ 0$00R0R 0$ 0$00R0K K 0K0 K = 0$00 0K0 ( 0K00 K 0K  0(0  0(00 $ 00 K 0 0 000  000  0  00  00C0 00  3/0K 0KR0K- M 00C0 00 00 0#1 00 0#2 00 0#4 00 0#8 00 000 0K/H- M $ 08 $0R:Q 040S 04 0801000 04 0800100 0 00 0 0 $0000C0 04 001cY 0SÏ 0800 01 0 000  0R:01 0  001 0  0 4 0 8 KH-M   0S 00s 000  00  0 0  00  0  0  0  0  K @ B CH-M   0:0S !1ƍ0Sp/p1徍 00S`L\!L1嵍 00sD(@!(1嬍 0 0 0 000, 0 00R1 0 0 00R 0 0 , 00 0 000  000  04 00100S 04 0010  0<0 0< K @ S   U( VH-M   0:0S LLL"L2L0S<,7.,2D 00s 00S"16 00 080R:o 0 00  0 00SH 000  0 000  0 0  00  04 00100SD 04 0010 0R !00<0S 004 0010 0<0 C0< 0   0 0 00R 0 0 , 00 0 000  000  K @ o   u< X H-M   P K 000  0000  00K - M  0 000R 00 $ 00 ( 000  0(0  K/H-M  0:0S XXX X0` 0SH8D 80X0 00S000K @ $  - M  080R *04 0100S 00K/H-PMP L0Kẋ0S 000cRL P0 H P0 D P0 @ P0 <0 ?P!80 ?P!40 ?P"00 ?P",0 ?P#(0 ?P#$0 ?P$ 0 ?P$0 ?P%0 ?P%0 ?P&0 ?P& 0 ?P'0 ?P'0KH-M  00S07ᯍ 0s 0$!00S 000cp0 噍 0s 000c  0S w 00K܄)H-M  10S' 0s00S 0s 0,݉00&S ؉000c"0 ! 0sɉ00S 0s000c g 0S + 00K)H-(M( , (, V 0s 0( 0K 0S 00ᔊ ,0 0R 0 ,0 0K h0   00( Ᲊ,0  0K0Kh H-M  0S 0S 00S0G$y 0S  r 0S k 0S d 0S 00 B 0 0R 0 0 h0 0S 00C 00/S 00C 0 00 W  00 0  0Kp x |   H-PMH H0S0F؈ 0S: 0 0 0 3 00 U {U 0S 0p@0KD K   0廌 0"S 0S  00 0 kU00cVD0ScU0O@0̉000 ,0Ɖ00 0 (000$0   0 $00;U H0 H00S?U 0+H0 @0 ؈H0 0 H0 H0 ,0 ˈH0 0 H0 H0 (0$ 很80 H0 40 H0 U0KH-M 0S 00U0 0 0  KH-M L0K- M 0S0c0cK/H-M   0S 0S 0S 00S0Q 0S00 0 0R 0 0 h0 00 R0  0KH-M  0S 0S0   㵈0S 000c0KH-M 0S0 埊0S 000c0KH-PMP T P0S T0S T00S0'L0KA㸉0S ȇ000c0 0KL0K T0 0R0 T0 h0 00L KP T0  0K- M 0K/- M 0K/H-.0H-?0H-M  0S0|0 0- 0s p00S k000c0  0KH-M  0s 0S0 0 傉0S J000c0K- M  0  0  0 , 00  00  000  0 0  0 ( 0K/H- M  $0 0,00S 000 0  0?S 0S 0s0  0  $0S $00 0 a 0!0  0".00  0 0 I 0SG0L0 0L 0L00S0L0 0L 0L00S 0L00S 0$0  B 0x 0">  0u 0S0 0 0,00S 0,0 0, 0,00S 00   0S0Kl H-M 0,00S090000 0So 000Sp 00 0 0 0L00S 0 0t0,00S0,0 0, 0,00S 00  B 0K4 H  X H-M   0,00S0 0)0000 0S 0媇0"> 0 0R 0 0 h00"> 80    00 0K4 H  H-M lKH-M 0 0C0 00S 0m000 0R |p l0b00` 0!00x 0"> (0t0S ԈKX H  | l H- M 0x0C0 00S0 0vt0,0S 0 0,0R 000, 0> 1 V0S 00 0> 0K0C0C!O 0s00S Y0sހ000cQT1 K 0 A>K0C0C ~ 0S>000 00(S 6)n 0S.0 0 00 a 0S! 00 0 0Sڤ0  ҁ 囀00S 0SS0  4 00K  H-M 00S 0Kႀ 0K| 0S k00ST0 0S _000c0 0 0Kh)H-AM  ;K0C0C$媂0S0#00 ;K0C0Cx 0S 000 ;K0C0C$卂0S0S04  0K H-M  0 0 ` 0S000cK0K  0S1 00 00L 0S&0W 0S0    0S 000S00  0 0 00 刁0S 00S 00sS Ђ0K  H-M  00  0002 @ ,0#30000  0R:KMbH-BMM( , 00 00 P0 4 4S~000cc (4R-*;K 0C 0Cd L0S#;K 0C 0C 04 D4d00CK04 4S 4 0x 00 0002,$0$ 1 (4R-*;K 0C 0C 0S#;K 0C 0C 04 D4200CK04 4S 4 0F 00 0002,$0$ $;K 0C 0Cu0S 4̀00 0S  000200C,$000 0SK04 4S 0 00 0002,$0$  (4R:0K,  , < H-GMM` d h$ ~00 0s"2R0S|l/l2J`~E>K0C`$0Sǁ00 r d4R:vE>K0C |0S lE.K BE>K0C0C  0S ,10 0  00 0 X$11X4 X4SE.K B 0@ KD0KHKLKPKTK H0S @0  0#KD0  0#KH0  0"KL0  0"KT0  0!K 00 0002h$0K0C`$嗀0S d4R D/00KD  H h  |  ̌  H-AM ;K0C0Cp 4P;K0C0C 0S0 0K4 0S 0 0  0K  H-M  00  0002 00nJ000  0ReJK- M  000S 00@0S00 0S0 0 00S 0 0S000K/H-HMH L 00 00 0 0 L0 H0 90  Ѐ 0S}000c0+J0@0 0D0 D0K n~0sw}000c 0 @00 500 0 00 01 S 01S '0<K 0 }<0K G~0sP}000c 0 2[8#80S 2[8#8@0SL00 L0 @ D0 0RL00 0101I H0 H00S 0 0 gH000 @00 [00 0 00 01 S 01S M0<K 0 :}<0K }0s%0 0 @2[8#80S 2[8#8@0S-02I 0 01 S 00 00 2[8#80S000 0 00 0H00 @ D0 0R0S*@0S @0AI 0S L0 H00S H003IH0 00KH- M $ 0K~0S |000c$0 0 00 0S $00 $0 000 0S$00S0$00 0101H 0 00S0I} 0 00 0 00 Gu0S =00H 0 0 00 S 0 0 0 0 000 S 00 ,00 ,000S000 0 0H0 0 000 0S00 5'0S + 00 0 00 ~00  0 00j0S 0 00 0 0 0 | 0H0 0 000 $0 0R000 0S0|0KH-M  00  0101 0000 0 0S 0 0 00 0 0 0 00S 00  0 0 00S 00 0R00  00  0  0  0  000 0 0 0 00S 00 000 0 0 00S 00  0 0 00S 00 0R00  00  0  0  0  00 0 000 0 0S80 0 000 0 0 00S 00  0 0 00S 00 0R00  00  0  0  0  000 00S 00 0S00S 00 0S0 0 0 000 00S 00 0S>000 0S 0 0 000 0 0 00S 00  0 0 00S 00 0R00  00  0  0  0  000 0 0 0 00S 00 000 0 0 00S 00  0 0 00S 00 0R00  00  0  0  0  00 0 0S 0 0S0 0R" 0S 0 K/H- M $ $00 $00S$000 p$00S$000 h$00$0 0$0 $000 0S$000 $00 0 $0 00 0S 0  0S 0 $0R 0   0   0  $0 0R$0 0 $ 000S 00 0R00$  00$   0$  00$  00S 00$  0S 00 000 0S$00 0 $0 00 0S 0  0S 0 $0R 0   0   0  0S   l0KH-M  0 0 00 000 0 0   0S000 0S000 0$0S0  0  0 0 0 0S 0S 0   0  0  0KH-M  000  0S000  0S000 00S0KH-M  000 0 0  0S0 0 000 0S000 00S 0K- M 00S 000 000 00S00S 00 0R000 000 00S 00 0R 000 0K/- M 00S 000 000 00S00S 00 0R000 000 00S 00 0R 000 0K/-M  000 0 0 0 0 0S000 000 0S 0K/H-M 0s 0&\v00&S Wv000c 0sMv000c  0S  0S 0 0KH-M 01s 0 0S00 !0k/01, 0k? 0K H-XMX \ \0S \ X0!H0K0H K H0K0H K \0Kj 0  0 000RP0KP K P0K0P K h000 P0K0  P0K00P K P0K  00  000  00P K HP00 080C0 000A 0S 2>w000  000  0  00  000  00  n080H K 0<04  0<00 8 H0K0 8 0 0 P0K P0KR0  Xz 00 0S k 0SnH0K0 H0K0RP0KP K P0K0P K C80 0 P0K04  P0K00P K P0K  H0K0  H0K00H K 00P K %P00 000  000  080C0 0000 0 0 040 0^$ A$0S $0P0K P0KR0KT l  H-0M0 4 400 00s/(0K0KH-M  00S0 000R  0s? 0!0 0[eAKH-AM3K3K|3K h3 K0!:K0C,0C*v 0st00S 0st00 S t00 S  2/v0S 2&v:K0C,0C 0 00 00 000S 000 000S 000 00@"Ks 0Sv0 0S 000000 0  0 000R00K0 K 00K00 K J00 0 00K0  00K000 K 00K  00  000  000 K *00$0 $080C(0 $000$  $000$  $0  $00  $000$  00$  (040( 0H-M   r 0KgH-M   0 00 0r0KvH-M   0 0000 0r0Km0H- M    @_00 0hr0 K0i0H- M    @_00 0Qr0 K0jH-M    0Ar0KfH-M  0 0S 0J K@BH-M /r 0S000K- M 0 0  K/- M 00K/-$M   0K0  0 K0  0 0R 0  000  0  000 0S 0  00S 00  00S 00  00S0   00 0R 00   00  K/H-(M $ ( $0 $0  $0  00 00 0000 0 0000 000 000 0S 0 0 00  00 00S 000 0  00 0 000 00C0 0S0 $0 0$  00 0 $00 $ R$00S $0 (0$3/0SKH-(M $ ( 00S00 00 000 0 0000 000 000 0S 0 0 00S 000 0  00 0 000 00C0 0S 00 C 0 000 0  $0R  0 0R 0 sr$0 0 $0 0 $0 0 00S 00  00S 00  $00S 0  $00 $0R$00  $00  00 00S 0 (03/0S 000 00S 0 (03/0S 000  0R  00  00S 0 (03/0SKH-M  00 ,KH-M 00 0 v/r0  0E?E0@0 @ 0D0 @ 00  00  00  00  00  00  00  00  00  0 0  0  0  0 < 0 4 0 8 0$0 $ 0(0 $ 0,0 , 000 , 0 0 !0 !0 0!0 4!0 0 ! 0 0   0S 0C0V? 0S s010S01 0!010S 010S 0\1  B 01 0!00  00  00) 0S >0H0d) 0S 10`0 J 0S 0H0)!000S00 0 000S 000S 0d0  B 00 0 000)@0K H-M  0S 0I 0S 0A 0S 0900 004 01000 0S"00S 0 0 00R0  0 0 , 00 0 000  000  000 08 0R0KH-M jL01s 010 !0 0s 0 00 0H0(0@ 0@00R  0p00S xl h0p0H0(0H0(00(040:0 4 0 8 K$    -M   0S %0 0  0S 000 0 0K/H-M  0 0 0J K@BH-M /n 0S000K- M  0  0  0 , 00  00  000  0 0  0 ( 0 0 0K/- M  0,00S 06 0S01040  080  04000 4 000 4 0 0 0,00S 0,0 0, 0,00S 00   0K/- M 0,00S0"0800 4 04000 8 0,00S0,0 0, 0,00S 00  B 0K/H- M 0 000R0K K 0K0 K F 000 0K0  0K00 K 0K  00  000  00 K &0 0 040C0 000  000  0  00  000  00  0003/0K 0KRKH-M fK- M  0  0  0 , 00  00  000  0 0  0 ( 0 0 0K/- M  0,00S 06 0S01040  080  04000 4 000 4 0 0 0,00S 0,0 0, 0,00S 00   0K/- M 0,00S0"0800 4 04000 8 0,00S0,0 0, 0,00S 00  B 0K/H- M 0 000R0K K 0K0 K F 000 0K0  0K00 K 0K  00  000  00 K &0 0 040C0 000  000  0  00  000  00  0003/0K 0KRKH-M fK- M  0  0  0 , 00  00  000  0 0  0 ( 0 0 0K/- M  0,00S 06 0S01040  080  04000 4 000 4 0 0 0,00S 0,0 0, 0,00S 00   0K/- M 0,00S0"0800 4 04000 8 0,00S0,0 0, 0,00S 00  B 0K/H- M 0 000R0K K 0K0 K F 000 0K0  0K00 K 0K  00  000  00 K &0 0 040C0 000  000  0  00  000  00  0003/0K 0KRKH-M fKH-M  0 0D 0J K@BH-M /k 0S000KH-M     z 0 @ 0 < 0 0  0KH-M  0 0 0`0S0H6 0S 0@00   0S200 0Kn Gm0K0 k l00K08K0Kn ;j0S jj000c0 0s 00  0,0*0, 0  0 ` 0 60KH-M   0`0s00`0 n0S 6j000c0 t 00 D 0 0D0 0K H-M 00S 00l0060 KH-M  00 00F0S 00j 0si00S 0si000cm 0S 0 00 0 0S 090 0S 090   0KH-M  0 0`0s000 0 0S  : 0SF0 ` 0Kn kl0K0k l00K08K0` 0Kn i 0si00S 0s i00sS ~i000c0 00 0S 0`0) 0S0 0D0 0 x 0 < 0  00   0 $ 0  0(0 ( 0,0 ( 0S 0 0D08KH-M  0 n0|0 |0x K k0`xK| K03/ 0S0 i000c+v0[S|00C|0 x0K0j0|0 0 |0R|0 0 h0|0x K  .i| 0 00S |0 0 0KH-M    00KH-M    00K$- M  K/-M 00S00|0s0 00S0000 000K/H-M 00S0 0|0s00|0q0KH-M  0S 0`0s0i0S 0S 0S 0^00 0K  0is 0Q04 0S 0H0K k 0S 4 0;|0Ki0s4Bh000c-00 00S 0I?0 00S 000 l 0 0R40l 00l0 l0 j 4 0sh000c0KH-M  0 0l 0J K@BH-M /h 0S000KH-M   040C 0 00S# 00S! 0,00S 0,0 0, 0,00S 00  B 000  3/#00 00S 000 00S 000 00S 000 0:S 000 000  3/K H-M   0S 0C 0S 0: 0s? 0S 0*0  0  0 , 00  00  000  0 0  0 ( 040  0 0 0K8 H-M     0KH-M 0 040x S0,00S0,0 0, 0,00S 00  B 0 0P0K H-M 0,00S $$p 0h0K (  H-M   00S \\z X1kh0,00S @4{ 01ah0S0?00 00S 000 00S 000 00S 000 00S 0:0 004 0 \0,00S 0,0 0, 0,00S 00   0 0 0K8 (   H-M PKH-M  0 0 0J K@BH-M /5g 0S000KH-HM@ D D0S XX; T3g<0K< K <0K0< K @000 000 000 F080C0 000 04 40K i 0s"f00S 0S, 0sf00 S ,i"4 0@ 0<00 8 08000 < 080< K 0<08  0<00 8 <0K0 8  0R<0K0 000 `080C0 000 0<00 8 08000 < 080 8 0<0 8 0,00S0,0 0, 0,00S 00  B 000S)00 0@000 000S0@0,0 ,0<C40 0 0 0@0(0 (08#80CS0@0$0 $00 0 000 ? 1/ 0R<0K <0KR o 0gK  L  H-M  10S  070 0g0S04Ve00S Qe000c*0  0g0S Ae000c00000 0;S 000000Kl)H-M  10S  070S01 e00&S e000c'0 i0S d000c00000 0;S 00l000f0Kp)H-M  0 0 0 00S30E 8E E E E 0100S 0Hf000S 0!=0000S 000 00`00 0s0 00  0$ 0fK   X H H-M  000S 00S0-000 0S g00 0000 00 0S 090 000S 090 0 00  0KH-M 000S00&KH-M  0K Gf 0s&d00S 0sd00 S0S  0eK`  p H-4M0 4 8 <0 0000S Sf00 *018 000 0S 0R018 @4 c00018 00sc000c<Je000  40R00 Q018 000 018 000 0S0S;0S004g 00 0sc000c<je 0Rd 0sc000c<Rd0SR 40R000  40R00 018 000  40R000  40R000S 000 f0S Qc000c<d0000S Cc00 0 Uf0 C S@x0 0Rh0S)t080p  t0<0p  t0<00t 8 p00t 8 t0,00S t0,0 t0, t0,00S t00   t0 4 x0 t00 d0K R -h0>0S: 00 -x0 0R x0 01000S 01 00s 01 00b01 00s 01 00T000   0Rd0K R -0KD     > 8 H-M  040 0KH-M   e0S `000c0KH-M 0<00 8 08000 < 0,00S0,0 0, 0,00S 00  B 00 0000R00V?KH-M > 0 0 0J K@BH-M /Ta 0S000K-M  0@0 0 08 0R 0<00 0S 0D0S 0 D 0 D 0 D 00 0< 0R50<00 08 0< 0<0S 080 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 8 0 @ 00 00 00 0 D 0 D 0800 0< 08 080S 0<0 @ 0@ 0@ 0@0S 0@08 0R 0@0 8  0@0 < 0  0 < 0 @ 0800 0S 0D0S 0 D 0 D 0 D 00 p08 0R50800 0< 08 080S 0<0 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 < 0 @ 00 00 00 0 D 0 D 0<00 08 0< 0<0S 080 @ 0@ 0@ 0@0S 0@08 0R 0@0 8  0@0 < 0  0 8 0 @ 0@00 0S 0D0S 00 D K/-$M  08 0R0<00 0D0S80 D 0 D 0<00 08 0< 0<0S 080 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 8 0 @ 0<00 080S 080D0S0<0S 0<0D0S0 D 0 0 0@00 p0<0S 0<0D0S>080 0 0S 0 D 0 D 080 0 0< 08 080S 0<0 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 < 0 @ 0<00 0D 0D 0 D 0<0S 0<0 D 0<00 08 0< 0<0S 080 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 8 0 @ 00 0 0800 0D0S80 D 0 D 0800 0< 08 080S 0<0 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 < 0 @ 0800 080S 080D0S0<0S 0<0D0S0 D 0 0 0@00 080S 080D0S>0<00 0S 0 D 0 D 0<00 08 0< 0<0S 080 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 8 0 @ 0800 0D 0D 0 D 080S 080 D 0800 0< 08 080S 0<0 @ 0@ 0@ 0@0S 0@08 0R0@0 8 0@0 < 0  0 < 0 @ 00 0 0S 0D0S0 0R" 0S 0 D K/H- M $ $00 $080S$0<00 q$0<0S$0800 i$0<0$0 0$0 $0800 0S$0<00 $0@0 0 $0D00 0S 0 @ 0S 08 $0R 0 8  0 <  0  $0@ 0R$0 0 $ 08800@0S 0@08 0R0@0$ 8 0@0$ <  0$  080$ @ 0<0S 0<0$ @ 0S 00 0@00 0S$0@0 0 $0D00 0S 0 @ 0S 08 $0R 0 8  0 <  0  0S   k0KH-M  0 0 00 000 0 0  p 0S0800 0S0<00 0$0S0 @ 0 < 0< 08 0 D 0S 0S 0 8  0 < 0  0KH-M  000 + 0S0800  0S0<00 00S0KH-M  000 0 0  0S0 0 0800 0S0<00 00S 0K- M 0<0S 0<00 0800 080S0@0S 0@08 0R0@00 0@00 0@0S 0@0< 0R 0@00 0K/- M 080S 0800 0<00 0<0S0@0S 0@0< 0R0@00 0@00 0@0S 0@08 0R 0@00 0K/-M  000 0 0 0 0 0S0800 0<00 0S 0K/H-000s `^0S ^ #j H-T00s D0040 (00s 000  #H-,40S j^*0S e^ #H-=t) j H-M\0 0K \ 0S1[00S 0S00K #H-M*0 0K\0 0K 3] 0S[00S 0S00K #H-M 0K<[0S ^ 0K  \0S ^0S ^KH-M 0S ] [0S ]KH-`M` `0$0 0,0 0T0 X0K@ 0S 04 `0R00Kx)H- M Z00 0 0K u]i0S Z0  E  4 00 00 004!0K \ 0sZ00S 0S 0s Z00 S }Z00 S tt p0\0s 0H0 0H U 0S 04 0R <_Z0  K   H- M $ 0K ]0K 0Z0S `]d00 20 $0S 010 0K  \0S 2Z000c0KTm H- M 0K \00 0K  \0S 0]KH-M 001s 00> 0S 00N/001, s0N? 0KK40 X1` D0K  0SKO00S 0S]CO00 S >O00 SX1,0:S X1 X1D0 XjX180( KX3/<X18@!O00 c(0KX 4/X1,0:S, X1,0*X1, X1 X1D0 %00V 040d 0,00S 0,0 0, 0,00S 00   0KD H-M 0,00S0 00& 040d J0,00S0,0 0, 0,00S 00  B 0KD H-M 000S00$ 000$ [0K-M !K!K$K/- M 0$K/H-M 0- 0S0 040C0 0 J? QP00 J?  P0 KK!0QP!0 K 0KH-M 0 0S040C 0 0 J? QP K y 000 3/KH-M <KH-M ] 0 0 0J K@BH-M /s< 0S000KH-M 0 0@0e0,00S0,0 0, 0,00S 00  B 0\0s 0\0߫0 \ KH-M 0@0|0S hhC d1<0\0s PDD @1<)0`00 000  000  0(0C 0 0| 0(0 h 0,0 l 0,00 ( 0l0 ( 0` 0`00R000S `PQ L0<040S @,R (0<0 < 0 8 Kh  h!    H-M 0,04S dd_ `2y<0,0$0, U0h00 000  000  0(0C0 000Sg 1W<00  B 00@0 000 c00 040 C04 0 00R 0080 00S00S003/00  3/0h 0h00R0` 0`00R$0 0@0 㪮0@0㒯0S0,00S0,0 0, 0,00S 00  B 0,0$0, K  ! 4 H-M   0@0C0 00S LL H0;00S  00S 7K\  ! H-M 0<0S 2;080Sx t2; 00 0K <0K0 0K _0K K080 K3/0S 0S 0<0K h 04000c0 0 0KH-M   0S 0S070@0A0S q0-  0S 0#0 8 0 < 0 0@0 㽧0,00S 0,0 0, 0,00S 00   0KH-M 0 0@0 0@00S0,00S0,0 0, 0,00S 00  B 0 8 0 < 0KH-M 4000 2 0S0  30KH-M  4  0R*00 00 0S0 00  30KH-M 003/0K,#H-M f3000 0 03/^30  K,#H-M  00 3/0K,#H-M  00 3/0K,#-M   0 0S 0S 0S 0S0 <0  00  $0  0  0K/,#- M 00CS/L T \ d l t | @0<0D04000<00T0<0D0 0 0X00p0P00K/- M 00CS( 0 8 @ H P X ` h 000d0 (0 0J?@0P000K/-v?K/-M   0 0 00 0 KK/H-0M0 (0K 8 003(0K 0S 0 0K$" <" H-M   0l [sys ysI/ sJ / s&@+SQ 4+S,+S +S+S sl +S *SG *S*S *S7 /-S( *S *S ʬ*S  *S*S *S *S x*Sp*S }s3 hsH hsns: ns qs^ qsrs spsY os1 nks ksls gjsc is bbs bs es esgs Wdsw cs R_s _sas K]s \s Fsr s5"s "s@s @sYs YsLXs Gs 1's 's(s5 *&s $sB %s{ s s s s s s s ss s  sP ss ss ssh s6 s ss s s s s s s, s s s ss s\  '72 '72 '72 h't72 P'`72 8'L72  '872 '$72 &72 &62 &6}2 &6w2 &6q2 x&6k2 `&6e2 H&6_2~ 0&p6Y2x &\6S2r &H6M2l %46G2f % 6A2` % 6;2Z %552T %5/2N p%5)2H X%5#2B @%52< (%526 %520 $l5 2* $X52$ $D51 $051 $51 $51  h$41 P$41 8$41  $41 $41 #41 #|41 #h41 #T41 #@41 x#,41 `#41 H#41 0#31 #31 #31 "31 "31 "3{1 "x3u1 "d3o1 p"P3i1 X"<3c1 @"(3]1| ("3W1v "3Q1p !2K1j !2E1d !2?1^ !291X !231R !2-1L h!t2'1F P!`2!1@ 8!L21:  !8214 !$21.  2 1(  11"  10  10  10 x 10 ` 10 !00 0K:D=;>EBCDGHT" X" `" h" t" " " " " " " " " " # # # $# 4# D# P# `# l# t# |# # # # # # # # # # # $ $ $ $ $ $$ ,$ 8$ H$ T$ `$ h$ p$ x$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ % % % $% 0% 8% @% L% T% \% d% h% p% x% % % % $" H-M 0t [sys ysI/ s / s&D&S  8&S0&Ss $&S&So |s  &Su v%S %S%S l%S /-S e%S %S ʰ%S %S%S %S R%S |%St%S }s Fhs hsns* ns qs qsrs 7ps- os 2ks ksls +js is &bs bs es esgs ds cs _s _sasz ]s \s s s5"s "s@s @sYs YsXs Gs 's 's(s &s $s s s s s s s s s sus s s ss ssr sjs s~ sK sWsW s s\ s s< s s s s s sFs` st 2222222222222222|2~x2|t2zp2xl2vh2td2r`2p\2nX2lT2jP2hL2fH2dD2b@2`<2^82\42Z02X,2V(2T$2R 2P2N2L2J2H 2F2D2B2@1>1<1:18161412101.1,1*1(1&1$1"1 1111111111 1 11110K:D=;>EBCDGHX" `" h" t" " " " " " " " " " # # # $# 4# D# P# `# l# t# |# # # # # # # # # # # $ $ $ $ $ $$ ,$ 8$ H$ T$ `$ h$ p$ x$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ % % % $% 0% 8% @% L% T% \% d% h% p% x% % % % H-M   0l [sys ysI/ sJ / s&@+SQ 4+S,+S +S+S sl +S *SG *S*S *S7 /-S( *S *S ʬ*S  *S*S *S *S x*Sp*S }s3 hsH hsns: ns qs^ qsrs spsY os1 nks ksls gjsc is bbs bs es esgs Wdsw cs R_s _sas K]s \s Fsr s5"s "s@s @sYs YsLXs Gs 1's 's(s5 *&s $sB %s{ s s s s s s s ss s  sP ss ss ssh s6 s ss s s s s s s, s s s ss s\  '7v- '7p- '7j- h't7d- P'`7^- 8'L7X-  '07R- ' 7L- & 7F- &6@- &6:- &64- &6.- x&6(- `&6"- H&6-~ 0&l6-x &X6-r &D6 -l %06-f %6,` %6,Z %5,T %5,N p%5,H X%5,B @%5,< (%5,6 %|5,0 $h5,* $T5,$ $@5, $,5, $5, $5,  h$4, P$4, 8$4,  $4, $4, #4, #x4, #d4z, #P4t, #<4n, x#(4h, `#4b, H#4\, 0#3V, #3P, #3J, "3D, "3>, "38, "t32, "`3,, p"L3&, X"83 , @"$3,| ("3,v "2,p !2,j !2,d !2+^ !2+X !2+R !2+L h!p2+F P!\2+@ 8!H2+:  !42+4 ! 2+.  2+(  1+"  1+  1+  1+ x 1+ ` 1+ !0+ 0K:D=;>EBCDGHT" % % % % % & @& T& h& & & & & & & & ' 0' X' t' ' ' ' ' ' ( (( D( d( x( ( ( ( ( ( ( ) 8) \) p) ) ) ) ) ) ) ) * ,* L* d* |* * * * * * + 0+ <+ L+ d+ + + + + + , , ,, L, \, h, , , , , , $" H-M 0t [sys ysI/ s / s&D&S  8&S0&Ss $&S&So |s  &Su v%S %S%S l%S /-S e%S %S ʰ%S %S%S %S R%S |%St%S }s Fhs hsns* ns qs qsrs 7ps- os 2ks ksls +js is &bs bs es esgs ds cs _s _sasz ]s \s s s5"s "s@s @sYs YsXs Gs 's 's(s &s $s s s s s s s s s sus s s ss ssr sjs s~ sK sWsW s s\ s s< s s s s s sFs` st 222222222222222|2x2~t2|p2zl2xh2vd2t`2r\2pX2nT2lP2jL2hH2fD2d@2b<2`82^42\02Z,2X(2V$2T 2R2P2N2L2J 2H2F2D2B1@1>1<1:18161412101.1,1*1(1&1$1"1 1111111111 1 11110K:D=;>EBCDGH% % % % % & @& T& h& & & & & & & & ' 0' X' t' ' ' ' ' ' ( (( D( d( x( ( ( ( ( ( ( ) 8) \) p) ) ) ) ) ) ) ) * ,* L* d* |* * * * * * + 0+ <+ L+ d+ + + + + + , , ,, L, \, h, , , , , , H-M    *0 08#8'0 0 00 0KH-@M8 < @ @ *@0 <08#8'0 @0 8%m+ 0S 800c0 0'S'00 40K8 '/0 K 0 40K80 00 0 u* @0 @00 8 x0KH-M   00 0 0KH-M   00  00KH-M   00 S 000S00 00 S00 0 00KH-M   00S 000S00 00 S00 0 0a0KH- M   0 00 S 000S00 00 S00 000 000KH-(M   0 00S 000S00 00 S00 0 000000 00KH- M   0 00S 000S00 00 S00 000 0y0KH-M   00S 0S 0S0  ^0KH-M 00S 00KH-(M $ ( 0 000R0K K 0K0 K L 000 0K0  0K00 K 0K  0 0  0 00  00 K ,0 0 00C0 000  000  0  00  000  0 0  0,00S $0(3/0K 0KRKH-0M  0SZ 00 0 z 00C0 0S 0,00Sk000CS?@ @ @ @ @ @ @ @ A A A ,A 8A DA PA \A x10 .p10 +h10 (`10 %X10 "P10 H10 @10 810 010 (10  10 10 10 10 10 00 0,00S000 0 0,00S0000,Q x( 00 0 0 0RK, - - - - (- 0- 8- @- H- P- X- \- d- h- l- t- - - - - H-M   PKH-M   EK- M 0,00S 0,0 0, 0,00S 0,00S 00   K/- M 0,00S0,0 0, 0,00S 0,00S 00  B K/- M 0,00S000K/- M 0  K/- M  J? K/-M  0 0 00 01 00 0 0 000  0R: 0K/H-M   }0KH-M   p0KH-M   0,00S0 0000% 0 0R0 0 h0000 $0   00 0K- M 00K/H-M  000 0 00S 0 0,0R 00 C0 001 00'00 0 0 0,0R:000'0 0 KH-M  0,0S0,0m000S1g 0S!1%000 0 00S 001C1 00'0 0,0R '0 0 1?00 1 000 0 0 000C S'H H I H I H I H I H I H 0  0  0  0  0  0  0  0  0K- - '- -H-M 00  \ 0KH Ѝ/H-L00S <00 4~0S 00 00))H-Mv 0S0 c0S 00KH-M 00S 0*000 00C 0 0,00S0000 0 0R孴000 v/&0  (00 R0 0K)H-M P000  0S 000 00$ 0R K)- - - - M 0S6L L L L L (L 0L 8L @L HL PL XL `L hL pL xL L L L 0"0 000000|0x0t0p0 l0 h0d0`0\000K/- - - . . . . $. ,. 4. <. D. H. P. T. X. `. - M 00K/- M 00K/- M 00K/- M  0  K/- M 0 S(N M M M M N N N N N (N \0X0T0P0 L0 H0D0@0<000K/h. l. t. |. . . . . . - M 00K/- M 00K/- M  0  K/- M 000K/- M 000K/- M 040K/- M 040K/- M 0 0K/- M 0,0K/- M 000K/- M 040K/- M 080K/- M 00K/- M  0  K/QPp@-@MP`J X!X1 0 L!0 0080SB 90 08`<!:08 S00 0R:0 90 0"!!0C90ЍpV 0 `S  $P0000S 0 3/00 !TgfffPQPA-PMpp`" R s"P0Q8@P+ Q/1$pP LЍ0 0P[" #@Ѝ @@ <  0 +0 @-"QPp@-PM@`` ,"P  #S%Ѝp0 00 0 $ @ d08@-@P P6P9P:P8P:88QP8@-@@ :09 S p0 #110B01 TLUdt @4@-0`p@M0`p P0|0@pP H00@@d'PPЍ`000pP 040p00 04Mh,0@-$M@ @@@ @@@@@0 0 $Ѝ0h< <0- M0 (  0 ЍHtT@ @0- M0 ,  $06+ ЍH,8G-DDqD M @pP` 0 1@@0  uPP"@DH0 )@T Ѝt000@ =>d ЍD000P (0W Ѝ,XL L00@- M0 8 @P $0<PЍ0@ ,P-M 0 00 0 $  0#ЍDP@-M @P 0 0 0 3,7S 3/Ѝh h0 0 \ \0 L L0 0 @  ^?Id`\{L rC-$Mu`Ph8@Pr $C@0PU $Ѝ40S 2 p0 0 `'2{pP 202 2W b`wP 4Pq080\28 0 0 <24200 $2 ` `|@P+0SP S4 0 @ 1o!1 0L! ?c7!1 0 ! 1Tt0 0@ ,1Fu@1 00?<:0Ph !  !0 0+0 000"9 PN 0 00 0h000 0 ^L<OlSayUjĽxgx^`aqp@-p1pQpaM0P`@0 `?TЍp00 0S{0@PS( S    0@ 0Ѝp000 0`90P 0 ` ?|000 l0`q90P T0 ` 80@h?ؾ5L/420@-M00! P  @P ("Ѝ0( (0 0   0\Ѝ0ذ0@- 1MS  P@  P@ P@ u0 :Ѝ0D D  < 0 m0*P4$Խ0P M/ 0v` 0@-Q MP00@S Ѝ0P hd\ <0S 0<P 0 S 00e \^.n !edÕh0@0hi0H 0 1P*h\hXH  ̌ h V@-Mp`P@P  0`P@ Ѝl@-M@P  0Ѝl@-M`P@p{P #(0p0,0 00ЍlC-B2M0@P 0tdDXP@P 0@SC 4;`PY 0@Ph 2 000 01KbPPJ  Xp )8@P ip100@ T1%ЍD`P@5@P ``<! ``0lA 0 0  0000 0 0 0  00 00 p08>(zdt\lgܹ$sK_KԳYܸCA-@`MP`@}:P  0PPp[@P }P c`vP{ |pPu k\300 R` Ha<`\P $VP p@ "0@  0 00" \ l0S0xlQw 0 S p2"0 `P`0 X2PJP0 @2` @%,",2 0 "P 23`Ѝ"2 0 ! 1&`Ѝ!1 0 ! 1Q `Ѝ!0 ! 18pV0* fW-:Vk cWh*X!X  P! 0`p 01p0 1p03/ \P P 0 0 0   0`p ?h;XX;TL8 Ԃ ̰а`ȶhX8p<|̺@dP@-PM`p4tP/ @P: 0p VP 0S P 0 P 0 0 0PЍh PPL L0 0,@  40O@l t#QPG-@MP``0 0S.p6 !0pw 0`p 0Ѝp p  h 0 P0 D D0 0 8  ,0t\\(QP@-0M   \@ @Ѝh h0 0 \  P0DD00 ,  $0,D0@-4MP1 @@@@@ @$@(@B.@W. P Q?0%  i0Ph00 4Ѝ0P P  H 0 00(t-ȱhT<@Dl 00( 00nO-fM.`11SEQ %5 0 % 5PЍ.d-5S @-4S$0T3 ş5 0 0d5@ (@-*FP* -44%L0`0P /@7pQ?0 4 0040`0`dhlptx|2倐 ,048LPTX\--9 ,0 bTPP<\P-D`<DL@ $0HP @Q(@a pWY#3 0 #3 0 PP W-pp# `` Q?0 )D-4# Q?0 3 00 =hPP9 200P ?wB@P 0020hP .}Ѝx"x2 0 l"p ?U-$@I @ ,0Q @W   )N17c PP,!1 0 !1 1 h!h1 0 \! P1D *00 $1! 0  !  0|x`+h8@D,l4px)ܮ09,"[LX`$ tУ4īXȣ6@-P 0@ |G-@q M@P@@ 1p0P 01@`   0ePP 0   P P P @T Ѝt000P X0V ЍH000@ ,0I Ѝ`L,/60@-MP@P 0 000Ѝ0l0@-MP@ P 0000 0nЍ0lPQ- M @ Ѝ4 40 0 (  0 Ѝ.О0G-M` pYZC WV@@>  PPH L!0 pn+0,,!(q pQ?0L1 000P@@- 0`PЍ000` 0 0 0 x  l0Ѝ\ \0 0 P  H0'ا`Heh`6Wh(6h]O-hIM@ (@,@` 4HpxP4 $}04@8@<@@@D@H@L@P@T@X@x@|@@@@@@@@@\@`@d@h@l@p@G?*\ Q ! 00x! 0 ' H00 P Y> p 0!00 ( ,  $0+ PP, (0 P P P @(5TIߍ|000@ `0IߍP000P 40IߍНx(O-@gM` @$@'P,T,p@(,@0@4@8@<@@@D@H@L@P@p@t@x@|@@@@@@@T@X@\@`@d@h@Fr>O* Qjd! (0,P!0 &pp' Y R! 0 `` $  0+ cPP!$  0 P P P @ Tgߍ 0 0 t @ d0SgߍT T0 0 H P 80Dgߍpx<Hp@-M@P` @@C!0    0M/ PP! 0 P P P@ETЍpx x0 0 l @ ^>ЍpH H0 0 < P ,0Ѝpܮ\ L\@-M@Pp`Pl0P0(00,0 000 00{Ѝ0 00 0 $  0P$lG-Mp`@PI P0PP PPP0P)00 0@  0PP 0 0 P  00Sp P-Ѝ 0 0 t  l0d ЍL L0 0 @  80U($<Е\P&@-@P M7 qa1p0` 0`050PS/PPP0 0 p00?`0S 00ȥ0S 00 Ѝ@ Ѝ0S 3/|僓|Pꐡo@-MP@pqb0VĠ e  "l\*@T0Ѝ@f 0 0 x 2 0h0!!2S H3/"20DSB202sHpbp@-h0h@hPM@P0 `00P[00P00 0ЍpPğp@-0P`@M0P` 00` >P 0 00`0pp | |0 0 p  0bЍp R?D0`00 0SЍp萟ĞhL0,0P- M P P Ѝ| ЍLX X0 0 L  D0, Ѝ4 40 0 (  0@PCPO-PM`8 䠟䐟䀟p  yP& |p@ I 0 0 0   Ѝ8 @ T0  80ЍĜ4t`+'@-M@0@,  Ѝ/?O-ؿ\M 0/@ ϟ  ?ϟ堯 $ϟ (ϟ ,רP0S 3/P7 q 0Su_] _0S o S:ϟ < PP PP7 PRP0PPFSD  0R0 RRppd R^00Sd'00 PP0.0> 0 $. ?=000S 3/.^W>P} }=  x=0S0S 3/00UP} \Ѝttt} p`PPU` 2S5 4=pP 2 S 3/PU`PRuiPpdPp `P?PPOf 0PTtlt<`0`00`\08P 0H<(Pp@W =,< 0 + ;0 RB؋{kp`P 06 ;p@ l0 00R0% P\[\;P0 P00Dk1` 00;m 0R ;0 0 P:^00*: 0 *: Q303cNClʟ` : QP P P9| ጐPP0P*P  H*H; !P0P(, 0P$ 9s)9 0 ) 9Q QN0 P0 )  )0 t9 <?Qp|$|(P>\(\8 0P(P8 p000S0u000o c 0 0c8#80 PP 0S @`0a0@Sʢp@%9.>P 9O-MHLP\0@P U 0S 0S 0S QZ`` Y@P /R r堂0p  0+t2000 00 L2000 00$200 0 00 Y!P  qP   ̐弸r 0S=p01`S`CЍH`PD`P( `P 7`P..7`PK j\<{H0L00@ 0 0 |  0Ѝ\ \0 0 P  0hXX(hl0@p@-@PM& P`0P0`0 0`n0S P 00}Ѝp@?4000` 0TЍptG-SPMP8p`i R@@W@TbR A@0S\ PĠ @T!1 0 ! 1!Ѝ8#8   0PAЍ@0 .P0D00<0S00 <00 "1DB0~8P#8 P@P6 0 0 0   {T T  L 0 400$pP- M Ѝ$ $0 0  0 ~D4 C-PM@P`Q7 1 000 00p P0    0 0v  0 0Lx  p0@ eTЍP P0 0 D  <0Wꀅ~"@~& }O-p$MPPq0 찟젟 @`0S @TW$Ѝ0zBP  ~0  pD08 80 0 ,  $0}̃G |9p@-@PM` PU Ѝp?P h X X0 0LL  @04 40 0 (  00|i {[O-M@P[  Kp@ W`.*PP[  > 0P 0/S-00PЍD!D1 0 8! r? `!1 0  n? `x V 0 0  0 Pe 0 0   x0Wl l0 0 `  =K]!lPЂ ܁`C-PMZ@PQ  u`0 Sp2@@@10 P 01> /00 0vPVЍ00 00P ` 0 0  t0 `\X X0 0 L  D0Ȃ, dt0@-@TM@01S$ P@ ,(!$1t @ ?d d0 0,X >  0+@ 010TЍ0 ~@- M0 00 0 $  m0{ ЍĀ$0@-PM0@0P @f0 b0S00  0U00Ѝ0LL0 0CЍ0舀~xp@-H@M@k8 80 0 (  `0%Ѝp}@-@Mk$ 0000 1Ѝd0@-ME1S @@PU Ѝ0 - Q?0t - Q?0X - Q?0Z@ @0 0 4 @ 0Ѝ0,, ~|1!0@-P@ MKT 0S ``-P% Pp - 0@: Ѝ 0 0 |  >*&PL L0 0 @  80x@ $~{l}t{G-@hM0PA prpppbpP0 X2j`P 4},1 ܀0 0P"0P $1SS 10  3 hЍ!S   0P c?9!1 0! 1.fhЍ$1S+``1 00P1 PP 0,0 P0P 0 00$1=0 0 $,00 0P b?$,z z}x}L(y} y|yx|}\|w{y|p@-pPMP@`T 900 Ѝp0 00 0 $  0Ѝp w\{wRp@-PPQ@`2bTp- M  0 48 ЍC-Mp PX@ @@剎PS QaP` 0`b@5P* o @✁ k!଀0 pQpap1P0` 00@`<eP> 4A@001S0 ڤЍ1 000`@&;Ѝ Ѝ    0}Ob00 0`0D$ @ P0 zv4xzTPzDv\z8ydy|u|yxPQ   /xO-MP 0300  Ѝ(`,p0(0,0@P.,0 S+(PP "2 0." 22 0  ("(0 |" t2((P`R`"`2P 0($ H" @2 $1SQ $2$$$0 0$܀0@( $$@ eԱ C(!$1 0C$1(!$1S+ P l(1P0 0 d ?P, ^(f4P0$(1( &(h( 0 0  0 0 0$!(!,!ZЍ 0 0 0     H(?7PsdxTxs xT T0 0 H  ~0P)_Ѝpgkjjdkja0@-@PM 0S PPP P Z0 000!Ѝ0lЍ0d d0 0 X  ?< <0 0 0  (0Xl``c``i`t!t1p@- hM@0\! T1LP 8P,PhTP!9P1 @P `0 `00P `>o0P   0` 0hЍp 0 0Lx  p0h h0 0 \  T0|j`ih`#GGDd̠hi_5diXhP_38iXA$_+0@-M#11 c  Ѝ ! @T PG?  Ѝ0 00 0 $  0?T]h@0^EP@-M 011 B  Ѝ ! @T tPG?  Ѝ0 00 0 $  0̔dg?p]Y@-@PM TPG?  Ѝ@0 00 0 $  0ЍHg f\e G? /᨝-QP0M $ V RT $@$0P p`(0@ ,( $P) `&," p l& !("0 P@ (ट&dt˰p !`$" ( `,(p! $0L$  |p``"\Q`PPQap)! + P+P XP`( "XP"$q` Q `!(! *a $(*  *)($D p@A*!) (!+" (|`@A`!\Q *pP+P LAQ`P$aP P(H@`*!H`@`! H +a""$@  +qQ@+  R ! *   *p"( "! ')! 0c( `$<Q, Ap$` 8"ĠT01@% R(p $@$ l80$ A p 0#‰ #l`#hP0`Q#4"h0`!4a0qD@$ @$h@$<0$(@" Q p#l`@#hA0`#4!h0`1(dp`aTP%(P%8P%l`%! PA( 1&|&$&X  `p P !D0$ 0#,0#0## ##$ 0 0Ѝ/((( 0Ѝf{e-QP0M$( 1 R/ `(P0p @& P`,! 0(p@) ", , L$,"P0 `pD !("88,0ğ˰ H$! , D$$"(0J"P P)|&LAp*@@Ap!\+Q@*%@ @ !""$ Q+&()!&d)` q + a !A+ )! * @! * !@$( " !|p``$\Q)PPap"\Qp% "XP X  +P"$ Q$$D`'q ` * `!(! * Aa *Q *)(`!*!)`&! 0b1,(@0 p!H"\&Ġ@@ ' ,p(P$  B x TpP "X)|!ĠPP (   x Tp P)X&|"PP (,,, ,X,,p  P&h P`!L)$  0'<#8#4## ##$ 0 0Ѝ/,q eilXrRP- M1 @0SU  Q*00`@0hl `&d`p@0x| p'tp @ 0 ( 0 P@8<0# 4Q 04 P@ Ƞ ̌,ČP@ Ƞ ̌,ČQT P@ Ƞ ̌,ČP@X   Q} Ѝ/Q 00 Q 00@S@@@@P @ PE@  #̠# A#!@ ! !!!@'(R@,@`p 0 RB儒P@  @@P **P!LP!Ƞ A P!Ġ  D   P' @(#R` p 0$ @ꤑAQ  @P @PA @P @P ! AQH !`\!P! %`)&0P4<8` @P  L aPA P ,D,,, , @'P(# R!<!d!0 ` p0,(P$@ $#!Zpt x[Tw ZLs(Z8o`nYTrPv0YO-$M P0 X@AP`` PP`p``P`P`P ` PP ` P@D0APQq́1̡P 0 P @!̠!X!aA PQA Qa $! !$\$XP`qP a,\Qa,XPQ $DQ,Ġ  @ qA PP)! A P`+!  P ! P p( *P& ) P%)p'pP  Q$ЍZfo^bO- Mp00RP04> Z@  ` @   ! \ `F8/V @0J#2@B P@ 0. \\:\ \ 8/ ЍO Ѝ@O-R$M pH@LE PE  Rh `P 9/   RHXP ` 0B#2 `bp` JX P 9/0 ! 0X  S RS   0S$ЍR` p`P 9/0   0SL\`p0 `C```p `0- @8T @(P@ 0vP 0$DTO-,M`p@XW0QPPL TJ 0200(0$ 2 0 0$ 1P 0^ 0( ^ 0S!1 0 ! 1!0,ЍO010S 0``1p ` V X @T,ЍO!1 0 @! 1@0S R0X$ 1 bR*2$08#820 000 0 0| |0 0$専 d 0 0 T0}stss} t|sr{rDrN{ rqJ@-PPMp`! S@P7 uP% PPnPP hPc 0"Ѝ 0 0  {>{x x0 0,l l0 pwT T0 0 H P <0a80l/H0z|`p`z4q0p,zpoQPC-pM@`F SD R>  UPPD NpQ2 P" 0@T=V d @TBH!H1 0},4! (1 PЍ@S뀐 0 0  0 0 0  0 0 0  0x x0 0l  `0,p(p`npn(omhHnm,on m$omLmnm"\A-`MPpS@P  07Ѝ, ,0 0 P 0kmlC-RMP0Ss $`PS@P{b`p@0@@@@@@@@@@PK@P00 Pm` PuL 4P00/ ("(2 0 "   0AB2@P 00AP@PP P !1 0L! {0Ѝ!1 0 x! 0 ЍT!T1 0 H! s0Ѝ(!(1 0 !@ 0Ѝ 0 0 @  0 0 0 @  0 0 0 @  0X4p L.pumxkH$t|ljttljltk|j4tk@jskjskisTki00 l}0@-@M@00PU d d0 0 X  ? Ƞ 400 @ Ѝ0}},hjhT}@-`M @pPP  @`0` 0cP Ѝ` `0 0 T @ H0J< <0 00 00 ?wtqig>@qilgJRPO-P R 0 S  P0 $ ``PU0  S`r`S`Q Vr $ Pl D%D5 0 8%  5W]f R R4 0 ,0L0 @@@` P4 @T ,P QP@@` 0S|  R5 R  !00 R RR  wPL 0 00S~A R 0 Sq 0Sqm !1F e0 SR P 008 000  7S  73/K !6@0@n≐ ]pP  V8 00 0PB@@P`H0L, 0 D k?'$"$2 0  " 0 IW 7S 73/DV $ P !1 0 !  x1x(0l@P  @T)D!D1 0 8!81 0  ! @0! 0$0   0 0C , 0 0 ` 0le(b e$!0a_e&_l^c\a^@e@^Z$Y^@ZXd]YXD]YX]chYW\(YA@- @@ 00 0@Xm@-]P0}0 @Vm 00@- M0 P@ l0]U Ѝ0@茈 PᆈUЍ0@Ѝ0W(\WWO-@StMXpP PQ  PU `P oR00?0` ? p@L44QP0M 40@T82 TϟTTTT/T?  0< ,@D H0 P 0\ 0Z( \W 0S,0> @T4< R 0`P .> 0 . |>`0LH R00 P 8.8> 0 ,.,> $N.> 0 . >Wr WP 0tЍ0110`Q 3 R W/ H RTVfAW" RW^ @-@= 04- (=c@W R:R-= 0 , }@\:0 9 $m$ | 0RTST0 QWT   Tx) 0<p G0S񏐋00 ` 0'Z ) 9 0) 8)0 Pt R80  ( 8 P R R0pȟp    L(0 @8 QT  = P0`(T  '0 ` Z>q R 7 0 0' 000 7\ 0 R=  [0  0 R6  [ 0 M `S.0S\0 0 B`Pd` P` p@\ PU fPd`@ p  R`P  [  ` 2 0f $0 (0(0$S  0[0 `0 R  [0 hPl@l @h}TaXQ lv R ln@llT H%H5 0<% 05%{((50  % 5P$4 0 $ 4 0L0@$4 0$ 4tЍ 0 40  |$ p4 3`0T$T4 0 H$@ 84)\P`@p $4 0T $ 3[30 340L 2N7 `K/@d`p `PT0SxSxx3P0 0`3lj0PN sJ 8ß0  3?TPTP"2 0P " 2jBTQ ( 9( $PT0Sl@ᄄ0 l@l凄T l僄 T w}@4"42 0 (" 26@WV`[]TVT`dVPVZ_[U>t$Ѝ 0 0,  0,d$ЍU 0 q 0iX X0 0 L  D0 TNdKCsMJpCDM $CXLBQO-LM( $0nP $4 0p $3 0S sc#3 0 p` P @ , 0040S$ 0S$ 0S!0S!R R p <R.00<0@04 0 , >0S񏐅lmzL0Sp`00 20PU(@ Y} $ R 0U$0000 1@ T{ t"t2 0 d" T2l R < <@P 4"42 0 (" 2Y<@0LЍAJ  <( R!1 0( !  1 7000   !01J8140 0  1<0 H< 0 0  0 @ 0 0  0 0 0  0 @KIA AHK`I ATKIHH,@jIH?t I\GX?NFG4HUGHF<>fGE>O-P44@-@0 \@P  p@-M @P ԣP`6e ЍpA- M@pP 0000 00000T0` d$! d,@0S  @  0.( $0, Ѝ,\ 0  X p ` 0ԷDGh=H=@- @ȷ0S L @໷@@ ෷4@賷(@@请@૷,=`=0==<@=0O-j D,Tx'#GM Yp + P; Gߍ \*@ 0 Z+b P:V  )PPT [RK BV0 RD S( S! S S S S S V  BV  B V  BV  B0V  BV  BV  R  V V 0V| Vy Vv  Vs Vp 0Vm  R Zf^0 c(  PR0M\! \ \ \ \ \ P R=P R9P R5P R1P R-P R) SP2  R! PR@ PR` PR PR PR  PR PR0 @ P"Z` +:V>GߍP`0&@ SP \( \ \ \ \ \ \ + `"`P@+@   `P&P@ $  S% P` @&@ ` `P@` P+ $ @&`+P@`0P" SPC P5 Gߍ Z`P0Z@0:  PVP PT\PK` @Y0 RD S( S! S S S S S Y  BY  BY  B`Y  B0Y  BY  BY  R Y `Y 0Y Y| Yy Yv `Ys 0Yp  RZ_^\P 0e. `@VPSX' X X X X X @PPB@YP=@\P8 @RP3@QP.@^P) U@& 0S"`@V@Y @R@^0@S` @P @\P  Z`@ZP7*@)^0N P( P P P P P P, `@&@ )` ` @",` & ^# @ $` &`@ (`& " @) ,`@,^N@4޾"Ƞ8A-#(MLh@P&<Ƞ$,l p@a  $  0P0`S ` P $0.& %0,(Ѝ \ 0ش X p  0ȴ: 22/1XX@-M0@ 00 @@@P  @ Ѝ11G-Pt Qp `pSPP PxU[  P P  2/PlUP 0P P PbUG P P PXU>  P P  2/P 㚳 㗳,P 0咳,奌,U4 40P P pQ8`X@  Q0P& PP {PXP PP P P m k{O-P`@5PA 80S@00c80)P5 P`Pp2 ۬ P $ 00奬P( άP, P4 QPP 0匬p8`P % LDPP\* T^'ދPP TP !i`TVTz V.p` p R@Pn^k0 0NP8@P 0SI cx8 L80 S < P P P P P P Pp080<  80 80 80 80 80 S  8pp`F_Nb= p`P@ S        PT      p`m$2$Ÿ0O-  MQ i()"D\ i4%`;PK 1n2P@X \`p-   44Ep8`@P%PP@ 00 00P 0, P,- ,0 N@P ! Ѝ(L`p, PH`X@Dp @PLP T0\@ Ѝ @ 3d+80S /@ AR <1\ P/P/Q 0R05!b00#//R@-@ 0@T, )O-!bq@M`4 :堶YPP,<0W T( `BV(%$ J )ZP.` Y.V!8`, &YA .Y Y `ߍ0J 0CP,  0\ 8 0P   0 R |h 0\ \ 0  0㜪Pu0P} N <1 81@1D1?1tP  ⇝PQ   wǟ 0㶱^/0Sx0 N<1$81@1D1?HPy $  װ$ XPm LQ 00DƟ 0ヱPVP  Rf v0( B Q3.10+* {y 3 @ R:p(@^6,NPN &Y1 .Y Y/ Nz@   014p 0P4N⼜PN\ 0 N<(8@D?1帜P8I ʜP R 廪 0P*^ N<,8@D?匜P 原 9 圜PQ 卪ß 0̰`P W OPip0 N0 SP\Ѝ  8 S Pr D^ ^D6  !P P APn 4P4 P@$Z`Vs PHe%)e$+PL H6/P0 偮@S $! *DŽ S9@T b" b,HLPH4/dɟ @T Hn.+4,n"PLH4/   1 0   ZP|P Px H P`H@0\@D00^80 4傲P` POdx`VPZ@  @X@,P$,  $T( $ Ƞ$8,H $SR` R0S R@00P Ф 00TPS   Pn Pi P,'@T 0c# c*HLPH4/ @n0 A0@ <#48#G@Tld 0S80g * +(@0  PPK PH^ PGH`$ PgD@(+Ȃ 8l,c#. ,c4"l+ @D0P! P  HLФ P`V Q  P  e@P Pj \4. 4!(@*0JĠ D.00* P0S R @06ꈤ  $@-@ D"Ƞ,(X@@T 0 (N^\  @DkH+a!$*4k,H@a*TPᚘ P P ᒘPD @8!j*,k(+,"< j#k \@D 兗PHu R 0S  "PY 4 Pl,P$ @1/P, 0 3/PY $@@ 9/QuZP$ R0 @@XP (P D @8!@j*k(+,"<L@H@j#k, PTH PwH0S /PФx ^K $ P@T H$ , 0Ju  Ф`> 8 P8 < @P<0  <P ` ^ $Pإh` 0~ФL hP"8d 876h5 h-0 M0$ ЍO-K[|M@4<` Pp0 S|Ѝ @QS P 0XĠ^#!(@ Q 0;D @ 廫 \ R  h PP0P PPSY P @^I@(0 CSR@@DdX$n.%Ġ,!4XPdD"n!$Pd@ @P`E$PYP X PPD@(!Xn.e8% ,$#R03/P5(0< ii  b0,3/h( @  e 48 嚣ß 0٩ P!ĉ  g`V h 儣l 0é P ,`v8ß 0㵩 `V Tl,!$ˡ\P%P  H%0 0㻡\50 e@Z0㬡 R`p 0   4( @ Ӭ0 p ppp T:T P"@@@徬4@X@H<@@ 0 0 0 \H$:$$hHx4tFXH4\ FL{`tK(p44|u=@-@P M @0X000 0 080 0<$@ Ѝ@r Ѝ8@-@P8(0(PU S  0-2(0S8@h0H 0P` P/0(P/P/( (0R,/p@-`M@PF1@P< (0(0,0 P' ! !80/4+P00" 05 0 0 0T080#Ѝp880 0#ЍptdP/@-@P0S0S00000p@-t M0 000`0BP0A840 #(@T 9@T ЍpT8@-@P8 P}0,0  00 x#8@蔀8@- @Pj,0@S@8$0@-dB M0$@0D0 @  80 K#Ѝ0@D0P 0/@-@P )0T  00S$P 0(P@0A-Pp`d0@P% PP@@P0P$ `0P( 0,P0P4P8P$$D0 0"@-@Pp `,PU$$0.0"PPD8@-@P P@880P/QP@-@` p,PUA0S P0 0"PPG-P `pX $B R0SR 3D0X X G  0 0(0 L "8@-@P8 PT0S 0T008@mO-p PM@@`Tp`# 00040080 002"40S8  [ *[ (\ \ [0 \@T@@@2Ѝ^p@-PP PP0a/0 `"~@T P@Tp  0  /0 P A /@-@P~0T  0/0S,P@c/p@-P0`/@P y~P+/P`, 0$P@@(0 0pppp8@-@P~0(0  00s/!8@~@88@-@P~(0@S@~8@-`@pu~(PU~~0 0f!P@-`@pW~(PUnr~n~0 0H!P$A-PSQ= P/€X1pAp`D* S' H`BHAC RڨpAp` @\ S @ȠLȰZ` ȠLȠ@  w<A-`SQC PpR BqW5E*@@P, !@ XlB XA@CR B!R ڬp p LT Ƞ@I@@P P HDHZl Ƞ,Ƞ HDHPp  L$PxL0-@SQ% P R ڄPAP P0/HPRP0CR 0/0O-LA,Š0@-Q@ 0\Z<0/0=000@8000S 00S S00 ///,)@-RL8! S 0S 4 R8 0RS\0 S,)  3/T9@-SMP (9Se (0Se 49S 1`)PЍ(94ɕ(@|!T4Ʌ @TILL~pn` ( 0, < `Ʌ0? 7(9? 0<7D80(900 0 `f( t0S  3/LH!} pT@T `V(900T ,P +G8`ЍD88040, 0:X x  0O-̐M00 00B0 @ ,0S 0S bBWV:Ѝ  00H0H 0Ѝ0 0(0$ 0dO-M͛P: `@쐟쀟pP`@ p1 3/ PP lR 0Q00U 1 Q  1D(0 0 L 0 UP 0T9UPЍ̗(T;T9@-S@ 0T90$ $S`Ʉ 3/X 0uC-M0@pPTP`Ѝ  0W q VY 0& S" :0P 0ad`0 @Qd(`8 !0@ G`8DP D0@@0VsWV ``(d8 0@ %d8l DPD0@ d(`8 D 0@ `8, DPD0@ Hi4hh hQPC-@ MPp R G0`\Y#  !/0P P9S Ѝ(9  , W< 6P 0S  3/P  T:0 0 ЍCx\YQPC-@ MPp R =0`\Y  .0P P9S Ѝ(9  , W<5P 0S  3/P  :T@-@P<P (PTf|l@-Hn`TPp 0W@THU 0W@UG-P@lFMU0  8<4; R~$ Rn$ R#  Y<8   5X\p 5`P 㯿 㫿  0K5 0F500 00800x0x `P0!Fߍ` ㋿Lp 0?B1c1@0P U1 40gfffA-pM|`PC'@P 00 0ЍO-pRM@@D `PD)3@.0T |3T jx,0T00H2 0$ 0ЍO[ X <4P\  ,.P `8@T`ȕ@ T < 4P \\4P `80T 8勮 S_ 0 S  R R0 SYO Y @8SN 0S  P Q0SX< !  -Ѝ<4P 0S0 S 00D8@00001,!0=fS 00 ,02PW T8k&PO 0, 0,( _< 0 \@P1 `8  @@bpPO-iM49S0 @49 U 0 3D80 0000380#@ `0Sp p0S  RWp 88 \p10SW[ d8lS0P0`30T#d8@T\ @ß `^p d8@0TL   00l80@lH2 0H 0|Q؁ YXA0 \Q5=w$ XT0\ `0>5*Pp긻0A*)H dP P P (/ ///SS($3C-SM@P S Ѝ4@d#dܻ8h&hpS1, 0` ŹЍ C-@PBM M`0 844!0PpD8H10V% 00 @T `8  @ @V4@ 2 0H 0l{Bލ Ѝ( 9P0 @(p0S  3/(.ԻA-@PMMP0 A,,!0`pD8(10gU% 00 Z@T `8  @ @U4@ 2 0H 0{ۍЍAP0 .@p10S  3/oPO-@zMMTI`_h(΍d8`ȟ`). ~DP៲P U pW ȟ ȟ ȟ! (ǟ $P , PPUe uP ~z v@_P @P ` p NP D GP ( APH , ;P"@:P :N a᪄ X8S <!@P 00 # 0! 0 0,4 0`P8(0@PHzލЍ$P ߭1SLH T Ɵ@ Ɵ ş ş ş $ş So @ T  P  ,0SP50 0/ $0@  3X5X%(0 10! @  $ 0@ D ,A6Pg,Pd `p 70, J<0 7<0S:$p 0 pPP  `8PPG 0S 3/<0X0S:^>0 3%/ E$0@  з (0Í$4Í 0@  ÷ A0@  廷,5?P.,P+ B@_00 4Wt2S;  3 !0O 3, @ l  X8S 0S"   3/00 4. P@:޹P 1Se t2SL" 0d0C @c Ό P P} @   `c   \:㯹Pi :N aQ ᙹX8SPY < @PU 00 0 `d 0    # z  0 ,040! UP/ w 0d0C @} \" l+p A !͆ |'X ܏vԸ X@0T|,T9S /A-BPH@P y1H"0H8l P 0l9p P 0p98N@T  08S8NT  08Sh8N@T  0h8S`P v0`8dP p0d8LH!} pW",0S h4,`00 0  0  彸LHT `V V,P X=,\P 00\8᧸LO-M4p`P(g $2$0@ D 20"P < !0@P9T9%Ά!.> hlȆȆLP((hi@_@`@P 0Z`00  ,< F3Ph/Ph /QPO-PCM@CߍD8b2`"0zࡷpP $0⸐x(0,`8p 0 `p 0ℶPdP pPX 0SUX` ( )d8@T'dȕ@ T" <X,P T 00` $0!80   0P( Cߍ| 0@P $0`!80 0  d8  @ @Evtd(0ሰ[ 0000[ 0S<F,P d(D80 00 0Q30 e$0 80  0ᶴ<p@\hT\@?t? QP@-@``PR 8pdp0 @⑴d 0@D⋴H>QP0/ nSQO-`e<Ѝß3 0@ 0|#0 0p3Tlh#h  `# 0 ?C;0#03 0 $# 36( [0峵Y 0SGpW 0}0CR2 @0Pr@P00p0 2 RZ ,0S40 [僵 0 1 [y$ ` PV `{00 0@` [ ^ 0Shl `Tg R;a `0;\T!T  L! 0 ,1岉(K`0` 1 B0 @ 0P0垉7 0 0  ? , 0 0  0  ܨ̨0\L$ PdإĦ 4y$@yt} Ph$hԣ3/HC-TM@P1WPU@PPT sp PFbr2`0p@ 0^0p2  +>@PpPvD@PbGPP~m4@P! lŸl2 00@ 0@200p@ b0"2 0" 0TЍ`&E` F`G`H`I`J`K`L`M`N`O`` \0"Ƞ T!T1 0 H! s0 @ĈTЍ$$1 00@ 0㵈TЍ0 00p 0㦈@TЍ0 00P 0@ᕈ 0 0 |  80㉈@ꐎ< x(L L ̠dԟ Pܟ)@-M@  EЍ8 80- M0 $  0P Ѝ丢8 80- M0 $  0< Ѝ䜢ȡ 8 80- M0 $  0( Ѝ4xX@-P8@-@P 8@z8 80- M0 $  0 Ѝdȝ8 80- M0 $  0 Ѝlx8 80- M0 $  u?܇ ЍРH(8 80- M0 $  0ɇ Ѝ䔜ܜ8 80- M0 $  >㵇 Ѝ8 80- M0 $  0墇 ЍH`@8 80- M0 $  {?㎇ Ѝ\@-M@@`@, 0pPP  @寒TЍp p0 0 d P ?dЍ@ @0 0 4 @ $0UЍ Hx @-@M0@-M @0 PRP  0 00@j hЍ08n걛ꁝꊝꦧMZfw@-Q@-1O-@M(,p0`4P@2  0(,p0`4PЍO G- p$`(P@+2 p$`(P  0G ꔗ;;;;[?;;;6p@-0P`M@0P`0@ `q0ІT T y00Ѝp@Qs00Ѝp@K8000`@ y0㶆Ѝp輝X4ll11r@-M@@`PP#@0@ R `p`p 0U?p吆=73/t00h0p 偆ЍH H0 0 < P ,0sЍ((|hWO@-@PuMG 0SD  RA 0S> 0S; x`I_ j f; pO Q W  Q  @ W 㞱PuߍA;Pw : <PCuߍ/A- M8`VSpP<@ RT 0 p@P Ѝ Ѝ@-$M8@pTS`P R  0p`@P$ЍC-$M@pD`VWP@ SR H0 0L00 0`P$Ѝ$ЍC-$M@D`V\P@ SRpp H0 0L0 00ppx`P{$Ѝ$Ѝ0@-M@@`RPP 0 00 0 $  =aЍ0`Pp@-`PM@& 0 0 0 K|0PU g`0 Ѝpy.4 P Ѝpf P-4M! 0 0 0x 00 0 00 $0 $$(0,4ЍdИHQPp@-@MP``V < 0SA0 R=010000000 00#300<0#100000 0 #3100 02 000#2$0001(000,0 0!"0500 0 #13400080Ѝpd d0 0 X  K0㝄Ѝp8 80 0<,  40㏄h0`HC-M0@PTS``p< ᐯ'1 suQ 0pP 0Ѝ4 40 0 ( P @ ^0U`4`O-RS$M@`ppHP\ PZ 1 0   01``!1   Ġ̌!Č0$#̌@0ĠC4Xp0 0 0p  0$Ѝ1" p   0 z00000 0pT T0 0 H  z0܃Xpdd 8ܔ|SP@-M@@ R Q >Ѝ 0 0 p 00 0㧃HH D  0 0㖃ꠒhTdO- M0PS\8@: P8 0R00 Rw000c00@0p`p඀  Y((" 8@㶀ClC4 $ d0@` Ѝ Ы 8 80 0 ,  0>$ba|dSPp@-M@`` R Q PA  ᩫPЍp<<00  (  @ L0LPQp@-00M`>R< @Q@ PU PUPU UPU) 0SЍpT\LPU PUPU UPU  TcЍp\ c<<0 0 (  ` +0㴂갑<8@- Ǎ@P  K PP K*㷭88ҍ8@-@PP 00@{QP-0M6 B\2PP 0 0  0mЍP PP `   `    Ѝ LL H  0  0>PO-SPM@P@`H V RUQXPppx'@'|tူ` pR񏐘,PrH# p  ps"`p(p "@Hp e p e0 0PePЍ   p剓 \`‐ , ,\hTp( "T p pP H ?0 00Ѝ p P p , sp`P@ X %@  @ !O>0Ѝ!  刃|"@`  ("$P !O>0Ѝ1 0 P 0`Ѝ    0@` 0Np0 0 P 0?al l0 0 `  02T]\[$[Z̍ll'|$DP Q@-@ppP;R9 0``VQ. Q A D⃩% ` D@  @Du@ ` 0`N`` Da HHG-SPMP@`8p@0 W RVQHP.Ƞ@. ဠ_ R񏐏1Gm2 00 #8#4 0  0 0 b @00  0?0  B0 f0 0`f`Ѝ  #$Ÿ    00 00Ѝ,`#,$!$   0̨ 0 0b @00 0,?0"=0`!幨\10ЍL100, #,$8#40 ⥨ 0 b ?00 0,?0`"=0 0 ` 0Ѝ 0 0 P @p Z?ll0 0 X ` [?pPWW8VU\UȆDtt/A-MwPPL \A\@"0S5 DQDaD1Dq0P`p 0W0`"@P00[0`00 a0Ѝ00 0[0` @AЍ`Q Qt t0`"@ 0X X0 0 L  L0pTS8SxSl  S|8td@-൨X00 R HHH  dhl$HRTRQR@-PPM .O0 00CPy0 Ru pbprp`p0 )0pƠ@P 8P  ܩޠP  ҩԠP  ȩʠP  ⾩P  ⴩ච`P PP P P PৠP00,1֝ЍᏠ C⏩ሠ ∩だ ⁩ 0 0  %0~Ѝ 0 0  0~l00 0p,0~ljH꠆|\<܅x܃Գdl!O-hhqhh~`V000 00~(3L  0 座8 3 <ЍD@ $O-DM0(, (0,0004080<0@P(0 RV1崱0 01q嬁0$0`800 <0pP4@00P  8P{DЍx x0 0 l  `0u{X000p @0k{{xwxydywPzwvzTwyP P0- M0 <  40M{73/ ЍtvyvA-A(M@0S $E  BPP0 RO !P@  @ @$@lalq`p4᭤X1 00H1Pp {R P $Q$1P0 0p1z0 S 00@P (Ѝ 0 0| |  t 0 `0z00(ЍTB\wvu yvtApx@A8v@@vwt/ 00@- M0 40 P@z0 0 \tP@  \BT T0 0 H  >0z4 Ѝ0wxw??<?wwwh?00/T?00/@?00/,?00 /?00/?0-1G-Q0@ `;>l>pv'Lv=u& tu0@-SM @`@@p PD 00 0 R 4P pW$@Ѝa(!"$,a$"P P L"(Q@ 0 1,0q01 00PtXP3P1 0=P5 ኟ &pP6ẝ1@!0܍Ѝ0` 0 ܍Ѝ0`/0at0tl 0``0pgpP 0l$l`a_`_h`p``_8_|`O-У&M$M΍^ @E+`EvpE대E6_>0\#0 0_.0PRPEY 0Pe0 % PPoRkPih0PqePP}VU\PP" VPP ͞\2 0 ᔄP 442,"0G&ۍ$Ѝ+ 0 00>01!0441_&ۍ$Ѝ+ 0 00c0>0|1/0+>0PP1PeP@!0+ 0 0 0c0>01!0+>00PeP 0+|>00PeP 0+m>00PePx 0"(```l]`a\D^D\^\^-[^:[,^BL[<^M[h^VO-M M@PҞpP" ˞PM ŞPK ࿞PM ๞PC 1/0ݍ Ѝ`V pHx  {P1R0  !  0N:00 H@ a  0MP ݍ Ѝ``````0X 03HH0@ 0*(^^X]]Y]h"yPQP`I4E42S8K PI &>h"P4$0S'82$0S/0PH28@`P4b8b @b<P 0R0<2$0S0$082$ R $ $0S 82$0S0H2P0H2PPtt0l 034\\0T 0*P4@@08 0 4'LUVdUVh"PyJP(,(2S0n ,2Sk Pi &>h"/P02$0($\$,$ R#S#((PPw 0D2`,(2$ Re ,2$ RW 0"$0S0$01/0,"$ RS`ЍL xx1l!0`(,0@PP(R,R0R F@R<P 10<2Ѝ0 0~0/0v`0 0m $ 0/0c $ 0/0Y(0((jP00``D2'STh"mP 0L2,Ѝ0\2[k?(!&>h"  PPPP P$P`PKPHQ P p0p$ `%P `0Ptthh00\ #0QL2@@004 0RL2(PQOTQ)@-p1LM`d0pP t0p03?@'U ( k?0 S0+ Q) 0S$0S0$0U k ܚ(0 P0  0WZLЍU WȚT 0$ 0LЍ0`p 0$`@ ((0p 0cQOHNOO- M9tP7 `@pX`@ p1 3/ XP xR 0Q00U 1 Q  1 0  P 0+ UX 0\2UX ЍxMMO\2@-SM@ Ѝ0\2QL”!&>\h"D2H"S S S* 00 0 0L21S k/L"3/ЍR R RL"R0L2 R0L2 R0L2R0L2 R0L2 R 0L2LNSQ@-@4MPp`4Ѝ00 0pW` @ @ PP000 0S@@ 0xKMA-@PPT``\ 0 Dp0@K?` [?@[A-aM$00$!0 (1p 00 0PS`@P .P&A$BXR\RXPP XPP P l0.PR{PЍ sD 0P 0X@JtL H L(8@-@@1@4!0(QPP VrP VrPP &Y0P0P2(P A0(2,P ;0,20P 50024P /0428P )082@P 0@2<P ,00<28IK2LPp/Pp/8@-P. @"8'p@-PR@`PP   0( pM00SЍ/Ѝژ 00RR/A-pP`4@P =O  0UP   4`@@  R` @000xV4!Ce@-@PIO 0R@蛘0T 08IIHp@-PP$ `=O0 @T T/ 0 R"0 R0 00 0@@ BOp>Opl0ll0 0h MT0TT0 0g D<0<<0 0f ;xV4!CeHIHGHHGHtHp@-@Pp0  PR0 R`N  0 0 0DA 00p@NH0HH0@0w 00000@0x xV4!CeFGGFGxG@-@  㑔@-@ ㉔@-@(( ご@-@ y@-@FF q@-@ i0@-S@ @ʗ@-@ P ė@0@-S@ 0@趗0@-P M  @A  Ѝ00@-@ M P0 0 Ѝ0p@-@ `PU ᵔ pG-≐ Q@P`| T D \p*`p `@@ T⊀$ @Ft\X@-00#R“\0P @!@ P?1P@@@0/0 ,,,0$ 04HEE`DE|E@D /8@-@P8p@-PM `@ @Ѝpp@-P`@P@p&'@-`p@PP  p@A-@Fp R DR `Bhg0`@ T,ąSpp@-PM`@0 d B0 0@Ѝpp@-P`@w R p@p&'"40 /A-@M`p PU U Ѝ W8ЍW P P 0SX 1,!,a00P  ! 0S@ 008#8 S0`fV; 0`  0 00S 0,0!!, 0᳒ 㯒 0`f V 000|  ⟒ 㛒 0◒ 㓒808800( :'!B?AAi?0A@p@-@M P \`00Ѝp 0L0 0R 0R  ?0d 0 7P@P @0  0ڔ e0@B!"R@-@4   008@-@P    8@-@(0@0S0@/@8@-0@00SP8  ("( R 0 0"$ 8#8S:0   88@- 0@0RP*8   ("( 0\ d2`00Ϡ"l0b0 宑 0 0008Qp@-@P`  } 㕑00pR /0  <8/p@-P`@0S@p&'@-"Ƞ"L"4@ 0@/R8@-P@D8 < 8  008p@-`P`!@ 0P@p@-P M p@`V8 Ѝ0 c  @&'p@-P@P ` !p@ R0@-l M@ Ѝ0P     00 Ѝ0$00 S  / /:  P P P 4/,/$///t:TP`:h:l:@-P P:9p-t` `@0(P\@0S 4001( P 00A,p/@00 /QPp@-@M``PЍpS` a 0 _P``0S 0@0~|00  ^U  XЍpi N'(7TAYUT,SPA-P@p`  0A'!p@-R`@3/!@H$HR0QU 80P 0Sᄓ! p@襒!@-@@sQP0 /!R Ñ/'O-`MPVP@pЍY RY<   c ͏!IR 0P Գ P " `@ @` (`"( 0. S b *p`V 00 0`V{ [ AF F/F0PRp 4 R 00PD !`V! 0 0`V [AF  P@4 FP !1@    0$P*0\܀  1S4ЍX``0\ `p X5 70PK` 7آßd" T X@VPP2 A S"Ÿ  " 0 ?SOYzph"\`P0 | 5Y  6@PS 51"2 0 " 1SX` 59!1 0L! =nSZ!1 0L! 1aSM!1 0 X! ?TS@l!l1 0 `!  X1HS4L!L1 0 @! 81VV V` V`U 0T {001S01V`( P `P g~1S0 S! 3/at@-@P -z 0SE:@-1S0 S! 8@-1@!0TQPP 8TTQ XX;{ Q XO 2{Q XF){P ;100P :000P :000P :000XP i0X0 P P\0 (0(PU  0z(0Sz8(LA-SFM000P03`@#0VFߍpP -\Sw(0(0,0pP / >Aᘀ OP& $c$0P*S(03#0Q AT"  GPP L2"0=+L2"00 ||2t"0'8PXXBXŸX"  0@8<@@HD P0PP " 2 0  0 p0XX0pAP \9SX6P \9SX+P \|9SX P \q9S9S @0 P 0@$@(@,@0@4@ 0PT} \ 0@F?hP TS+oFX! #0x 0TyT@\41 |NPSFK0(P/P/@-0P !R gRPO-pM``,ЍQ 1 0@(P 0(ZZ _P Z `V @gЍP00 S(zP iPP,  P, x  03$0 0 / \QPA-PM@pp`Ѝ0S 0S R  fx0 P 0  XO-pQ4M@ 0 ԃ`P S yvPU ` "0S`S ` S00`P+X`P P uW <3<0 04340$0,30(0 3 0,00P "ux Rq\SJA  0S  `u 0Sr( Vu0 0Sc` Ku0H Dx 4 P  70) } 0S㼐 @8JT0jЍ 0SY  8u0 R et 0 @T00S 00)R@&0S 00 RS R0 RR @   0 0K@j 0 0  0KЍ v0P P0 0 D  0K4 `,t |RQp@-MP$ 0 +@P Ѝp J`VV < <0 0 0 P ` 0HK %#ZRQA-PM@``p% P#  ``JP  @_VЍL L0 0 @ p  ,0K(0XЍ6Y@-?V@-M;J@P 0 00 0$  0JЍx 8UFJJNJJJJPO-tMQ llhQhhhA`d0P @ ;p\` !PhAP0@P@ @T0$040D0T0弑(8pH`X張dF8PP  0 0  0JtЍ 0 0,|  p0JtЍ` `0 0 T T0 Jd$|D|PO-tMQ llhQhhhA`d0P @ ;p\` !PhAP0@P@ @T0$040D0T0弑(8pH`X張dFPP  0 0  0,JtЍ 0 0,|  p0JtЍ` `0 0 T > J0,# 8HO-PPWM `<@dTp @u u :s #G 1s G! !!ȡ !! (!!`p`F|OGNGMG @La@`O@ AA@0എḰepȠf ALDᴝ Po8!00,1rP ` q0<1弫DἺDL1H@PQ@P  0 0  0IWߍ 0 0  ">vIWߍp p0 0 d  ~?iIT8D%=8tXd,#0H O-@PYM ` P< d\p`]t Yt뼎EPPPL2LŸLL"L弝0DD0  d 00!ef  JJJ@$0041(8!Pp@崼JD1T1G_ߍ 0 0,  ?G_ߍ    0Gdp\<T`HT8P@px@d t<<O-@P_M 3#0scS ^ 000(8#庰Ḑ᷐ᶐᵐhß x 0 0P EZ X`p  0崙H,B0SH@Hp@-@PMP` HP%  eP H 0 0 P ` ]0=Ѝpd d0 0 X  N0r=@ @  8  U0f= 8d 4P@- iPP@- iP8@-@P gPzHUl88O-8QMP0SG $a$q$$$A`p #$=@ 0\ D$D%D=$@D LH0A0@00j0 =0AD |0PX000ЍO}A@000p0<ЍJL<ЯxJЮ@-pM`e0S D!D1 08!0 <03/!1 0! 0<00 03/@@03A0P9ADU0S 0 0 0 <03/ 0 0x@x @ 0<0 A 00AJЍṱ@H8 hHO-pB`@ЍnMbQPp@-PM`! >P@T@T 1S0 00G0 0C0>Ѝp >0PЍpnQP8@-@P >P80S 0S !R  8@> >0P88nO-P MP ` ``F( >P@ T! PU 0S 0S 0S 0S0 >P$5/ T Ѝ@ T p>P ``F 2! 0c0S 0"# 0` 0 Mb8@-@PP @>P80 08@C>80 /0P@-@ 0S   00p@-PP` >@T @T 1S >p >pp8@-PP >P @>AD AP D888@-0@`p 00=0=PAP 0 `=0S PU pA0==0 3/D0 `S O-P4MPt SDPn  Ld=@P]aaPCDP a  ;d0SRڀ1倱00x1 0 0$0Pp0 00= 0 0 0d $00  0(崂,pP@`P0S% [=`P 0S@P 0P0v= 0010@S Dj= D4Ѝ D4Ѝ04ЍU= C(QPA-P@p# C`P! @ p)=Y@@T 0S0  S\  R0==/QPA-@MP pp`V <Ql0@<Ѝ<P4 40 0 (  B0\8 87`ĞXQPA-PM@3 qp`V < ➎ 0S S $ @TP T 0<ЍA{x<P oT00.8 80 0 ,  d0 8X766P /P /@-@ P00@5Q /Q /Q &/@-P`P@ MT W<$`0@[< Ѝ9<pP 4 40 0 (  075p5؛L!P /P /P /P "/P '/.3C-M`PR 0C S&4pW0@PU*@  bPP0SЍ8@T@T  bP 0S Ѝ!1 0 ! 1Y7Ѝ pBPPT @0@0@@ @@@@@@@@@_@1 0@8 R8P 0SPPU 0S 0@ 0R @T:<; T0 <ЍC;<;@000@ t t0 0 h  \06T T0 0 H  g?6z44o 32t2̜ jp@-ta0` M@PT0 @T @!@  8!  @ 16Ѝp0P %0S S. S Ѝp  0|  00P@@0(i0( iЍpp p  h 0 06  0|1ȘԘ]00uܗA- @MTpP` Q@ Q  aP Ѝ\P@@ 01Ѝ0O-qp@$MP`UH弤 QP Q  aP $Ѝ2 P3@!R 㲢!0S S4 S 0 R@@0(i0( h" j  0S0  z0  G``0 0 L  050  z\/].0uL$t0@-PMP0@T<U:0  Q   @Õ@<R:0P l l0 0`  d05Ѝ0H H  @  0@ _05Ѝ0-T``O-PS4M,@ s夃3c0p` 03 P50z0TPR T#0 0 000003m5`(`4`V^ (00 *pZV  ` P(0 0R "  "0 |2D5x2000 d"d2 0 X"T2 25D200,PIYT YV 2@,0S 0, ]( 4ЍOg!1 0 ! G? 54Ѝ(08P<9U7PU4  k`PxA 0@  R4 `!`  X!0 D14 0,!,1 0 ! 144Ѝ1@000@000<O9000P 00  0 40t,ܔ'DȒ̒.4+|2**0u*̒PT>Qt)d)L)8)xAO-TD0 08@8@<7@j>000#d#D# #"@-`P( @@PU @4>Pp @ +^h& PP @( ePP,`uPPP"C- MR@P Ra  00 CRЍ$P[%0&0S,0' &0 0\[ !1 0 |! B02hS``p  p )^P,1\  00S{,0 @@KHI [ 0So@$2h 0  R"QbQ!  !@  |11TB @@ 0bY㔐@ pR ᕠ 0 B5@ T0&@ T"Q,0e%@L@0C1#0C B0 0  0 |01 Ѝ,0e%d00L0 Ѝ,0c# L < Ѝ0 0(ꐉ=o]G-@P MPpi 0S_ >C20CSZ,  `MP YMN H`R[ 0SL`&2S0D P S0>S0 P20 RP@S0P,#U'0 0 `00 `1,0G'0P0 QP 00 00 0m?1 Ѝ,0G$0Q0 Ѝ0 0`,lO-@PDM` 0A8#8 S*,0 R 20>48<S,P H  PVZ`0XPS00ŕX0SZs0SV0pSPb P3< SL0 R, RF00@S  0> 0S0S 0S MoA [ Y0^ Pu1 ! [ 0u B c 3!X!1 0l!00 1k0DЍ,0C# ` DЍ @,p  PQB 0PPE!,7" [- ./00  P  00p$00,0F&0a` 0 $0ଠ0 0T00 E-X g0ꌃ)Ђ ]QPC-`P `pp@T y/[`P匀吐y:P @O-@P4MX\P H \,L,0p`Va8  `V⋰`3 `•c R_0`Vcy p WT SR0V AK,p 08` " P|Qm, 48pQ0601 #  #`0 C?P `v/000` ` `` ` ` ` ` ``` ~Z괄Vh( V(0Ss ,PU 4Ѝ4Ѝ KP&  P  PP004Ѝ 3/0,0Q  S0Q00`Fd\Y  S00Awdd!  P #L  30p0 0p,.00 00 0 0 0 0 000 p,W ,0C#BR00 0.0,00 0.$\  0+"2 0," 2*0Ѝ4 z/B20@ 2 P *Z 20 x2P p` *X0VSE zm1Axm0T(0,0i $200P( ,0UP@<!,0 ! Z>*,(0$ W@(5TJ $ /`5V($0V%t!t1 0 h! `1*0Ѝ$00` P00@$!$1 0! 1r*0Ѝ$@ / 0 0L @ 0^*0Ѝ?00 0 0  0K*Qrtsqsrr@rptW qstp sqor$qodqpLor|pnq$pG-PM@Q`P !1 0 t! l1*MЍ0p pp@;T3!1 0 !1 )0V0P䠟䐟䀟 PpT  00 @0P 0 0)T5Ѝd d0 0 X @ H0)Ѝm@qLoHmpn nmpxl pmO-t嘔pP U|M |$|4 0 p$ d4)|ЍT yGp P0VnAd 0l o0 B`f@ 00 `@`  PPPPu-  --C@WzYw x0IUbi 0h M0NJ Fm 0   PPPPE- S--N4P@ /ET0@0004-@PGZz "2 0 " Q?)x20 0h20 @T7 @"@2 04" (2($R$2PP [00RP04-08?0/P 410 |Ѝ!1 0 ! 1(QP /ⴁ@P lQ?d Pi[@PHi[@P44! 0$! 1(!1 0 ! 0(000 @ 0 0  0(loTmjnXkTjmjJ i\hxhk i)0@-@ M@0S P PP [0 @8@0/P 0h@4,@o300 Ѝ0@ @  8  $0$(XP$jfgC-L2LBLR$M0@P0 P$2 (Xn rp`V 2P00 1'$ЍC3Pb ,0P- ,P<1 00 1P't100d1`0 UpP 4100Pp 1' ], 1P00 0p'@@200$ЍH,0P00 ?p '000P ">'l0P00 X0'&(P0(0,0004080<0@0D0H0L0P0T0t`Pp00Sli`ji11Spp400D2S 1@P E1SQ? 00 &R pXPR Olw/ RTg/  R< 0O} p8p%O 4 00$0PPv #3 0 #P 3b&1H"P` ic3`00`3 0M&h0b0P1 lß0 ` P3>&&HSPpW hhj> o0P`tɍ0P #  "0 2&Ÿ2 00 2&+000P\-00,"2 0 t" ?%7, Q $ tN '1$0000 0`1V? Aq@0 00p3+ 1X`p*!1 0 !1 ` p%00*0 0 xx 0 X1%P!P1 0 D! 81%0!01 0 $! 1%|!1 0 ! 0%qLb4g cagbbafdafffffff0l_(a`L_dd0,d^p_T^x.]c^ \c^\@b`\|bx]0\bH] \]p@-M P` 0PP9@P} 00P# 0@0 0 0 '%00Ѝp 0 0 | @ l0%Ѝp\ \  T 0 @0%>0[a[#ZLaP[0aZ[&6O-FM 0 & 6$@0X0slPGOL UTP0v0 Cxpc`00  P P  p ` $(,( ( )ԅU%5 0P 00P`0`,B*0PSK@ 0 <  0!Ġ!!, S %ş  $ 0 n?r$p!P$0  48<# 8#4S |$|ğ  t$ 0 \4L$ PPğ L$ 0 ,4<$ 0 48<,#,$8#4S q SP R`0 48<@p pE3 0 0` x3@ $T d EP L EP E $ Eß  ~?` `# EP  E00S2 00 1 3/`BV "2 0Lx" l2#a(`"`2 0 T"T2 #+4"42 0 (" 2#"2 0 " 2#Ѝ    1#0`0 48!`A 06P0 48,0K0.M`!`1 0LT! H1f#mB81 0 0` 1X# (E  0H#m@Y`ZYY, @`0DH`(_`8 ?P"L`'@P(P 'PG)PS'P^@P0 R( .> 0 .|> "p*0t0  S]  S.0N@0^4^"!^ ^"!0S=(`0x 01'PP-= 0 -= d"|=00siP d=00kT-T= 0,H- @=M"8 ^o0 Q@yQ| p`1^ύ"! 0R3@0 RU 4 ^1S̠t<00 R$`̟`l `200 2fRrh0Pp 2 pWhAP X Xu  AP r pAPP  APT AZP =>UA ("(2 0," 2' 00, 0=XR`ZRKDR R$Z f,P ZQi'OxYPOK u>lK>D>=IktIt<dI4=h<J=;Fp<X;E;4FFE:<;<HEL:::t:9D:(8(B+7A% EyE8XF`9aB0886@1D6@9x7B$87A7h7\B35?Ah6 A7XT@66 BBBHA_\4A|\44A4,A3@L4@l@[?[|?0[Rrh0Pp ,2 ph?P PRP?P  ?^`P pp 0\PP "2 0," 2:G, 0Pp0)  :00, 000 X0 g>|(YP=P, y p=P% y^7S  =p =ppPk^ 73/P :0000, 0|0000, t\ZPq=P  l=H^P]:0 0: 0 0, T:p00  :yP*: 0 * ;kp0, 024+4; 0 @+ H;UL]N`;p00 t;Gxh0 ; :00, 0h0 0 i>%0@- MP@MP x x0 0 l  d0\00 Ѝ0@M@ @0 0 4  ,0( Ѝ018A<3X0@2TO-PPPA$M @ `p @ 1@ PP5 1@"!1  0 0 @ [ 0 0P     ;[ 0  x 000 `0$ЍP0@00 <08@20@20d4?/1?T ///3#O-0LM `PQUc ԂԢ2Ÿ p  p  R $@4/PH$p0 3/P(pT$  p @4/P{ R0Q @@T \ 0 S  0 \ 0  @T[B$p 2/PPULЍ@ 0Q  @ 00S @y 0P @m 0@ 0`$`:/ LЍLЍ$ `AeCpV6 Q" Q Q Q Q Q Q QCpGMCpGJCpGGCpGDCpGACpG>CpW :C8C6C4C2C0C.C,CpW4XzQ  N @0@SS8p= `CC8pV85 \! \ \ \ \ \ \ CHBHBHBHBHBHBX BBBBBBBBXx `BZ1 V V V V V V V BBBBBBBZ B BBJBJBJBJBJBZJ(e P`(mPl( 0NSna8 }P[( BYP 4i  0(=P4 ( DP-( IQ dP0X 4pG $ 04XYVy p884 `FWN  Y `Vd \ \ \ ^ R `0\ Y ` ^ Q `VA 0p 0` Q P 0 Q \  0 Q \ 0`V P 0S   0 R   0YA  PPD(Z 3@  0Ap  0S p  0 p  0  Pd^U(  $ 0( @{  0, 0 [ 0s Y} ^ B 0\o 0PP b 0cB 00, _P0, 0 p2 4Ÿ 0q(q(oߍ( oߍp3(oߍ( 0^*   0K R P l 0= 0 50S 0  - 0 0%0P    0 00P    0Y X _($:::::,;86 7655656L2D1d/P/h-..---,--  Po0S(A  04z  PpP  }  0( 4 00S7   0 04, |P>4,04 0\?   0 9 0P'   0| ! 0uQ   0m `(>(:( 6@(1p(,p  0Jl$JO-@$M g`P PPPPPw<Y{p I P  P~P UPg Z. Z Z Po PiPP Pa P[PP PS PMP UP6   P? P: P30 P-0v P&P Ph P~P UP;aX @@  +?$Ѝ$ЍztßO- AMdß0 Xß0 p*0 @  p$$ptx|倰6< 2o<`` ذ#?(@TpY@@@@@@@@@@@D@H@L@T@X@\@`@d@h@l@`PN 2b P0B>@P0008Pu <ԑ qp x  t0P<8P l< f  b<ᄐ PK` Y@C@ >TPP P ?PAߍ0g0 PT=000 @ G0Aߍ 0 0   y0?PX000@ :0,'\*`'pv=t4|N$Ll'$$ĢO-t t  l 0 m?/e!  QRC-@MP`plSV Vuxb<PG \<PuH"H2 0 <" 42 0ЍCg<P <P. <P^!1 0 ! 0 !1 0 ! 0  0ЍCt!t1 0 h! 0P!P1 0 D! 0 ,!,1 0 ! 0Ѝ!1 0 `  0 0 0   0z 0 0  0lLT$$LxLH@ HO-Mp@`RW#9< RPP ; ;} ,00@$ ; @;}00ph9뀐 /PP @ 0; @;} 0 0硿` 0``:$@+T (30PR  1PP  :  Wd@h@l@p@t@x@|@@@4@8@<@@@H@L@P@T@X@\@`@TPdt2gϊ0 DH:@D0$0,P8 8 RPb`  P$P8,P 8?P 0  8  4d07@0 :TWgb0 t07d 78 1@Ѝ0b D0": 0 0 @ 0GЍ 0 0  09@ 0 0 x  l0,@b@T4L|8P< 0ЍO0g :P  :P4  :Pf!1 0 ! 18P< !1 0 ! 1 8P< 0ЍO`!1 0 |! ?8P<\!\1 0 P! H18P< 4!41 0 (! 1Ѝ ! 1 0 ! `  0r 0 0   ?d 0 0  0Vx0! @ht0<:H%/0R/(  0C " !8#8 "/ /8@-@P 8@0Q 4 0C8 " #8 / @-0 0@x @T ```P`p`Pp 0 R@T$HDPDC- 1 !00T q a p` ?P"@TU @`p @0 tqPjPUP  _ 998P X29뀉dA-@a@1`@PU ,,pPU R  0 /PU ppuPU 0P0  0  PU dl` p\ PU ^ 00 ,L0@-P@P MP (0Q  Ѝ0PdP^ Q  T ^ 0P 0 Ć@-`PP@` (0Q pPp`VU `V  T$P 0 `P`@-P@P MP `V  Ѝ  P0pPUQ PU VR  P@` PPPL  @0@ 00S0S \//hh@-d@ M@T Ѝ  0  0P  W3 W* W! W W W `1P0PP"0p1`0`` 0P1p0pp 0`1P0PP 0p1`0`` 0P1p0pp 0`1P0PP0S 2 pP1`0``p`p1p0pppP"q1p0ppp`q1p0pppP"r1p0ppp`r1p0pppP"s1p0pp`0c1p0pS"$pQ @z00/}t00  00  00   0 0 0 0 /Q-gPR`a!Q I qP70A,@\P`= V! V V V V V V`7`P7LP07L0@7L@`7L`P7LP07L\0 `@G`P0GP ` @G`P0GP`@G`P0GP`@G` P7L\PQ4a 0a! pe@<S`E0C6Gs@Q/   /Q- I `a 0AR`p W! W W W W W W p p   P P @ @ ` `   p Rp @ `P` p @ `P` p @ ` R` 0~`qx 1 Pb8Oa(ApF\k X7 X- X% X X X X 07u)p7)07r'07r'07u)0p7)007r'\1 8(p 8(p 8( p8(p8(p8(p 8(p 07r'\ Pa5BAQ  l30000 0/@-@P 000 !38@-@1P P @800880-2@\ BQY00`1P q  P`Q0E0p `P0Q<p `P0Q3p `P0Q*p `P0Q!p `P0Qp `P0Qp `P0Q SpX/0/-` QMpbQPlTUH @0!S = \! \ \ \ \ \ \0  0@@00000S   @  @   @ 0S@Vp`e!Ѝ2Uz @@ 0 3 @a 0`+C0+ Sg Z0 Z& Z Z Z Z Z :* ;( ;( ;( ;( ;( ;( S4 8+ :* ;*  8+ :) ;* :+ ;* 0 S F !AE211qЍЍ/- Q M * 0 c  `V  R &Q0Ep0AV  U (0""8V`", AP$[ p0( [ م`܅+  Ѝ/ W- W% W W W W p '0 p)0 ,0p '0p '0p )0p p p " U p 0 p )   p) p  ' p p p"p pp p)   p)  ( @K SPT0 !E T T T T T@S0S`$ *0 pS0 ' @S0P$ S`0* pS0 ' pP,`p )@P (  `&P@$!pP " 0P@S S`$ ''Q/ 00 \0 \ \ \ \ \000000 R0/0000000P/0P/00//0@-MP ] eЍ0L00@-0P@UdM\  dЍ0PB &*PQO-qM@Pp(P,b ` /.1pPG%( n.,<`n#[xT'@t.TPpЍ  0K0("S㴰  0: 0R#ᶰ `@ 0(\ 00 PZ 0 0ЍOip// 0/tk-00@-PMP ύ@ 0"0P q.P PP5/ߍ0@ Ѝ/@/2Q S02ATkj1A-0M(0pS1 0@RB`U2`10S0R 2S@00  l  0T 0 d(0\  0@ЍP +PW8@-(@P@F4P8TW8@-(@P@4P8W8@- @@4P8V0S/0S/P/0@- ˠ@  ,8@/@- @00CQ 0S @0  000@-0@00S0M0 Ѝ0 0@@0@- MP@P Q  -( Ѝ0p@-0@00S0M0 Ѝp0`0`````0P0Pf Ѝp0@- MP@P Q  ' Ѝ0p@-0K/P7@'`2 ~*) :z*c v*V 2 %*0v0p  '8@-0QP@ 0S T80S8c 8@ *:( *T8/O-DM:00}(cpy( p *80px(pn('8 S(0"(0 ("(x'Ƞ 0,pppS$ 0 @p(p"(v0 S7p#Ġp0040s0 P8`980    @Pq ) g'*(4 0 p 0pMQ p*ppsdIp` P C'0p`hW&X pW   3/` UDЍp*4&8(0xP'xX%8,(' P pXW%X `'Ġ,$h0&h8P *(#X'%X<<=0<> P<`- M   3/P Ѝ-? M   3/P ЍAQR00/R70707/O-M` '@0DP 04U0p)\ U^ PPP0PX%XF @PZ ) (=) p&0S  "4 0 )Y``* PF 0 S0010Y0#<ȕ < 0ȅ)00ȅ  pP+  ) v& r& m&   3/ P  ЍPPP0P0   -!4 M@ 0  3/P Ѝ-!4 Mb 0  3/P ЍO- MPp`&7W0#707H$Ƞ$H  Mp ( ((,Ġ %00` M (@ }00@%  3/V KRQO-`` @B$Mp, 00 Ph0`S &P(WUL004 Mp ( N(`&0@ $  @%@Z`,70#\0,`7(0 P ,M@7 #((} 0  0`%, 3/4U Kpp p0 0`  T0HH H0 08  ,0x><L-O- MP`p&7V0#707H$Ƞ$H  M` ( '(,Ġ ,% 00@ pM ']0 0%  3/T KH-M 〣 0 09 0J K@BH-M /% 0S000KH-M   0 o0KH-M   0 ^0K-K/H-M    0S 0Q0  0  0 , 00  00  000  0 0  0 ( 0 0 0 < 040  080  0800 4 00 4 0,00S 0,0 0, 0,00S 00   0KH-M 0<00S 0 0<0 d0S000K- M 0800 4 04000 8 0,00S0,0 0, 0,00S 00  B K/H-BMM  $ ($ 4 $4R T 2e%$4 A>K0C+-% 0 S0s #00 S #00 S #00S& 4 400RA>K0C0CA.K B B A>K0C0C A>K0C0C0` 40 0 A>K0C0C0 $ A>K0C0C00 A>K0C0C0A>K0C0C  40  400 $ 0 A>K0C0C0540 040C0 000  000  0 $ 00 $ 000  40  0<0 0S000S0003/A>K0C0C A>K0C0CRK!!4!H-M 00 0 0 010 0s00 0 0 0 10 0 ,% 0s #00S   0R0s "00 S "00 S&K!H!H-8M8 80 1s 0B 0S00 00 "0&s0K㵽 0S04 K  $40K㏘ 0S 0603 00 00 0S080 0< )8008 a 80!0K !HH-M 0 1s00KH-M 0 1s01s 0!0 1R 010 !00 㠖0 1ޒ0 !KH-M00S 尯 0s 0-P"00&S K"000c#0 00S ㊯ 0s 0 0"00&S +"000c0 %0K蘍))H-M à 0 0| 0J K@BH-M /" 0S000KH-M 00%0KH-M 00$0KH-M 0.00 0. 0它 0F 0 0,0/0 0.0 0 0. h0吃 0( 0@ 00/0 0 0Kg%0K耄.A@BH-M 040J"0S 00KH-M @10S0400'00 $ 0S09g!00S 020 0(0S 0$00040 00 $ 0S0S 嶑 0S U$00 0(0S 0$000K蠍)H-M I0 0 0 0R0  0-R00S 000 000 h" J00 00 " >00S000000- c# +00S 000000- P# 00000- ᓮ 0s 00&SX0 0 0A?R 00C0 0 0K褍)H-M 00D%$0S 00($0S 00KP!T!H-M  00 000$0KH-M 0 0 04 0Kh h0?" 0 0S 0$0 0 0s0 00 0KUVH-M " 0s:0KH-M 040 0 0S+ 0 0*04 0  0s0  0R00 0S0 00 0 0 0 0 0KH-M 040 00r 0S0 0040 f 0S k00 0 0KH-MMH3 K<3 K01(0 (3 K00,0 3 K0000 3 K0-!K00 00 0( 0c$0 $0 S:$0 0S :K0C80CK,$ " :K0C80C,$   0s00S 0S0s0S 0S y00S t00S00 f0S00 dc0 0 M :K0C80C  00c0 s!4 40sR00S 40s 400 0 0E00 S @00 S 00 600<0 03K03K<0K 4 40s)00S 40s 3[08#8S 0 00  0R0 ?K 0!K 000  (0RS:0s 0 K!K-0KH- M 000 00 0 0-!K 01 K " 0s 0 !KP !K 0-00c0 !K -000S 00S 00XS 00S0 00KH-M 0.00 0. 0| 0 0 00/0 0.΁0 0 0. p0^ 0 0H 0܃0/0 04 0Kc 0l0K耄.A@BH-M 0-R00S 000 000 a  J00 00 '! >00S000000-  +00S 000000-  00000-  0s00&S0 0K訍)H-M 00 00 140U/K 0 ( U?KY(0S(0o?K(P0S 000c0 3 0 100S 00 0 10!U/K 0 U?K,0S00 e1[!0s000c0 X100S100S$ (( 0s00S 00_S 00S z000c0 2100S ^00 *)1K 00 0"KUK"K 000 0 (0i  U?K 0S (1 0c0 (1 ?K 0"K0S0S00 00 (倍 0S 0S00 0Sr 0S 0S00 0S 10U/K 0W U?K 0S0 0  b 0KA @x- M  0  00 0  00 0 !00 0 !00 0 "0" "0& #0# #080 ? $0$ $0H 0` 0L 0d 0P 0h 0T 0l 0X 0p 0\ 0t 0X 0x 0\ 0|  0%  0%K/H-xMx | t0Kx, 0St0K|0KH-xMx | t0Kxw 0St0K|w0KH-xMx | t0Kx 0St0K|b0K-M  00 01 00 0c0 000 0S 01 0 0R0S 01 0 !   01 0 !   b 0K/H- M B00 000 000 0 0 G 0  0 0R 0   0S00S 0S 0S0 0 +* 0-R 0 0 ? 0 - 0 0} 0 0 001 0 00 0c0 00 0 0S 0A/0R U 0 0 0KH-M 00C 0 0 0S 0 0S 000 0 0 00CSXljhldmllkxkkTmkDjhjjkhk 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( @ 04 040S 00S 00 0 00@  00w0 00 0,0K,nXiH-M   0 0S0S 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 030S 0 4  04 040S 0 0   0 0S 00 0 00P  @00 00 0,0K!!L!,nXiH-M   0 0S0` 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 0S0= 0  0 0A/ 0 0S01 0 00S 0# 0 01 L  -0S 00 0 00@  000 00D 0,0K,nXiH-M   0 0S0P 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 0X0S 0 4  04 040S 0 0  0S 00 0 00P  @0:0 00 0,0K!!u !,nXiH-M   0 0S0M 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S-00S 0 4  04 040S 00S 00 0 00L  <00 00 0,0K!!0!,nXiH-M   0 0S0M 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 00S 0 4 > 04 040S 00S 00 0 00P  @0u0 00 0,0K!!@!,nXiH- M   0 0S0g0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S0 4 0  )000 00 0   00 04 040S 0*04 0 0 040 00 0S 00 0 00@  000000,0K,nXiH-M   0 0S0M 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 00S 0 4 b 04 040S 00S 00 0 00P  @00 00A 0,0K!!P!,nXiH-M   0 0S0? 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0  0   - 0 !0S 00 0 00@  00D0 00 0,0K,nXiH-M   0 0S0M 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 00S 0 4  04 040S 00S 00 0 00P  @00 00 0,0K!!\!,nXiH- M   0 0S0j0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S0 4 0  ) 000 00 0   00 04 040S 0-04 0 0 040 00 0 0S 00 0 00@  00e000 0,0K,nXiH-M   0 0S0M 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 0!0S 0 4  04 040S 00S 00 0 00P  @00 00 0,0K!!h!,nXiH-M   0S0S 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 00S 0 4 m 04 040S 0  .  .0S 00 0 00P  @00 00F 0,0K!!x!,nXiH-M   0 0S0` 0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 0S 0S0= 0  0 0A/ 0 0S01: 0 00S 0# 0 01   -0S 00 0 00@  00(0 00 0,0K,nXiH-M 0S9040S 0(0S0 0S0400 4 0 0 0S000S 0 0A?R 000 00 080R 0000 0 KH- M   0 0S0p0  0 0 , 0 0 0 $ 0 4 0 0 0 ( 00S 0O0S0 4 0  )000 00 0   00~ 04 040S 0-04 0 0 040 00 0 0S 00 0 00@  00b000 0,0K,nXiH-M a 0 0t 0J K@BH-M /w 0S000KH-M 0e0eS񟗄؟Пȟ0!0000|0x0t0p0l0/= `0 \0 000cDD\ @0KHGFEDCBA@>=!!!H-M 0$0C0 0@0D0< 0H0  H 0L KH-M  0$0C0 0 00S88p 41X0 0  B 0<0S 0<0M0D0S 0D0D 0@0S 0@0;z 030 < 0 D 0 @ 0}s 0L0S `P L00L L 080S 080 L H 3/K!! !!!EH-0M $ ( ,0 $0S ,0S0S0,0S ,`000 0 0S V0000 0S 000 0 00 0S 0e$0  00 0 $0  $0( 8 $0 H $0 < $0 D $0 @ $0 L 00 0S  00 H $0< 0 00 0S  00 8 $0D  000 ,0S  00, ' $0@ (0S $0$0T  D0|0 $0$0$0$0$0L0KԠtH-M 0S  KH-(M $ ( $0S (0S (00S0)0K  0S 000c0K (0 0R0 (0 h0 0K$  $ 00 (0  0KH-M     0KH-M   0 0S S   0  ;0`0KH-8M $ ( 00       Kd  0S (0R:0 0K$( (00C$ 0 0K4 !H-Mx | p0K 0 0 ! 0/00k K x  // b b!" k1K00 00 0 0S0H0 0D0 0P0 0L0 0 0 ' k0!K 00S P0s 0P0 0L0 L00L0 P0s H0s L D0RH0KP K0P0 00 0 0SP0s H0s L D0RH0KP KH0s D0S0H0 @0K0 0 0 ^H0s H  0RH D0 0R H  0R0  : DC 0S 0  : 0S)H0S&D0S D0ST0SD0S\ @1Rx0 @K00c.0  0S 0;[ 0 00  k0!K 00 0 00 00 0 0SH0s H D00S0  : 0   @0K0c 0R0@0K|R0K0 !H-PMH L P L0S P0S0.H0S S 'LP(0#L00 L% 0S @0K0 L00c0 0-S00L  0 0 Py0`0KH-(M( , 00 0 0 0K0 0 Jy 0S- 00 0100 H10c00 0S 00S0C0S0>0 0 0S  00 0 0S0/00 0.S0S 0S0 000 0 00 0(0 ( 00 0S 0S0,0 K0 0K@ !H-HMH L D0K0  % 00(0 0 0 H00:SH00H0 H00:S 0H00 00 00 i30 , 0S20 , 0S 020 00c 00 000 0S0E,0:S+H00 0S 0S 00 0 5H00S00 (0R00   "$  0     00 00 ,0.S0 (0R  0 00S000 00 0XH0 H 0,0 ,0S0S 0 (0R0F0   "$  0     0S'   00c40  (0R0,0$0 $00c( 04$  b  4 $00c 0 $00$0 $ 40R(00  (0R 0L0D K0 0KL !` !8 80- M0 $  I?Ѝ`non4 40- M0  0 Ѝmndn4 40- M0  0 Ѝmnn@-@MP`@-@ \0b 0`PM@P lRPP` XPZ DrpPS PPv 2Q 100SR 0 !RK 0S`a1!`0 P0`1P0 1` 't!t1 0 h!` 0ЍH!H  @! 0 0vЍ!1 0 ! 0inЍ0003/000S P 0   0I 0 0 | 0 ?Ќ \ pmlPoDHll|o lLok4nlXkn,kT T0@- M0 @ @ R0" QЍ@ \j|j0@-$M@ @@@ @@@@@0 0 &$Ѝ0圢@-M&'@P #'@P "11SЍ' 0 0  0 ' 0 0 t  O?n"P P0 0 D  <01Diji2ijHihtj iA0p| p@- 0MS@ `` QA`Ѝp< <  4 0 B008 @ 0 0  00 00 _?@bbDel@a3Pp @8P- ``Z @  Z >`<3@ P-@ gp`P b! p  ` @ p @}  P ` ͆@p@ja  } p lQb!Y  p`P 0\(`P``e S ^5p 0" ᝋ# @l!  0" }# @l!     * p"i!  0" #0ୁ `qXl1'#a@,+`G(P쐆 peGDP(X ^@5`p`͊ @pY  `1 Y ^✐5 @mp  `1 @ p`@὇ p  `1 @́p M @ p0-  l1`ፆ`p W`` aA   pla @@U(SO`i@pF*Q\PSOv NP`4p '썊 `pY 0a g Y NL4 `*罈p 0a   `(} 0a `  }p 0筃 =+  0g` p쭇p)Yplfag) &( *(P0@$ p 84`H$( 0 0PpWo 7R [r< `XdPp唐0 㜠 (P  `$$@p% '. ) &.Ϡ蟠H@Dp( ` @ $p% P. ' & %`*" _LQ믠H@pDP @$.0\吁d` @& p\0 cJ|P  $(` .APPp(P` $@ `PH `p (` M PjP@  P @ P읂` gpP m b! p ` @  @}  P ` M@ka  } lQb!Y p `P P0e`T`C&q ` " =p*[ @l!  [ p " m0* @l! p " m0* @l!` 갯Xh,h7h7  `͈  *p"읁f! ` " 0*`ql1 ['#a@,(@Pe`X`N&qF  ` @} Z  `15 Z `@ p͇ `  `1p@p `  `1 @   @쭂 0p l1  p` mp aA[`  plap@PSOdI\+`P p 콉' V 0a  V p` 轉&  0a p` &콉  0a ` } 0p +  0n`p )쭋pplYfag) &. *.P @$(` p 0 0 [` @pg'L@,gt(pP e%+le4&0j*,jt(p Pe%+le4& 0j*,jt(pT iߍ ;R0Ӝ0ե ΍ Qb8"#dLb$p【0D@ ΍ Qb8"#dLb$!x0D@u ^!al4Dp0D@qh``x`$ 0Te 0`20@`Q@-dM@`pP dЍG-`PMv 0Ss @@ 1 c;RS   00g?+ PPb 兠 pPN 夑夁 d >T+00@P   PPPJ X@ZpP5 @@@ 0T+02@P %I 0 0  0Ѝ@ 0 0 0x  0$XX  ;H  064 4535 4L3433=p3A-00M@Q`0000P0 a C ?dAo`pP !C @R@B R00  @ 0P0Ѝ뼀@p%0 #a00Ta xx  l 0 0 X0o@ @0 0L4  ,0a3<@31A?031:p@-PPMJ A(a0 1c  !)10` 08  0P  0P=000 x0 ЍpX X0 0 L   <0 Ѝp0>2?2I>,2(0CO-QPlM0@pp4  ? PlUlel54P`0  0L5@`080,(( 0 R>`88P<& 8 ,PU ğ弤 ğ ,` 4$ P Z pW8'*0S Y  ^P<2!!!  $0p  3~,pP `W8:Vq L , @0d4\(\8 @ T8P( P ̌ Dp0@P6 Rb2P`0 02`t2 00d2`@ ,04\U ,qg1  lЍ<; " 2 0" 1lЍ!1 0 ! 1lЍ,g ,!1g 0 ! p |1lЍh!h  `!L= p@, @>0(\ 4,p8<` QlT0Q0 S8 `XlЍ0800` 0/=11.D1<8 0\-p;\,:p/k\/t:T.+I9.+ox9,.<+e-$9*4$0p@- P@ M`0 vUo@1 RB0 S/1c!/0PD A@  0 0910 t1 /d!d1 0 X! L1$Ѝp<< 8!0 ?   ! 0 0@0@0 0 00 0 Ѝp 0 0  P x0UU)6l,(L, 6h,(r((+P('T+(''+5l+u5*p'mO-RPVPe  M H 0 B0P !P0P$1 0 0`p d1<ЍL 0 <1` 8000 0 0`0$000$ 4` 0 0  00 0 0` d0h&l*h&4&&<*%$T)(p(D08#`'H#p'A- M8<@@p`@ 0@@PP%a 0PP8@T Ѝt t0 0 h @ X0w ЍH H0 0 < P ,0h@ Ѝ/&!/@&!@-@M@0S P 0S ^X0P0 0 Ѝ8 8  0  E>4d$%4  QPA-PM@``p& R$ ĀP!  ``0e@P000Ѝl l0 0 ` @ P0@ @0 0 4  ,0ꀇ@.$-$0@-PP M |@@P Y 0P[ Ѝ00 0  (  0|#-P@- QPA-PM@p` SR P 000 PP000T000Ѝ0 00 0 $  0~ꔅD@,"0@-PP M |@@P  l0P Ѝ00 0  (  0SĄ "+LC-XA4M@PE DaDqD1`0p 0p(180P $1 P PPP0p00 0000 4Ѝ0 00p0@ T T0 0 H  @0$+!UUp!` !t* C-鬒,M P rb2p`0 0x2` h2 0 0 P2` @2Q0`00 0 22`000 011`000 011`00 0 011`000 011`000 0l1~d1`000 0H1s@1`00 01j010S 0@1c1@@  D  H   Pa> L0@!0 T:,Ѝ 0 0 |  t08ꄂX*h 0  tX< <'aπO-M`P@4 804`8`QpP48`QU n Vl TF L PB&6 0\&  V?똁[U p$P0S P/P,U  Z8p$P 0p R D Vp W80< (  E0 SPqkqpX $ 8 9[K@000(0 aDH  , %,  % 0t5 0 00z㊡j00[Y005 0(ş0,0 0 5 y,   0V 400 ` =aZ00! '! 84`P\$\4 0 P$ H4E4HPЍ,$,4 0 $p 43PЍ30,03,0 3 ! (6P ( /  0 ( }(0P t,   0 P3 5!j!D $PVN(ß( $# `  [?[20  "p` 2<0 (0Q"2 0" >qgqX$p$8 =# PL"L2 0@" G>Ѝ Ÿ  " `  1 p P!1 0L! 1!1 0 !> y8( $8 P4h!h  `! 0 L1^cPw40!01 0 $! 1O1, 0 (0 00D HDPPi ,DLTod tPD|<O-(OP@MPp / ? 0 / >Ѝ`q`3R`V!̞̎> 0 0?P*PjP^ j/hh>0 00YH>0 00P$A 0FP@APpAt`x`|``t@PPu  0P0|00uP 0\ L\0a Mm@ }=a/0 `p 0 ?pb9P3P/< 00<pM@tP|<Pm lllVfPq0S PɟPP @  p :0@T8*^ y0 R(`E `P" 0 90U00 RM 0$`8   P@PN   0 UO ~  Bl 0(0  0 0C0?1 R! |gp` pW*P 0 0 +> 1!g!H `H pW:``XP1 8 0 bPL 0PcPH!F6@00, x6@l6JPPV \6@00P, D6}eVPQ,6 006pp@ P!i@P  %5 0 %@ 5TPo%5 0 %5 E0%  |%0 d570\ P0D5@00, 05(0P$5 005p@DPTP0  4fPq0@0T3d4`00 4`pPR d4 00`pH4PUEL44PPH 0 $ 4 0 $ 3PP8 P< 8@0 8 Q10@S:P- ß <ßl @xß P Dlßh \`ß `Tß d4HßHH3 0 003 P 4( $`P~ X$ 0$ $0P  0 4  =j0Y8P*[ @D P< X2UT 80Y80` Y `V`d\ 1< 0 wht  4|t @ pUU'< h sr4 T *r8r r $   $ 4< @q  8,X  `x,ml4L2t 4 pH 0<t h4  8(x0D 2< ENX p I] 7P P7 H 8x0xVT`H|pr4"`   1 0 0 D1iT ```p t0p`t`P4p t0:`pV 1 0P 014hlC8{P]!1 0 ! 15A20 0`$2)PD 42 0 0 =pP`BPUP200p ?3"1i 1 D04 028-P"2 0 "3 030  ?D#D  L#0X3 0pp30  # 9>300P 33 003P 0\3 004 0N$$$4 0 0$04 0?hl808d$d4 0 p$ x4ru400 :>iu4 0P 04hlZ84Pt404 N 0  ?BP],, Ad4% 0 0.fp%p5 0 |%|5 ! 050 5 U%  %0 P 0>%5 0,% 0T X$6PQP@-P M`p 6P*@@P \ 00P] Ѝ, ,0 0  0^0@-8AM@P= 20P @PPP@P000%Ѝ00 00 0  @ 0 0 0 x  @ d0wX X0 0 L  D0l]]|]X]'@p.|A-8'}@p`P @h T廵&h("hᵵ0ȠT,hᰵT!h᫵ 8T#hᦵ T!hᡵ(T"h᜵0ȠT,hᗵ(T"hᒵT8#hLQ-F8=BȠ,P 3# 0 0ԻW&C-8,M0'`0 00000 0$0p(@ ₐY(P,2 "IB\ LR!2@pBBᰒQ A2R'r@BBQ pAW)2P@BGᰒUPE`JpPJ 0J 0I뺐@ PJ` pJ 0J 0I뼐@ PJ` pJ 0J 0I뾐@ P}J` pJ 0J 0I밑@ PjJ` poJ 0J 0I벑@ PWJ` p\J 0J 0I봑@ PDJ` pIJ 0{J 0I붑@ P1J` p6J 0hJ 0xI븑@ PJ` p#J 0UJ 0eI뺑@ P J` pJ 0BJ 0RI뼑@ PI` pI 0/J 0?I뾑@ PI` pI 0J 0,I밒@ PI` pI 0 J 0I벒@ PI` pI 0I 0I봒@ PI` pI 0I 0H붒@ PI` pI 0I 0H 0I 0H@P Rp p0KP  ,ЍP P0KP ,Ѝ8 @? V-C6j?@HzG@(\G@A-d@Mp@P @@@@@@ 0 '0PE`p Su0Sʂ(Q"( SxSS0C@DP(Q0@"(UT`0S 0 \\`Vi:VfqWc:Wa Q]S UZ:!QWUU:0SQ:CSNaPKTI:ᶂ^E:s^B X? W=:PU9:#U61Q3R1:BP-:cP*T'V%:$0 s5S0@@^0@CN~0| 0CsyTp@T HŸ  $p\ @Ѝ PU a l @ЍQ d긁p\  Y  P1P Re 1 H0S]  1@PU  18@TM  10G @0(\;  0 \3  0\+  0\#  0\  0X @p 1 TpOlT<0p@-SM@4P4 P P 1PЍp0S$ `a`1`0XQ`00P 0<10S1`000 0100ЍpЍpP˯0S 0 0 00 U?ν00Ѝpᳯt t0 0 h V?  帽00000]tbexDO-0DMSP` 0A8_S, p @INp 8IJ O0H@S00ĕ_0@ @R0$BT0eT;9:80  "Œ 7$ (07W$ (0RS< "QH'QE ,`P ,bഁ`, `O`0  ? p?0 S 0^. S:0,00 1%DЍS 0S DЍ,0S# O DЍ,0X%0O0 0 0,0@l0 Tp,p` 0 p(0$XZV]]0G-S MP`\ 0A8?SX,0 G`D@@DE0SHL!L1 0p 4!41`p  ಼@0$B0 T 0/T@R`  rᑠp㉮Z# `00"1# B0  0 Q?ー,0X(0H0` Ѝ00 Ѝ,0X%0H0 ЍT'0A8#8 SO-@DMP*0S ,0 N 20>48<S,` RPK`\0X`S 40S0 QS ` php<ḣ, $崳. ,/$-0 R- ,N.``\p $  0"2 0,0"000 q?0S S:|R|b|2P`0 0d2`ػX0 {1 0v? `ʻ{1@SvNpA {!B100 >p`㳻{1!00 10 y?` ᥻1SQ_ {!`100 {?p`㍻{1!0c0b(!0C0 910 ` >{9! R'{F?` ~?fDЍQ, DЍDЍx00DЍ,0E$\p00DЍ00,|H0 ,]QPC-`P `pp@T {/A|`P刀匐{;P @CğO- @&O- @4MT`PXp  G R RP  加 ,加($( Z$ 0`PpV 0 S}0QyR`Vt B"0Ps Ẑ Qt X \`\] QZ0C8#89\zT4ЍyRpgx'x R0S PU: P4Ѝ0Q 0 P90CP6\ 0 R  V  BV\ _P 0U0 V0CV\` PPP00P] 3/P4Ѝ0 P S \I Ƞ,Ƞ0PQ| SyJ Ƞ,Ƞ0꼢2 0H(00ᠲ00 00 000`t2ݸ0 0 000000 0 0 0`Vd 00S0W)9R)0E%  `00008C8S0!00 ! A0 ? 00P]hD`%00/-0Q0P R6 R1 @`@&A B#4$R@ `p@D0#pqT#4'pq#4'pq#4'pq#4'B  R`B < `A @ $!Q#4"00/2/p@-M@P` ЍpRQA-p@@`P 0P @ @T PUX0X 0A0 AN0  I( 0 AB'0`0A-@RpMP`@$@ \p@   @0\ 6!@\ "@T\ 0  pЍ     @ 8@-@P  \@  8@ @-M@P`p  Ѝ-PMLL0L@LP 0@PD0 @PH @0PH` pD@0\D@ Ƞ &Č L "@ j  @P P, 0'p` ` @`0fj "L   p,DZ840P p@PJ P @xW& tp  @0@ɟ$$p 8pdE%|(p(0(  ̄p$  8(`X9`pf ,`,0, ` `&P"pP!7, P ` 0 `# x `&H&p%a,#$@*P x+ t )'` (p4 H,X+ Tl!P@ ̅ <+. <-,@/P8`)k@kp" O`Fp p'\02`1@@P@00gP+ 83PD60P%@w5 L4a &70p  ):P  9 |80 (  X; " TX>P= k\0'< 0 Ƞ0#`Č? `7ǧ +0 "a0! 0p #, І-p"p 0'@0v;#p`( vi`)p`&(ppfh (` p!<`pP} ' 0" 4&뻇0+ 0 `#`6$fi &0  "8 5a!0 p ( ؅-p"p 0' 0u;#p`( 4ui`)p`&|eh (` p!`p\} '  "00`0<%;#  `!` fi &+ (a p4 ! b.p!p'0H0:p#@Xp@Ht崄"p`+p kd ' t$`+( p b. !0Xd0p(0:`"<!###|""Ƞ" 0T0 P SUVWpQR@ |000#400X 0 00 00 0#400000000#4 01 00 00 00#4 01000C-PM`(b0 p` `H ? Pe% HPf D 罋*e(%!DP, 〰`! )e%HP` "$ἐ,gqe$"@ ' 刐jaꍈ @@ @ !j*D  j <P&@譄hP @!k(+i!"$8<,k$"倰@ P% @ph(@$ p!8pjQ͌h!%  +g('p$ plA8읉$("$ ,h$"*`4 Pf&,!ih!}` ,倠 g)} 0f(&4`g }"$ P4f&,i$"@( +!P  @ga }j!) &gA e(%}4"$ဠ,i$"0 8ర P!e% ,Ġ0P $j,  "e% Pg)}g e(%}0!"$<,h!e$"| `|P,x@k+到 * `g}`+ ( @!ᔀ ,k!g!MPp `&x "%`&Pd䝉p o|@` ` p+!pଠ(! P& ` P% @  ia}  @&筊 P%@gp_P P,! P$PP+ +@$뿠p !$PpꝉjAx+P'P "ठ0 %P $0D 魈0堀0 p iᘐ "/ ` P)| p' `+0 ( !j!ꝃp嬠!`夀P%p*ࠠ 0" P%(ఠ 0#@_P@0`*ठp ( ഠp͌iP)*l1Mଠ %  `&p匠菠ᘀ P# `&P%o 'px P``dM !(", * ര|}dA $ga͌ P)p!0 *P%x ꯠᴠ0!pरP%p& * )_*xP| ꯠᜐl!|x̓@0"p P) 0#l썈)@h0MP%*p|P%`#ਰp xp_P !P地!`ᘀ %| 0,0#*pdQ *0M `%଀ꯠሠ`&#`! !ࠀጐ 到-dAp$b1 (m '#p*(P 崐P'* +ꯠ+唐堠뿠fq͌࠰`x '@`] ) "l, !@ eᨰM!P(`堀0 +|p嘀 " `* "P`&0/ (pdMP `!ର 0)P!0#` ᔀ0} +dAP " `$g͌ "p& `嘰0/ 0 &`pP!l! P%(͊0"(Pp *@菠ᘀ @ਠ촟`#읉`&l `&Px0  o``଀Mp#i Pp' 0 ` P|p'P0䭊dA( `xp p! 0 P0 0!P&P%pP%|0_'xPp-j `P ` `x͌P%b! _|PpP 0  @ᨀ|@읉`%l P`& 0 p P`&@p P0oxp`(! !i `P p @ ` `p圀`| =!`@* Pࠀ @* @ Pp(p'mp'c1ꯠ@p p删@ P @@'(p͌fa (ࠐ P  菠᐀ p*ഠ  p'Mp'l pPp   x  䝉%dA0 !p唠 P 0 !0| '"* ꯠᔠp娠  `鍈Pi `'ࠠ ] 0h`&  `&0ἠ 0 0 p ! @eQ ""o0@ 嘠`@ `Ϡ @@ p" p'崠 p'ଐp ` *`=` ,M c1,x尠 Ϡ`  yZnܼbPἀ p)P- p'dA|p'ഀ ` pP*xp堠 ` P%尠 P%`& |圠_xPb!P*p P%px`& pరᝉa P% o|` `,@_1PpxP|匠地 `&鍈i`&)o hA`}` P* 吀 $ "P% `(|嘀 地P%`&_`&PP匰ot` `g͌! p%쭊lQᤰ (p' `p' +@t `jᔰ (%@  ,)pp,`p+ x删 `pt@ ( p'ਰ菠l` +p'|@lP-p ! (@Pmb! (hp菠p"f͌ p'h @d`@lp嘀娐** `(ꯠᜀd`hpP༐+`&଀ P `&lሠMP ! (  dp ,ఠ o\`,``p*\]dA$Ϡ X t嬠eaP)x` &+ p' )pXp' \ ,|ఠ`Q ,Tp%ϠPl T p!X@x p'p' |@-!Ph@(`@x`❉|@bx@d *hLp ,Pp删 @`+iQxP &tPT` p*p@, `% P$|L@Ϡ@x )`L p'\ `&Xp' P%儀 " |倀tpx l `&hM d,`\aXP%T! Pd!$L䭊(x@) 0|4p@p"o_p8`?RDMP0P  bDЍC@@g pg V @  0@ S@:  @- MP`0 @S     !1" 0S 0p~? Sp  0~? S  @$!0!01230@T@ W S000000000 Ѝ舾hQPG-pMЍSR`` !RV @ ZY0000`\ PUZP?   G@PD L R 0@( "(JU }h&h v t  MPGP   hS7#Ƞ #< &h0VLL0g 0d2P((0o 0Y2ػ@-03 >S2  FP/ 0>C&S&'&#"!  0 02谺QPA-PM@pp`ЍR  0pF0PA R@!R> B @ X    px'xT* Q (@"(` 08#Ƞ#< 0  |P DX(@"(W `'C-M@ ˡ0 0P0Sp `S)( ' 0& PT 0㜦(Ѝ pנ$ 0㏦0C-,1QS.S@`P pC         *  &PQ0 P         ( L 0L0S P删  0@и8@-PP @T n~~88@-P0P`@ R.TT  0.TT8~P 3~pP .Tp `0  ,A@4  00A~pD(,O-0P$#dx'8X,@ M#:Ѝ Y(!Ub\C0`b0pSX13#RZ? "q: `Q Q`*`Q ) 0 ` `R0 p  )Q ` p '\  `p p(!Pbp%P(q 00`P 0 D V "F!0  ".#0 , $.%0 , &.'0 , ( .)0  , * . +0 , , ! -0" . ./0"p W`PR  $( ,0l P(!/ R     0.0$ , ( 0.0,, 0bS *cp ` `(!0b\ e(!Ѝ0  0Q 0 0$ 0ݤP (QЍ  Τ ` $( 0,0 Q($0^ XV1p3p#U`  R %1 +S$Sp,p`( & ^   p!Uq `0&U  !Pe0 0 b )Z `p0b&S  b`*P` p 0b )S  `pb W  0b*S ` pb '\  `0bp Sp  b ,P ` p 0b 'S  `bp V p  0b ,S  ` pb&Y 0b` S ` p R )/ )up>븡 0 R3 2댑 0) Up+pd!`0U&^" U*X#U !R$p`U0'0L%\ .F & U "@'Up+p:(`0 U&4) U * .*  U) (+ p U` `", 0 U. - U, ؅.ԅ ,ȅxĵԵQA-@M Q1 Ѝ  办 0 p@ `Pp#pPP p(`@.& $0P,0 P@P Ѝ00 Z V P`p P0@' @!"P#0 `Pp, `'1P&%@0 p$`(P,CpP `p$P@@$@ p!`"#P ` . pP.`%& $P(`,00pP `p$P@@$@ p!`"#P ` . pP.`%&P $P(`,0  `P p` p!"#``P p` p!"#`ԭO-` @!p``@0 ! @& $S /P ^  (*,* ,!'S_$'/(^ ($, )! !&S_'P)^@'|- )ApP*  %&g _~` @$ $P( `P%! A%s  P "w @ `n p( p* "LqI$,co%w(n @(%| y@$ @$@!co,`(n)P,̠ p) Q`'p&"#p/!,o P%% `*$ & Q'g "ào 0P(  ( !  Ǡ '   "'c$So_"`P  $GpO qq@ !͜!n^M 4p' ( (* (8" 'P" P%P

XpP!-M(\  : (! Ⴐ \ r\! RT\Q [K \ @P p`P? ESGqFb [pA@P`P ( P 0 l 0Ѝ/ P0  C"=000 = P p   ‚AC!0 @ P )00)ꫪ{zz- pW , ` Wy@ \uP U W f\ @lT @ TW T XY=TZ U@TR ?TZN`WYS @ @ੑ@ቐPp@≠jP3AQ!3QH\ + p @` S  Q QPP Q @@Q`F?TsV# V' V'p@@ S `/`P U X +/Z@/@)dz\y00B \00A0BS70B0a0BS0W B0 Q/P- 0AP`P@c@pT#3@gV0!02U@ SQ Q # 3cR0/P-pP @`@0@ H03#0@0% 3 # 0 3#  %  3 #  0 3#  % 3 # 0 3#  % 3 #   0 3# $%$ 3 #$( (0 3# ( ,%, 3 #,0 00 3# 0 4%4 3 #48 80 3# 8 <%< 3 #0X<@`@@@i J"" #p Zh  @0`3`#0 0 @% `3`#   @00`3`#00 @ % `3`#  @00`3`#00@% `3`#   @00`3`#00@% 3#  p0 Z ` @( 3 #@T0  S00S /0 P0  0/h@-@P P 0S 0C 0Cs  0003/0 0t0@-0`QP@`%0Q0003/pP Q  !ᠷ0S 0C 0Cs (0003/'@0@-P\@`P20\  Q 2\$0S0\ `!003/pP Q !a R B  Br40003/@ @0P@-@P, `V+ p0W !Q 2\0Sp0 S : gq!㶹 ]Pqp6@-Mp @`P   ЍA-p@`8Pd0⨃ h<#R0 @ @D0P0Q%PPU S( !0Q0P@-P@`( PPf à0`l#"  6#R0 0 pW%PP!Qp@-`@PP  !  &AV000p0Q05"172012#/Rp@-@MbP0Q *0@DAЍpR   P Ѝpp-`V @P@D   P 0b130 p/PU 0S 0S !Q 2Q0S 0!0 S   c// 0 2 @-@-0@ 0$aRPp %>P\PT0#!apqPQU@T0Q@-Pp@P` iV 0f # <bR0@-pP0B`P'T 0T**  d 1 #S0!0S"V 0T *0 f1 @2\P S   p-RU+( U a0 0  @eT S* C @@ 0RQ R 0 Pa1 R0AŠ@#p/Q pR 00p-S @C Q U \0S B R PABaAV@@T RL  S:S  CAQU:  B\A:0Sp/p/p/O-M0<0\@J@ PF !〷 0p@ W01 W 05 01P@ 00a08 9)0  0P 0U`0 0B   庴 lP @0 Ѝ0 00p-SP CAT \0S B R @BaV@T RL& S&(: PRRP#S  C Q A U"  *@ B TA :0Sp/p/p`/`-!LMQ 0 ЍЍPC-@P P pPIP0U0 !E!P 0QPU0C^pP0U`0, `F@  3# \ @@Q aT0 P P T@@T`  EQ0P00 p@A-`M@PP/pT# T P0 S !C!P  \0S B ЍgPP @-@0P`pJ`P@JP P P@d@@-`0@PSp -P  P`1P` P`f`-"NMR0 0 ЍЍ-"NMR0 0 ЍЍO-$M` pX VVK VQ PU !E!P 0 RPU0C@T !D!P 0 R@T0COP , *$ЍePTD   0 0@TK0 0 P p P -M0  00 ЍЍ0ASO-pMP>` ጳW& !P,XR @aP%@TJ T H  { PP0 S7P p 1P  ЍЍ PX @X̀ X   z?!H@P 0-S00 -R C-M MPH@!`ݴ vP6  0P/ P@ t PT p  _ލ Ѝ> @09Q S S. 0 @@)C0R9A @09S O-M PpP L@X`dp|  PP   Ѝ [ 7P[ PЍzP0X0L0P P P PjP `0P0PP0\0C  K0k$僲 00P1`Pl0Ps  P P `P0$~C0c0!C 0@p p4 0 pK 0ᘧ ` 0;/[Bލ Ѝ@1O-M Mt (0^$ p4 !P 2PQ   R:0 h"4 ]T"ύ  0T? $ 0(0 0$@4@H 像0  0()p-@\ \ T  \p/p@iA-\M@Pp` Q Qߍ|  2 k$20 0D 2 ]$2  0ߍh(\(O-ŸPM P(`p@ 0S T 200SЍ080,l"( \Ÿ LPŸ PDŸ 8Ÿ 0Ÿ ,(Ÿ T2/lp0t$x4|8<@DH 0L  0P 0| 0(0ll0p0t0x0|00000c"P3t\  ^ 0  Ϥ^ 0k' ^ , [4AT(0003/Ѝ00 0$T 04AT000Ag@'m ''\'08@-d0PS@0 0S'8X0P&d03/PP8 P P80StP8 P8P 8 8@ꀰC-@MPpPЍ RP  P NL Ѝ  PP PP P PP PzPZ@-M@` Pp  ``P P  `ЍO- P P  P0S ) P P  %P P P0S  P P  P PzP  PNP tPo0 Pi0cO-(DMR @ 30 03/P 00(00'40( 0#4!0 PPp ` K  `PP n PP{V`a F PPp0`FpDPa@(@W4 Z  PYJPT   PM >PH  tPB 3P= iP7(P2 ]P+ P% PP PP P 6 PEW pGW -P P@(4 p``V p80 003/DЍDЍ 4@0O- M0Sp `p@P DPP0P U 0Us 7  $@0P  Ѝ# ЍO1/ x0@-@T h0S P A0 0 S0000 WWWtWlW@-@0S SS 0S@-@0S 0S Q  Q 8@-P0S @ 0S P88@-@P @P/| D@-@P|@@-@P @@-p@Pp`0S (LtP x0S P`x0`St$P,0003/| 0S @.0@-@P|@8@-P@P8 P88@L@-@P  P@O-@tM  `P? 0S PP; 0S PP(pC4@@=L :X 7d0 03d1 0P 0.,* ( & $d"0tЍ tЍ tЍm0P 0Pb0P 0PW0P 0PL0P ?0P `s P P>0S0 ` &0P000Y P P$(0SIPEPX  0|( =0Pu 0  70Po d10id /0Pcd0P^ $0PX0PS  0PM 0PH 0PB0P= l0P7 @ PTP 0%  0P 0P  0PL0S  P  nP  0PL0S  P  YP  s0P40S  P DP o 0P`0P 0P U0P  H0PX0S ?z  P 9 P DꀰO-iMPDP `$LP&'  P\@  T4@3@#Pj 00\0T 3D2@#)1C 5p2p! @%0S(.7 0$03/ P U `P-(0,``0@4 0 P [@ T   @P ` tP  `P- P@@@T$P:5 003/\PZViߍ(P@@JPHe$wiߍ P`PY P`P(0, ᚟(P/ (, p0PpPv P pYp:` V p0P(, 0`&@.@`,``0 Y *t , (0$0 0y,0(0 0`P s``69,01,=$  ( `P1Sg X0\@01h00 `0!1VP  P P`V 8P( ;`P  `(`P  )`P `P$ `P$`P  `P `P$ `P `f dVz @$,`a  0Pt  0PPT   u$ '`P$` `N , , 0@4`P0<008@4pS aA#P$@DappWA$@D  0   1P `4p 000003900 P,8@4p< `P R0 t0xq`&@0@-np38@-P@ P  P0P88耰p@-P@`Pp Ppp@C- pR@P$`"8PV+ 00iT00V0:00 P  C@0V0 :  Cq耰@-PS`@" 0SU@00Sp00S )P "P@耰S@-@@\ 0C\ 00 0@@/ူ0@- M@\P LoP00000 Ѝ0ꀰR@-@0 R   00P @ӗ耰p@-@P` P 0V000#4000pppG-PM`i@P300S4 <0S' ^P( pXP"PP  K@P Ѝr\00PAЍAЍ @P  +@P @P0 S 3  @Pw@P  P   @P @P @PZP"  P `@P@ @P  P {@P 0S @ꀳ8@-00@SP <Q PL]P8`8yPtP \0@PPgP88耰O-Mp@P P @Ѝ P00S <0S !1 0  0dH`TP jP 00S <0S @ 9PP 0 P @P@ P1SM X0 0108 P8@ 00!10P PP  R  P8 @ PP 8s P P08 0 0P 8YZ00l H0`0<  (P pPL @@,,0s , H0Pa B0P[(xl%0 $0!00000 00400D0 D   A0P PA7 Pl 0P5  0l D 0S  0P ,00C,00P p@(P b0P !0l 0P  0P E  P  Px0S  =0P 0Pl 0P0S&! P P 0 @(P3 pP0 P P0 Pᜢ 0Pl PSP  0PZ0S  P |P  0PE 0P@D 0P:D 0P5D _0P/ 0P* 0P$ w0PD j0P0S  P ;P > 0P W0P( 0P L0P l 0P A0PL w0P 60P 0P PP ꀰ@-p MP@`JP! EP  0@ Ѝ@P P.P  Ѝ@ Ѝ@A-@0(MPp` < R P0 `P (ЍP(Ѝ@ D0`P 0`P`ꀱO-\p`0 MpP@0q048 <0S㇡PL$ 0 P$\ a PPU PhP0 04 ЍOP 0 P  Ѝ Ѝ Ѝ\@Pab P h Pc P\0S[P  U P- M0 0( Ѝp@-M@ P`ᬓP`0| Ѝp0G-SMP@- S*P$ P pP`,P.| (0pp@P ЍPЍP 0@ P  @P@ꀰ SA-P(M@p" `pQp 2P  0( S (Ѝ00 U5P O5` 05P Pp0O-SMp4 5`P@p0PS@ڄ^tx 0`P>A-pM9@P+  㙗 ` Vk#ᐗ 0P>`  0 R0Vۍ `>ꔚ p@-M@P`k0U0P QPЍp8@-@00PPP;8A-`RPO G@̖T] ?T a TQ ?TH b T@ ?T7 c T/ ?T&  T T 1 T T 2 T T 3 T T T T 5 T T ?T O T ?T N T >T M T >T  T >T >T Q Tw >Tn R Tf >T] B TU  TM F TE  T= J T5  T- N T%  T R T T  ? T T > T T = T T  T T ; T T : T T 9 T T ~ T  T z T  T} Tu / Tm Te . T] =TT A TS =TJ B TB =T9 C T1 x=T(  T  h=T E T X=T P=T q T @=T r T 0=T s T =T  T =T u T =T v T <T w T <T  TQ <TH y Td <T[ z TS <TJ { T <T  T <T } T <T ~ T p<T~  Tv `<Tm X<Td o T\ H<TS n TK 8<TB m T: (<TQ  TI <T@ k T8 <T/ j T' ;T i T ;T   T ;T g T ;T f T ;T T ! T T " T T # T T T T % T T & Tz Tr ' Tj Tb TZ TR ) T T  T 0S+0 L@៓pPq T "T #T %T Ts `T bT dT{ fTs hTk jTc lT[ *TS ,TK TC T; T3 T+ T# T T T  4T 6T 8T :T <T >T @T =T ?T /T BT DT FT HT JT LT NT PT{ RTs CTk ETc GT[ ITS .TK TC 5T; 7T3 T+ T# T 0S()0 Ap`gV) pg`FP( _( Y( S( M( G( Al( ;X( 5D( /0( )( #( ' ' ' ' ' ' }|' wh' qT' k@' e,' ے_' ՒY' ϒS& ɒM& ÒG& དྷA& ි;& ౒5& ૒/x& ॒)d& #P& <& (& & & % {% u% o% i% c% ]t% W`% QL% K8% E+$% ?%% 9$ 3$ -$ '$ !$ $ $ p$ \$ H$ 4$ $ $ # x# ߑk# ّb# ӑZ# ͑Q# ǑI# @l# ໑8X# ൑/D# ௑'0# ੑ# ࣑# " " " " " " y|" sh" mT" g@" a," [`abcONMLKPQR@ABCDEpqrstuvwxyz{|}~onmlkjihgfeTt=t , T|(Tt4p0` Dt,l$0d,H`P P`XD0l$\lXd@P h 0@<p8l,t0x<L (\ d$48`(,LDl<(H<LHP PXL((8! \! V! P" J" D0" >D" 8}X" 2wl" ,q" &k" e" _" Y" S" M" G # A # ;4# 5H# /\# )p# ޏ## ؏# ҏ# ̏# Ə # # ຏ# ഏ$ ஏ$$ ਏ8$ ࢏L$ `$ t$ $ $ $ ~$ xz$ rt$ li% fc% `X(% ZO<% TGP% N>d% H6x% B-% <'% 6B% 0<% *6% $% & & ,& @& T& h& |& & & & & ܎& ֎& Ў' ʎ~' Ďs0' ྎjD' ฎbX' ಎYl' ଎Q' ঎H' ࠎ' ' ' ' ' ( | ( v4( p|H( jv\( dpp( ^j( Xd( R^( LX( FR( @L( :&( 4@) .$) (48) "L) `) t) ) ) ) ) ) ) * * d(* ڍ^<* ԍXP* ΍Rd* ȍLx* F* A軍O-Mll@x0pPp0:@ x - PXPTPPPLPHPDP@P 0#07 0#00 0#0) 0#0" 0#0 0#0 0#0 0#0 0   000PPP```   000PPP```T[% $P%P%Aek&0)`& aQQ)eZ&P%Q!P$Bf*& "!1!f`i&B`&(@$(d``)q`ad@PD,!@Ǡ Pt`,`DH,!H\`LTP !&P`L` "0#T P0 t0(LX " H p(Xp\P@pD  `@$,p圀L0TPP`Xp !h@P0`p崀@0lP0" ˠ 0,ʅ! x0 S "A:P R 0#0PK 0#0PD 0#0P= 0#0P6 0#0P/ 0#0P( 0#0P! 0#0P 0#0P 0#0P 0#0P `0#P`P`ppp   000@@@```ppp   iA\ai! 1pCA.O$.&) q dpU@$.A A&qN'@$A A)DrN'@$ Ap` "( p&($pQ0#$0dp,0 0#,00p`0 !0#008p40p"@)0%(408p<0p#$0<|0(40倀00<0`  xp,p0刀 0E=2#p.8p0#.1pa0p3!P %0#01縀CĠ<,0#1@1P#0# p"0GŠ)&L 0#0E 0#0> 0#07 0#00 0#0) 0#0" 0#0 0#0 0#0 0#0 0   000@@@PPP   000@@@PPP DK$@$@$ &LU [%0'P%QA@'U%!! B*! "!0&AP&)a)d'!`` a†t`d`傉((a@A.HP`@.D@.P% ,HPL@ P\@$DNȠL@,T`(P! "TP X` @!tPX@\`D @$ @帀X0# . H@ LPT`P h0@P`娀 @ l@! ˠ00,ʄ! x0Z "A:P R 0#0PK 0#0PD 0#0P= 0#0P6 0#0P/ 0#0P( 0#0P! 0#0P 0#0P 0#0P 0#0P `0#P`P`   000@@@```   000@@@iA\R`i!1&..'CA O$ U`@$.A&AN$@$A 'HBN$@$ AddQ "( @'($&0#$0`,0 0#,000 !0#0040(0%40<08#$0<|040"8(x0,<0  00儀 0E.dP=2#8.0#1_03! ) @0#01CĠ<,0#11\#0# 0"Ip'&L 0#0E 0#0> 0#07 0#00 0#0) 0#0" 0#0 0#0 0#0 0#0 0   000@@@PPP   000@@@PPP DK$@$@$ &LU [%0)P% QA@)U%!!P&B*! "!!A79#0#d00&`)`a`t`†d`傉((qa@A.DP @H`.@.,`&DH`TLP!``TP\@P% "NȠ,LP$P @X tPD\`@p"@$Xp @p0# .H L@TPP`Xp h0@ P`p崀@ l@! ˠ 00,ʄ! x0Z "A:P R 0#0PK 0#0PD 0#0P= 0#0P6 0#0P/ 0#0P( 0#0P! 0#0P 0#0P 0#0P 0#0P `0#P`P`ppp   000@@@```ppp   yA\^y! 1`CA.O$.)' a d`U@$.A A'aN&@$A A)DbN&@$ A`` "( `'($`Q0#$0d`,0 0#,00``0 !0#008`40`"@)0%(408`<0`#$0<|0(40倀00<0`  x`,`0刀 0E=2#`.8`0#.1`F^03!P %0#01` C< 0#1@1*0# 0!H)'L 0#0E 0#0> 0#07 0#00 0#0) 0#0" 0#0 0#0 0#0 0#0 0   000@@@PPP   000@@@PPP   000A     'LU [%0(P% Q` P( !!'B*! "! @79#0#) (t0)0'qdpptp@qQ @$@@GH$DP@$A,ADHp \P p'Hp`LpDȠ p'LpPpH,%TP! PP TXd! h\p@P@$D`)X⸐0# HpLhPT`PPX`p夐P` pAp@ hl0 )00) x0Z "h@  TMlP < 0Ѝ@- @Y@P/  0S /C-`R M@p   0,  0 垅`Vp 0VP1P# S 0 Ѝ/X0@0P 4 /, /$ / //8Hp@-@P& ่P ೈP ୈP lৈP XࡈP@@@@<&8& 0 0          /8@-P@PP80S8P $03/P 0   0S ,0003/  0S @80P@- 0S Q R S(03/@-`PQP@p` 03/P WPD00 03/P$03/@ P@- 0S 03/P@- 0S 03/P@- 0S 03/P@-  (pP6 @ PDB PP  A>\  D@Aލ03/PP03/PP+0 P዆P,P03/P LZ G-P MPP 0SM @TJ `V"*03/P 0 R0 Ѝ0 03/P0 03/P0@ ` P 6ំ0` \㙆Y 00" 0 p '  \003/P0 P9 WP$(@P`$ P.E0S\\!0 0WP'00P 2P (Ѝ 0 PP ᇁ(Ѝ0X ` B y s (Ѝ0Stt 0 0P0 ( 0 PB x U(Ѝ茭جp@-@M` @PP Ѝp k0\`  R0 0003/ЍpD0PP/88 @-0@  @ 0 0@/Ыԫ@P/X/00  /ራ@P/0Ps/0Ps/@- 03/O- M@8  "Z.S!W P\00  D0PЍOV   0 0P  05 0  0~P  @@Ѝ 0~PW ꀿO-MP@0p0H0@0L00P08<`D 0ɿP0VUBY@X  %PU  ,PV  8P ЍY  P0S  ЍO,㓿P 8㎿P ㉿P ㄿP Ѝ耿G- p@P`$rP%VU7Y5X kPU ,dPV 8]PY VPZ GO,GP 8BP =P 8P 耿@-@pP`)P,"P 8P P P W DP U P PV \P  @@耿 /p@-@`P u 0 0003/p|/p@-P@P`PPᕼP ڼPh@P@p@p@-M@PP,p8` P 0~P P\00 D0t~PЍЍ8@-@PPP (P#0P88G-AM`\@P: PԺ0p003/P@ Ѝ 噼P 0003/@P ῺXBLH@DЍPh0 P  ᜼@@{O-FMp( P @P+5`003/P@ ЍP\0$0wh0\0st0h0otmW ig뀰0 0尠a_0 0[Y  *P! 5003/@P\PhNtLW HFD B@> <YCLIЍ0,0eP PD0W80P0<0,040k 0S  屾 P , }P0 0墾0P, n Y ᓾP, `P,0\ 40uPh8 oPt (0}P0\t 00pP|8 Pv(0t hPo0ht 0[0Pf< 0P_<0080t008 40PS80< (0PI  PC \ 1P=4  P7( %P1 ỽP+W  P#, Ph ,0 [P ូPP \4A@@D(,0 0`H匐 `L04@ A 0 0P v0P ϼP `V0`4@@DH匐0`4@@DH L, 0`4@@DH Ph00  ,0 ySO-$MP`2 V3 UP . pP  00@R k$W": X`sX0X 00   6/P @@ $Ѝ 0 HL 0P $Ѝ0S $ЍP G ak  P T0p a0  0P 0g0X Gp dp 0 e0P 0 \@ LTXX X00 ꀿO- M`4 SP0 8O  RUL XJ  G*RE: BSpi"0W0 d@@T0 P.  5/ R P%pW 0 0)p  ЍO`0W00   S0 0p  00 ЍO @@ Ѝ R Ѝꀿp@-\M(`,P0@ \ @Ѝp` P@Ѝp(`,P0@Ѝp@O-SMM@pZ P E?RYIP T x⋀U`N:T @@  t4 @L p0S  ͍ Q  RpݍЍ t p0S G 0g0  0PE f  0 r0P0  i0P 0W0 R ݍЍ L0 hl$0PV@   ,VU  ` `b```&\  " D0| a R,0pĝx 0@o0ꀿA-MMS@$4C PH?UFT7 p p`V#T A 0G 0@PUP!\@ 0T0a, a Ra0  R0ۍЍp ,`PH?P 4( n @G@$@ 0Pa!30c! R 0P 0@-\M0p4`8P<@ \ HЍp `P@Ѝ0p4`8P<@Ѝ@dO-STM@pxE WF P`P? 300VP9: q0   7/0P C@ TЍP' | 01 F'B$  \n$!0 $ lP $( TЍ0S dTЍ$P0$0 0P$| P$  P$PF0L00$ec 0PݷC` 0 `\`PQ 0$X 8TЍ 0}TЍ耿G-aM@S(`p'- 0PP W P1p03/PC 03/pP?  0SP 0@03/03/ Ѝ ЍG0SP0P  P R  00,SQHm40003/g@0-p\`P@ \p`P@/p`P@yO-SM MPK @D?\NS@ H``4P6-pD 04SSgp4S P7 t|P1 000 !H0 b@ S""p0@@W:(` PF  :P  ݍ ЍH` T0S@0D?STݍ Ѝ P0 PH0 qkRw0LTHp *R 0LR0S @R $@ pdRr P  $Pxt$P P P  o0Pꀿ@-M04p8`$ DJ(p P@P0@T@杉,fa$p&i-P! P *0@(,*  ꯠ❌T(+Dp8P%IT P% '@Hp_8P`P@b1+ #+tIi @ L "@뿠4P@ p)TD <`p',@ p' &L\! P)X@@$h`Dp8p- *` ( P%ИDbA `(

P@1?  M7R t#l##Ġ8 bx bp0`P Ѝ  P 00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#4000 ЍPSA-`M@p`PP `Ѝ XPPPl 1fP/l 0S /@-l c0Q-00 llpl`lPl@ll l0 p`P@ $0h/<P1?  M7R t#l##Ġ8 bx bp0`P Ѝ  0PL   "$      "$    !  "$   !  "$     !  "$     !  "$   #  " "$  hP '0020$0#40$00 Ѝ ЍEA-pM@Pp`PP pЍ 5PPhPO-?O|M0@ 0?\ q$ϟ PP?tP0`h|?  Ẻl? 0000 P?@0S@/x0 0 40 U>0? 00000 0>$ 0 l  p+l0S@00x0`0d VJ0 0 $@P0h^0P 00T>@@0p 0 4>@paD0$3  3/000 0V:= 0000 =ڹ0S-= 0004800 =ȹ0S00P0TPU@0Pc%UH-0 <-0  ,=0   0 +0D # RTQRRʑ0Q 0l<p0` < D *_" X$ U:p<#p0d<  @ a@0  _0ppp#0  `Y U:({0p ;` 岹 0BS U :|; 0D0 h; ឹ@0(U U: 004$00CS&$ 0S"; 0<` }$0S  T$0 P4S:ʟT Dʟ$ HʟP 4|ʟ 8tʟ EU0010 RD 3{D$0 8$  ,4/p$D$4@00 4 $0`d0UD01S 3p0p W p#03/P D0VW@G0@PpG`V00W00S5HCH3@00 83 0,0S' 3 00b0 ݶ00U4P  04 P:Q 04\Q c x2x"00  d2岶UC0S@@ d0@2`004"00  2垶#0U,:2 001p  0@\- (D $2 C,>>\>,=d=d@= B<~X<B\<X<,B@::?V9=P=988>h>T8<8<$@P7D:,:;`6BD;6j8d7q42K,4l306 06/6/P78t.27.T6-$.P-550-64=9fD4MU2`+3+w+*-*4+h*+D***)*)Dt*),v)$)X,(x)P*t(')8(m('('('.'-x'(H'''']-&P'&$'8/8&+&&p&,%,H%%]%%d,2P.|$X-<$JP-#O$*x$"X2 00 l2u@|2 0@0P2 ׵0  R 0Y@VTY2 00 2PR2P0 0 3E0 0R'(\P 0 R0 R1 Y,2S0 @$B@T 0Sr p0  p ( $ , < L@@Zf @40R0 0Rg`P ( 00? 0 Rc S`00@ 0*S hP D01S 0S PU gD0đY0LPPHp5%000 0 $5巴 0@T  0 @To d5d%0 0 x5埴 0 SQ 5%00 5勴( #,$ 5~tL< 6uY(  4 8(@ D4 HI PD<;<+0 0 P;ڲ G\; 00 p;в =|;|+00 ;ŲE;+0 0 ;廲( (; 00 V?;+0 0 ;娲 ( *! < 00 g00p `4< 00 q?P< 00 d<h<h,0 0 |<{ ( 8 <,00 9>l <0 0 <b F <00 <= 00 =L  =00< 4=B8=8-00 L=9UeP DBp=p-00 = '} w=-00  =o= 00 =   y( P pP0T PUFD0 $!0S0S0S  {ZP00 @ 0$!>.0 0 >ԱA@-0xP0@p`P \0$003/L0003/P$  aW(b 0@<@ D0/0O-StM@+ D R( /0 / |?啱Pe00cPa  U^>P00> l00`0S P 0 >~000p00 0>P0` 0H> ᡱD03S@0S0 R ( 2/PD0 = 00=D0弃3S@0 p  p P|NK@)H(ET 7P'00 7f0 CR S @0\0Sw  lgPP U~oPP PP0 0R0G0 RC QppP PR R:5P 0*P0YP0@P @0\QP `Pp Rz:00PT0RID0(303/@ 0\`P  0`=PP 5%00 5T 5`%0p 05߮ p 0BS$D0 S2 1S/ P D0 S* 1S' 0 GP ,5,%00 5 0B SL3QF 4$004 ࣮000ro4$004 00b_[00XUX4X$00 @4w<I4GPU($4$$00 4g90BS3#PK 0\^ D0 R 0Sv 0\ PQ^Uj Qg l3l000 0>30DPPPc0D 0(0 9GPPp2 00D0(PC?02H  BR,a 0Sk 0Sz 2"0L3 0` 0)P$pH"0 D<"0 >UD0 S Q Q Q  S 1S ,000 00 /`P< 1!00` 1 ,!k\!|+ , : +R d+a l+ + d F * * * *  `*t8*$ $* &P +["<*$m H*P)# ()8w(L$  X$p Q'  '('t4$4I "tL" h%|!4!H tH  | p  d    d` | < B_p  @X l  x    |C `4hnh $ ' < XdT,   ht8 $ ' L  lT@(D a=FP|200D0>0 820D 00/;;FPYp200D0U?0 2ѭ`P200 2塬s2"00 >=2"00P 3Ǭ^Pu,0 ##40, 8#00> ,00P0P P 000PP3#00 3]/0S00#10 00D01S 300 4E400 4= 400 <4020   00d$00 Lp4 㑬0 000<\ (pp@p!DA,$2= 600P (6wL0S L0S Z D FP t6t&00 >㊫x\6&06 0`} 0'Pp G@ 0p0`Pf 7'00` 7圫3@0\Py `p@=T7T'00 l7儫x7x'00 7>7'00P 7m7'00 >'00 @ ”0 40000CS񏐉00\G?0   S 000000800 8`$p0P900 $9Ϊ( PD QU Y) Ɇ\D`>: 0gS;:Z8xx0 p Q [D`:V R:&$ ` HEP  9 4Q0U cp)40 0XPP P 0P 0)&0 P00($0   p$ :00 :哪 *:00 ;刪 LQi;+00 ,;?0 \P 3=P 0S`;`+00 t;)0 L0SH F;00 ;L ; 00;  h0  0 0R<,00 0< pD<D,00P< )40 Ll<00p <<,00 <Ω  P f  D0<,00 <巩 PPU0=-00 (=妩 4=4-00 H=囩L m 0X=X-00 l=厩8 `x=00 =儩 V1=-00 >u G=-00 =j <=-00 =_ 1>.00 >T &@0p@-@P0p0 ` P03/03/U@p0/ဏ/ဏx0x0p@- 0@P0 `3/P 0`00S0Pppp@\00@-S M@P 404 0( R0\0X% 3/ Ѝ0$D0L 1@-RM@- 0 00 0DPL0!p`L 1 N ND NL0S R 0 0c00Ѝ00Ѝ,0, 00 0忨Ѝ\V R C-@pMW4@%/ЍJOO-M @p`PN000S 0T0 0@pM MP  P Ѝ00 0D`NT U& 0,A00    Un: 0 0R U5PV  nP 0 c  T `mUA ,`8 (E, M Z CP U&:0 ,0Q U` 0S  0 R0Ѝ<Ѝ4e,X 0S O-1@qMXp0<0 14@P`6 LDLD@100<0,1 ㏧10000 0僧[  p@O D$ 00 00Ñ,0@ ]ߍ 8g Dc300 , 3, w3#00 ? k3#00 ?_p3p#00p ;>S( 0pS p@2 $h0 S000 ֩ a 0SN0CSv00ʧ0 p 200 2団!2"00p ?ʣʧ p 0l#8@P18@P 2"00@ 2嫣1000 001cʧ  pB1000 001O1!00@ l1~`1`!00 L18@1@!00 ,1-t4lX D.HOX,Wt  < ` H >P h   8 8 } \ &C-`2`rM0p0@L2 բ$0S `Vc (( 0U`eMV`) 0 0  0H1 ᵢ 0   c 0$03/ 1P٢UЍ P/ 0BRR( 1 !00 0{Ѝ0P 0nЍ000 0cЍ00 00 t0Rpl000 X0HT , d D0@-@D0!! 0S D0 !00SD0 !0 D0@- M1 h @0 0D00S D0 !Ѝ00SD0 !` 0@-S@ D0S $3 3/00D0S! ! -R M R P D0 $# Ѝ< D0 $# Ѝ(0( 00 0弡 ЍD S@-@DFDD@l I#.IC-x1xM0 p0@\1 㔡h0OoH`V681003/PP9 dQ h *G1d003/td0pc cc c0c  0h`lpdPptx| 0Ѝ 0 dPh`lppPtx |00ЍdH`0 MЍ@0`00 (0B  Z@0 e lC-1M0 `0@0 )0O_耟PU0003/pP! Q F0003/ 0 pP`p 00Ѝd(`0 Ѝ@0P00 (0d d T@0 ` 0000/0000/ /0 010/48 / / /0$ (0,//X\ `0( $0/ /R/S/H/LnPT /DqhD0!/D0/@-`P@p nl@`P g`P WU@-`P@pl@`P `P B@@-`P@`ˎl@pPŎpP -+/X/\/A-䀟`QP- FPp,@T FP# 0S@0003/V p0003/P  E0```p0@,0 /P @000R0 R///Ḹ|0@030/R8@-P@ 00@ E R888耏C-@Rp`@"0xQ03/|0003/Wx 00S @LT03/0x0|0 |p (0@/8@-P0!@S:LE1088 / /0020/0 020/0010/0010/0@030/Q 0001 S9=//00020/0S/@-@MT0>  @@@  R@T'   0@@ЍR*   00@ Q0 00 x0"p  d  \0ЍL0L 00 <0  h  0 @   v<0@-SM@ h0h 00\0 <0`Ѝ@0S 404 00 $0ߞ@0`Ѝ `  $ P <0S Q/00 0S S SX/P/H/@/8/0/(/ / 0 , (  L0-S M! P R Q :AQ 0   Ѝ 00@0@ 00 00x, Ѝ00  Ѝ4 08 (00R/d 1P!/xP/<P\/@-@P 0S 0 @3V000@-@P M 0S t0t 00 d00PP0SP<0< 00 (0 Ѝ0@ h U _@-@PPP1N18⊾D∾ 0S @p@-P@PPpB56t0`03/P P03/U03/03/= 0S @p贾00 0@-0 M@ 00ŝD0 0PD03/P0PD0 0P3/ D0TT < 0P0 $0妝 Ѝ0 Ƚ0` @ 8@-LP@PP8\P 00\003/l 0S @8(0D l1p@-cd!M0@0 L1w<DQPP h @0h (1<003/0@$ R<@ P0 0  00 0MЍpV(2/P00 D01S $h0h 00 T01L0L 00 80' 0p  l  D p@-`P@vl B\`Ppt00N03/P\ ) \0\ PPp,0\003/0\0p p@0QP@-@ @P 00PD0 #QP <0S  /8@-8P@PP8\P80\003/0\08ȹ0p@-(R@PMP{ 2"00 2 ࣜ0Sr Pr  R01`03/00d0S hP`  R0d03/0h0PP f0P3/DP rT]@0D3/0T3/0@3/<P 0<3/PU BP0  0S P03/0$3/0P  R0x0x 00 d06# 0S @Ѝp,0`x 0 00 P/@P/Q QDC-QEMp@`&)VP.`!`H`,?`<@ 0X? 0W 0000 0N@1@! 0X H0g+0 \Eߍ蔐 @,?V㔐<@ 0 ,hA> `!c,2P0 | 00000hh0   T 0\00 HX Eߍ`DL p@-@`YlWLT0T 0P` P03/U0x3/ 0S @pԴ0@-@ᠾP 㙾PP P 0Ps//P/P/Q Q///Q Q/0S /0S //@-DR@TPP M @P DP $T0So @0St D0SF T0SL @PI kTP MCPM.K.8zDxDP=.?Co??o @10$3030 !  LD 0001 Ѝ00=03/PD0 0 00š0DP03/0T3/0@3/0D0T0@0\@0003/T 00l03/@ꈳ@h 0p@-Ha0@Md00PSd0`S. R+  ` P p0`Ptx|R/BЍp@3 ` P t0`Ppx|L 9 @  40N00d003/ 0d0Ѝp 0p@-aP@P!d 0 0 ,RPPPPPYPPPPPPHPLP]Bdh YBP`P h0P`03/PP<P o0<3/0<00$3/0$2(2p@0`,0@P00//\ @P00// 0\ R 0S0S S//0X R 0S0S S//R@-@P` QP0p;0pTh P0p:0A QA  ` H R/Qa@/L;L+C-PDM0@00; z0$k`p0S W] 0 0 0   0%$ 0PL0S j:`00 :Q80SP L0SM PPU p:P000 X: 㬙p0WU U `U"L0 K 0PaX  P  0U*p 0ppSpĀ L0  (>0, 08P,+EL 8ⒺL 8⍺0L8L8ǺL0 000l8l(00 \8ᴘ0 # 00 0((   h `0 00 407吘7p000 7PP700 7yDЍ80h0S= 0S|L 8,L 8'L 8"L 8L 8(L8W L0 =6 000`0H6 㭘L0p0Upp&  h6p *L0 P0#-PP 0R\ 600 6VD R !R  R503/PB 03/P   =00D0!R 쁃 0S 0sL500P 45DЍD0S_ 1S 0S\0pW D R  E"0"0 0000W 0ppp@D0$3 3/aQP >0W00N0p0p0     8=L0 2=L0p Ā  #Г  0P P0 a>rL P0l,PP0Wg d3 00P3\,SPL083P00  3剗CD 0!"$ D 0! D0! !"0  42㤗p0W"0 "p 2%R2"00 p2$Rd2P00 L2JD2D"00 02QL0x < 2 "00 1Q1!00 1`Q! !0@0 1ٖXQ]1!00001 ̖|1003/l1lQl!0(d1 BP!0 D! 81岖  X ! , s p ; B | _  t i0 { @ Ŀ   < 2   l T( x % L c< ?  4  0 B p  A-1QM0P 0@1WD0!R 1 00l1KD0!!HD0 !D0DaD`p ;0 0D0!00 ᚖPP%D0QU 0S0S R !  !D0x0x 00 d0ЍT000P <02Ѝd  D  ` X G-\6\VM0P0@H6` ڕ(0S dt0h 0c0SV:000V5%000H5 PVЅХЕ #,\ t000㡒R202 ᗒ0 SZ|"0 0QP0D3/D0P^  +8D0 1D0  8D0P!0 ! 1g1tPX$1 00>'LPN1P00 0PC q    ̼  +  : 0 4 f  6 ع , H @< D & Y  ` C \ 00@-SM@ S 00Ѝ0DP 0SP0 0 P0P 00㳑 0S S Ѝ00S dS000 t0坑h00000 L0呑HD000 00凑, - DP 5D <A-@PMp`8 0S5 P0P0 00g0`0 00p]0  ̀p0``P p000 \0IЍL000` 40xЍ$T  } ~ p ( p@-@PM1 0S. P0P0 00 R0S 0 00 x0 Ѝp`P T000` <06Ѝp@ $ $ $ ز  T @-h3hcPM0` 0L3@ܐ0 CSRi Sg  0uPUD0 S 1S 2 "00 2(D0 Sy aVv `Vv P 0BU0Z PBcUU % %  p0P @64a0V`C&&$ `  ` 0000PPE1!00 1pЍPUA1!001 a000ЍD0S= Q: Q908 4!000 1CQЍL`V 0L0S l j0 00P 0dP0 000000LQ|0| 00 h0dP ( P L h ? (  $ L ; x @-0` M0`@ 000P PP000TpP `000 L0я Ѝ<000p $0 Ѝ@ P   2"p@-0M 0t2@ᰏ 0ST0 0c D0  ,33/ 0P(  D03S 0   0 00000Q1P001 w0`0 0 0      T@ 0L8 0DPP  1 !00 1QЍp0 00P 0ЍpD0L ! 40       0  R 0  R `000 L0HЍp꠾ p  ̽ h S O 2A-1aM0`0@pP 1T` 0S] 0S P2U000P@0S00 P4P`P'1!00 0̎Ѝ`P 0 0H0 P000 0PЍ0 0H0 ߎPh P \  P0嘎LPDP@  ة  l  4 xغ `R  00/,b 0d~00t0p0 H>YH0Sb ,> 00>ލ4 R HPU  0S 0Y:S SY 0Q$0 0 Y:0Y:hp倠W p  ՓQ 0S 0kS㌀ k  |0P0 (0HP R:$( 0"PP$0Yv <,00 <刍^g0S P\Ѝ0<00 <u00: t,0 00 `, TyKP  , / | +h 0T O-0X唀,8pM0P0 8@0hC(SP` S   D0Y Rk tPP 0  唀0SP0 S Z 0Q4P00Z@\P 7@ 0\03/@70N03/P\6 @0\ P` U*0 S04S P\:@0\R P` Vږ pM P * ,H6H&00` 06׈ЍY@ 6` &00 55%005 000ЍSn5 0050S Xe5%00P p5圈Ѝ+ ,R R pP  0SU 0ᜠ0  ZN R 5%00 4= 4$004 .2 Ѝ4$00 44$00 x4t4t$00@0\00 T4tY< D0QU!@0`PPT \H0@48  `P@0\#P @0 \  "`0PY UY\ Vd@0`0SL |#0 p# d3ʇ`3`#00 L3@@3@#00 ,3P RS  >0P2"00 2 ជ@0@ Y` "N? " 2升P 2"00 |2~t2t"00 `2t\b@0`0 1 *  C A ?- , . 0 1!001 O@1V`k0bPZ @0!` ` !1 80V`Ix1x!0Hp1 f8z v' v`M J+ Z  0Q4 P1 Lk0@h  ̦ Ԑ s Sd \ , }Х  \ T 0 @ ̎ ! Ѝ ܤ  @ 4 $  ܌  L x  }$ qС P `p@-2bM0` 0@1ņ4PPN0Sg0ST00SP100 1ᯆT@ 0H4 00#p 0P0PPPPPPP 0ST0| 0|00c0 0 $1 !00 1兆Ѝp) ("(R)  0t000P 0夆Ѝp0 000 ]2 |Ѝpt0 00`0N L ̉  p 6    @ @-H2HbM0`@ 0,2( D0 P  ",33/pP50SN0 R:` jR3 0    .0 S  0SND03S< ? 00@H1H!00 41Ѝ$100p  1Ѝ0 000 υ2 QЍ0 000 B000 00 |h0h 00 T0R  X dD D Ђ j̝  p 4 O-@PM 0S <4<$0004 |000S 3Pk pPScs30P`p 0Q!`0S X3/pJ PN0S0SM S) S S0S*Q 0 Z! *0(#0jS000 000300 2% Ѝ2` 00 00S2 00 2#0xP x2\coPm0 R 0 0R (2002 00Ѝ1 ۄ 0SZd ZP Ѝ1!00 1PD0SD 1SATP= X1X!00 D1嬄@Ѝ818!00 $1堄1!00 1΄ ki0\ 0 00 0廄 X000 0uNꨜ 8 @ 0 ( < 0 G~| x < X  ( } hl} w(t  0S Q Q0 D0 (#// D0 (#/ouG-M P`dp))@P 2"0 2 V(P ЍD@ ,@P 1!01 ;  +@P +,@P l1l!0d1 &P1P!0H1 ;@PD@ 1@P 1!01 0 00  @P 0 00 @@P(ቾt0t 0l0 ك  y! ~ ! P~ !D (~ !8 } ! } !Ж l} ! } !C-M`8pᝣ @P 6PP D1D!0(<1 ृP ЍKPP 0 0(0 D@ GPP APP 0 0(0 x0 0(0 n 5PPᬣP0P 0(H0 \\ L| ! { !@ { ! p{ ! ({ !@-@P(p3@-@P0S*00@-0P 0S v)P@-0P 0S +P000  V,TR(@-\@M@QH(00 (,00  b0c0 Ѝy|yXy@BQ@-@M (0<0c! ? bA3c0 Ѝ(ЍMb8@-<0< 08P@00,+T008000@Q|Ѝ000|Ѝ0' p꜀ 80@-4M @ P$((0 Ѝ0X:N/%1A-pP0!`P@⚟003/dP  0 R@003/XP  0 R@003/XP 0 R@003/XP 0 R@003/X0S Q  R@003/4aV4AN0 R`0P 03/T:0O-鄊QPM`PP2 @4qPWb @0SD0H0L0P0T0X0\0`0d0 0p,  000, P0 ,0 b\: 0j0003/P00  !,00 c 0 0 000 P<, 00t 0c0 0 { 0P bs4 "U041T 8003/ Ѝ80N03/P4 41PSDpHpLpPpTpXp\p`pdph@ @ᆽK[ Ѝ" 0 J/K?`P00<0  00 P0,0L Pq0 <00c80 t 00 Ps P0cH  00 P,0S 0l PQ0 H00cD0  yPG00CSc0 Z$ \ P0P9, `0RQ0d#PLH T0RHR LX#PA G/0PH00 \Q hC0t0  Pj00[i 52  P00[ L(꘵0G똵"ꔵ ꌵ(0t0  P 4T0H   0$P00CS  0$P0S  P bp}40 l 8$PZ@ 4 00hlp8 t t0x0|0Pt0S|00 01, B/0 P1SP@%P P01 t 00nPP 0 Y   tP bp %@[ PP帰P尰  uP0S000 Y  hP00Yl1 018@0QPO-`4M@PW R: 0SX6P "P/ U+0 0 $p0`$ 00 0$`P R v0 B v % ZPb@U0SZ  4Ѝ 0$( Pc@`%V v Z00r r p@-@M` @PP Ѝp 0\`  R0 0003/Ѝp+0O-$M P `P? 1!0 0 3/P0p䐟h@p" 0P   P|p 0: S Pd} \0003/P ߍ8o ߍ+d\ 8@-0P cR@  R 0  P 0   @00888 @-2P# @@-P# @O-`000`(0@@0 }L_ C-!MM @΍`P Pa{ pP ލЍ pbpP Ppp SP 0 Pp>`(0@@0 1 ^ 00@-PM @ b 0P Ѝ0(@ 0Ѝ0] 0@-M@P  0P Ѝ0 @ 0Ѝ0@] O-2M M2=0@p<08>P9P 80 C P0S]P <  eᚠP<0H `K0j <0Q6P 4 90P$ 020P$ P(0 P, ,6P4  + 0p0P  $ ( ,  Pe R 0P 0t0P  PL d0Px0 00P= 0P 卒 0 <|0Pf̝  K@  @ ŕP&D0K@0 4 80@'6@P@0 gUQ0e @<@0 &PP 0 P@2ݍ Ѝ 2ݍ Ѝ]<`PD 56P  P0 bP P T P 2ݍ Ѝ(, k@-|MMzz@p`P* 0P D,,*c`P [ڍЍ4X PX 0p-@cTA 0@0lQ6:p/ L\ 0&T(`@P Ƞ̌TP@T@PDH @@T P@D@T @@_c0-PlU PU0a0/_0@- MP0 @P0S0   0 Ѝ0c@- Mp0 `P00CS R@0P0Ds@0 Ѝc0@- MP0 @P ` 000 Ѝ0p@-0@`PPp0S 0C0 R   0V0ep_pcp8@-0P@|P80S0C00 0Sg8g8C-p MP 00@apP`` V%\ 0 *PP  0 V 0V  Ѝ@0003/P P e ЍiX @@- M`@ 00Pp#P*0pcW1p p  0P0 00W0 0 0P 0 0We0 Ѝ 0S@ Ѝ_-M0 P0SS0SgЍg8@-H0@P08< P03/03/  0S @80p@-@@0T0Pp0 `0003/@Tp0p@-@P`P @T 0S Pp0RaQXC C/R QOC C0~ C C/R:R&*Q?C C0"CC0"(C C0| C C/Q)C C0"$C C0} C C/QC C0"CC0"CC0",C C0{ C C/k/0aQC Ck/@-\@ : 0aS: d  Hk@-P`p._0S@(: fP%` P_P0S0 R  d0P @P fR C @Ckp@- `PI@P Pppp@-`P@P 40P @PpppA-@Tp`PP@ 0P@ 0P0 @hP8@-0@a\PR C C 0P @NP88k80p@-PaQ@"CR C0 R` 0P `+Ppp eRC ` Ckpp@-`P @P 0P @ Ppppp@-`P@P 0P @PpppA-@``PPpa:0aS:f 80Qe C PC n0P Pkp@-`P@P V0P @PpppO-tq M`0P*p@P 0U V   Ѝ1003/P( 0003/P0 03/@P 0 3/P0 P03/P 00@L  02/0(0P03/03/ @0Q@- 0@00 Q@@/RPp-00 P\u3Q3`eQ`  S@3@# %0 S \p/b0Q@-0  0@00 Q@@/RP-PP QP0 `@|AT@@0$QPP`V0&P/ /0-@bT B 0P00 TP@@0/RP0-00 PA@t3Q3dU  S@3@#0 U \0/R/! 00R/RP0-PP QP0 @pT@@$ Q P00/RP/ 0 0Rp  R `0  R0@  00/ / "`"D0D 00 R QQ R/L0p@-`P0 < P PP @Tp@pP0P0@- 0S @@T@T@T@/@ @-@P<P 0003/@ 0S @P@- \ @ S  @T T S0<03/@T 0<03/8@-@P 0S Q RPR:( 8P8P880P R $//O-PP M0`k @Th Vf p W  Z QT W WZ0< 0r@Q9 d $0X@$@+ 0<0 (0Q $ 0R5 0SR Ѝ$0P Ѝ 0S 8pQ$ 3/ <(0p``=@ eZ h"d <@,? Ɵ@g@% @$Fa!@  @-" P@,@,tKP$P`% TVlɄ`,P`&8f` P `P %V`!P `@ & U+@"P@ `$P`Efi&@ P,(@PşeV% @ @M$ ! ˄ , `"$`%` `  `P &DeaP!` P@ % ` $U-@"P@@$ `E˂P,@PP%d` @ `P P%dPa` T$`@! b.P`!`& PD,Z@`"ğ`&@dH `%`&dĄ`$ `& H ``,`&P,$ P d P P%@ b(`@!T@$ `dP", PCe^@& @ßJ %! lȄ $ "`( `,|#`&PpSa ` `&@ P*`! HC P`&lȂ@P"` @%$S@P@ ` P$Ca P@PP% b b+@`@P@$ ȢȂ@ @@$R@P@ @$ba P`P `%pR b+@P@@$ TPȂ@@$`$0BP@P P%ba @`@@$ Q b+@P@@$ aȂ@`@@$Q@P@ @$a,Pa @@` p`|Q $ b+`P``&( XAȂpp@p' @`@p P E  @0Ѝ/xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆA-@R`P( p0T00?p0@g0T030#W0S  P@h?TPp@@D@PP?TT w C-@>P1?  M7R |#d##̠8 bx bp0`P Ѝ  P000#4000 00 00 0#400000000#4 01 00 00 00#4 01000 Ѝ A-XMp `I XPP FXЍ bPP Pp@-`P P@PP@P 0S Pppp贚 @-`Pp P@PP@P 0S P00-贘, @-`Pp P@PP@P 0S P00-|4 @-`Pp P@PP@P 0S P 00-4 @-@P 00-8@-@PP 0 0-80-TT@ @@T PUPU@0/-0/ᰘ @-`Pp P@PP@P 0S AP00-X$ h0P00-0 @T P\0-0/$$P P000/ @-`Pp P@PP@P 0S P00-,D h0P00-0 @T P\0-0/$$P P000/И @-`Pp P@PP@P 0S P00-d @-`Pp P@PP@P 0S P00-0 h0P00-0 @T P\0-0/$$P P000/Ԗ\ @-`Pp P@PP@P 0S tP00- A-`Pp X@XP@P 0S WP 0 0- G-P`UMЍ 0  2L [ϠX\$`ZP`p@p\000Ã @ 0?ϠP#\P``Z4eЍ Ѝ( S O-mM`@Pp 0;;JP  @6  RZ ;W p R@ mߍ!>P 8P @!q<P  0W@ YPW @   @P  P!P P 3PW G 0  0 0          /O-tPp$M` PP  PP@E0` S0` S0` S 9PP 0 S0 S0 S0ehS0U*@e @ 0@,p 30 03/`P @  0@@Pm ^0 Q0x3003/ D$Ѝ\ P0 S0`` SxPe Xq PjXh Pj  P  PSP0eSw 0     0B \ABZaB7B\dWB 0 S70 S7P808P S.Pu[ H0Sb X, X= XJ 0SV 0R R0 R0|1003/ 0`0$Ѝd$Ѝ\$ЍT$ЍH 0 L   x@T 0003/[H 0 L   e@NH 0 L   V@?=S P0H  R0 0003/@(L@0 | 8@-x@ P Q  0S 80P03/03/  0S @8 0O-ȁM@ `0pP0 <> 0!3 0 PRQ?0 >PP@ 8 8RP  `@R@1@@#   0dP S` 0P@ 8@0  l@0 03/Ѝ\0003/P 40 003/Ѝ@) `0@O-@SQM@@ᄒ@YspP , Zs, sP ߍ2u2XP P @ ` P P ဒ U@1 @!  pPUPV 0[ @1@! b[0Q8vO vOr 0 0 P8,P 0$ sP$ sP sP sPsP W+Z)  0sP P0 R0 0S  0S @ 0S ,r ߍZ!  0 R 0 04 Y 1!  Y 0 S BQcR 0sRS!b$ 0sRT!bvߍ.PG-SM@`P@\,pl! @$@(@80R@L $ 0lP% z @P VIP @\@N$(@ @ 0PT PX!\1SRލ0$    (0bP0T X($  0X\ލލ C-KM @pP` 0` pP Kߍ LH!P1 `0S KߍG-M@e`PN (P⨁p  p0 0 0MP ЍH@6P 0 R00 R0 Ѝ! 0P PP``P0 bPO-PTM0p|^s 0\ 0[ 00 00@ arPOx rPI  rPCrP>  Y` CrP1  rP+ rP&[0   ! 0 S` V0 \ !0l 0 00_ 000S0BR\TЍO-0M0T@`p P($@ 0 H0P4 R Ѝ/ @ЍЍ8PH P0L0R0 0 d P7 / @P$pP <@  T0P,P,RPP 0T 1R0DX 0R@l@Ḑp \X  pP2 p y 0d  h0P0[  P0[ @ P$ P0[ bp}dx x h0 P P x0! @P(1$!0(0 0  1 X 0P8 O-dMP@`p(6 qUT0 0S-Q*AP&AP!@P AP@P l= j=  BP h= f= dЍdЍ  AP >  ?P0 0[s ` 08S >  nHP@P 0 +5[ P  0FPp  A  P A  P Dpx'xPX!: @  P  |A P/HP@P'@p  0B w@P p C-SMPp% i@@P d@P_@P Z@P `<<  HAPP <<ЍЍ 8APP  GPP  PC-M@`pQ;V  ?PP M;Ѝ  BPP00S  ?PP 0 BPP40SP  4GP8@-PP <@@(0S MP888uL0P D00(0R(0 R// / udu0p@-00S|P|`|@P`t@P@`T *P 0*S00@P0  00p4` ТȢ,h@-P } @-P00C S3G/  ///P:PP///00CS 3//0 00@/$ /*0Ps/O-?_L<Ѝ!R  0  .> L@0'P0ASD03S&lnl>`0 0P>DLL0 0P?L0   `QP ͟ p0 0P Q 0 RN =P p L 0B$  ` PPPP= 0 08=pK0= 00 =K0P000)|<#`p0  H<K<0< K``Ā0 V x< 00H0`K,\l `XQ*0<0,00N0 KĀ0`0Q ;+00; `K0\P P 5QP;+0p0 ;yK p;pl+`00 L;iKXcphW`0  000 0p)# `p`!! X !` `V`x:*0H: 3KV&4` l00̰  0  0WᕱPPo:*00 :K<Ѝ0 0P0`IЍp`808 00 >H` |  ̂ 0O-oS`M@ D R p/0 d/ \?GP00pW񏐏Ky50+&!D01SyP pЍ00Mp>.00> G00pppp·p4^4>T 0P` 0>\GӡpP[0 CR S 0S\ D0SC !R@ QR  R `(33/ 0S D0 S! 1S jP` P$0DP P \ jpP0\ 0"$ 0\ 0 \ 0 P P 000忭pP<,00 p<;G_`d\Pa0P0T H<`0P 00<'G0 C0CSR<00 ;GL<[;P0 0; G|pP0Sh0   Q] RY   0p;p+00 \;FpT L[L;`0P0 >F00C S`+3 R BpP0S{ 0  0 S0r0*S 0* : *00: F0S0S00:*00 ;FpT XZX:`0P0D: \F0 0CSpP{0S00 SR 00S00 9  )00 9sFpᄵpꠙ9 0 09cFကѼpP0S000P *0SJZG449Wp pP0p 09PpF 0 2'  ೷0Qӵӵ 0ӵw R0q QoRmʐ8000 8 <040s> FD 88"`00p 8qF V0 07+0R,0'&JQ( Ry% #$0RTpT0Q; pp70 (0T7`EL7#0( 00071FD0@p#R V XA     A`UD0&3 S& v6p0 0 6E6 006E6 00 00{>E0 10C@ P P,6,&00$6 qE/ xp:p5%0p0 5YEu|uz0D 00 `?pPQ|500D0C?0 \5qF0D 00/;pPz$500D0U?0 5EF`0  000含pPK400 4 E14$004 E0p00#|4|$00 h4d4p00 L4'E@0\P> hP @0D\0 pPGpP3 003D000&00R0 3#003 D2 B2 Qr3p00 3B3p00 4BT $P 0P 44BF (HtL4L$00 `4B2 ttx4p00 4B4$04 B(  SpP4$000 0}>gB5@0p 5]B(`Z  0 [4XX% (, hh% 48 xx% <@ Tp!S %S S %0 % 5+B i0JS JZt 0 0 [4SP S+ S$V$6P0 086 B0 YS Q Q0S6&00 6A( p26&006 A0930 Y R 6&006 A( Opv,0( 047A0x R | R 0@  00 Y 00Y 04Sp0PtpGxP4DH'xPL|0U*W`aၡ 8P A0x !PV48 0`@(000 X8DHPLpA0Sp Y?^0  PQ(0 $@ 08A-8(008 PA00 0S Y~@0 h  9 )00 9:AY0S,@9@)00L9 *A00 0S| YzD0 #9D 0`0)00 9AܞDHLP9)00 9B  `fR  p t S!  W LL ( P ``000P0 :@U:(0 ` `  `-:00 :@:*00: @/ 6{Tp,2S0P%RPUo 4;4+00 H;@P;P+00p h;@p;p+00 ;;+00 ;}@{0`p P R V  $0 $0 P 00ᐚpP <( 00p0<@P ׮uLQ R S  !R |<00 <;@<00 <3@ < p0 0 < p$@<00  <pP@ ` 0 \ ⏱\(Q`0S Qʑ S \=0p p= Ph@ 000hS=D 003/=00DP3/D0P  D0q"ᥝ>00( >?pLP^ \0>0.00 D>T00 `0V   D0`Sp 1S >P 03>.00 >>00 >?~> 00>? ?/00 $?|?(,?,/00p D??L?L/00 `?d?d/00 x?L0S ? 00??00 ?? /00 ?>?/ ] p t Sd AvQ6 006h|6 00h6?dv`60 0L6? 2 㔭8v1464&00 62PL0SO M( ~@5%00 5>F5 005X  %0 5I?(0U 0b`E PIPp``5 00L5 /?@0\P aP5 0 05>( 0t4 004>t4$04 >P t4$00 /=0W:凤PP \0'P ᣤPg<$\0 4 0 04h>$\0 0 03]>\00\0e P0`o3 003L>s300 3B> S `؅ 3#00 l3h3h#00 T3+>( 㭬rJ83 00$3g 3p00( 3>s7/ 㔬V"\0 "00 2>2"00 2B"\0 "00 2="\0 |"00 h2=`2`"00 6==Dr@200 ,2(2("00 2=30R 0'&JQG @0\\0 `pP) 3 +1p00  1=|1 00>=( pUP$p je : 4  R e  + D H ̤ ~ ,   L Z ( t t  \ p , h С ܫ xc 6  O-GM ` [+2001P00 @0p =R@A TS0\S ,S TO 0 S P @0 Ph Q S @T0GߍT9 0SG  ,RD@h0h00 P9 V@T 0 S @00pk P P 0 EW  P pW 5 0h00 WP PGߍ7x 0@- M@P0>P 0 P? Ѝ0O-@R Mp`O |100# hPP80 P0 PP Z0P<1 PP!0S@T'  U P 0~P 0P Ѝ Ѝ 0P 0P0 uPT G-@MPPp,`*:0aS':f( 0eS0A`0 AP  KP ` 0 `PЍkЍG-@RP`V p 0 0C5PD  B0P? P00S  P 0P' P# P 0P0 PH@pT B/P/B 0S /- 0@00 S0|R`P`` `0`0P P/Q-`P @``pPP p pp(p@T`P/H-8M8 < 00 T00 <00`8 <00S; <00S4 40K4 K0K<000 4 K0K<0 054 K40K<00 K4 K 0 0S {00=0|K40Kh<003/0S L0H0H8 :<00<0 <0S <00SK!!!$!(!H-0S,0S30\!p!!H-M 000000hQ d0X00LR L0Q000S 40J00T 0CK!!!!(!H-M K0 0K   0B 0S` |00K0 K` Ḙ 0S@00,f 00 Kp!x!8!X!!!!!H- MP勎L塅0 Ku$  0R咅K!!(!H-Mxg 0S 00l h0ч_j 0S 004 40Ç 0弇0K!l!!!H-0M$0K   ~ 0# 0 K$0Kr$Y 0Sg00)0 0 |0凇0p 0t` 0oP 0j   ,0o0K!!!!!! !,!H-M00 x0Sd\  0S00@ <0J0u  0B0KH!X!!`!|!H-Tm~뺇 0*!!H- M   0 00 0 0 w0S 000  0 10: 0S00 00*  0R000 0  0S00P X0ن o0S 00  ,0͆00K!!!!0!@!H-"M  00 .K< Q!.K< K00 0 0 >K"b 0S20 1嗆P>KR 0S>K0` d1准@ 2R !>KS0!.K 0k000 !>K, !>K 0S0S 20 0[ 0S >K0| 0N>Kt00S 00 0S 0 0 0KX!!!!`!d!@!H-0M( , 0 40 00 0 0 00 00 0 0 00 00 (0S ,0S0B4  1R40S090K4  0K4 0K(M 0S0% 0K(C 0S00K0 00 00c0 0S0  00R00, 0K'!!H-VM@ D H! B/K< UF?K 0 0 0 0J?K 0 0 0 0N?K 0 0 0 000 B?K,0b 0S 00 0~0+B/KF?KJKDNKH  @1F?K0S J?Kl0SN?KT0S $S/80S00K!!F!!!!!!H-M 00 B/K< B?K,0  0S 00 0'01 10TBKD` 0S ( (0 0K!!Z!8!aD!H- M 0 0 00 00  0S 00%00 0000 0ۄ0 000  0R <L L0ʄ00 00 [0Kh!`!!n!s!w!MH-MM00 00 00 ;K 0C 0C+?1BK L001 K 044 1 K M 0S!1億0TB>K 0C0Ct i 0S44[ 34[2[@1[0[/[BK A@ l;K 0C 0C X BK A 0X;K 0C 0C00  ;K 0C 0C0400  0R Pd d0500 00 0KHЍ/,"h!`!!!!!"!H-M( 00 ; 0 t1KL L 0 S 0Pk 0S00!010C ;K0C 0C ;K0C 0Cl 0S  00%+K B B>K0C 0C ?;K0C 0C+>K0C 0C 4 ;K0C 0C(k(8 40R 00Kh"!@"T"NRTSH-M( ;0 1KL L0 S 0[|k 0S\\!\1呃0N ;K0C 0C(+K B B>K0C 0C |;K0C 0C+>K0C 0C q ;K0C 0C(u (~k 0S  0_ 0 ;K0C 0C k 0S 8{/D0H h0 Nk0Kh"!@"x""H-M  00 0 0 0S 0S000 0S0~00C 00BS 0u00 l0 00@S 0 00JS0 000C 0 P0 00/S 0 009S0 000 0 =0 00`S 0 00pS0 000C 0 *0 00pS 0 00zS0 000C 0 0 00JS 0 00ZS0 00 0 0 0 00 0 0 0   000 0 C0R0KMH-M 00 0 0 08 ; K ;K0C0C+;K0C0Ca 0S ll+l;t080S2 ? 0 ;K0C0C;005 0R0.0 0 0 : 4 04 ;K0C0C;0Q 00;K0C0C;00/:;80S H47 70Td*d:.80S/ @0 0 ;K0C0C00? 0R0?0 0 0 ;K0C0C0? 00;K0C0C00)980S2 0 0 ;K0C0CA00=0 0R0=00 0 0 ;K0C0CA0=0 00;K0C0CA00(8Á80S/ 0 0 ;K0C0CI0R0E> 0R0E>~0 0 0 ;K0C0CI0E> 00;K0C0CI00(8叁8;Sy 0N>0.K BKAKAKAKAKA  0}>K0C0CKA p8[8[8[8[8[ 8[  0'7Q>K0C 0<0.K BKAKAKAKAKA  0{=K0C 0CKA 08[8[8[8[8[ 8[  0&.68 0S h4@7 h40%58@0S2 00 0 ;K0C0C00F>0 0R0F>00 0 0 ;K0C0C0F>0 00;K0C0C00%5̀80S 4H6 D60$48<S 4D6 D60h$4峀8<S/ 0 0 ;K0C0CQ?B0J>v 0R0J>n0 0 0 ;K0C0CQ0J> 00;K0C0CQ?0#38;S2 0 0 ;K0C0Ca?0=0A 0R0=080 0 0 ;K0C0Ca0=0] 00;K0C0Ca?0$#$3H8:S T57 70/2;8:S! ;K0C0Cs? 0R>0 ;K0C0Cs0R>0(;K0C0Cs?0d"d289S X57 708"8289S \57 70 " 288S `58 80T*.188S2 0 0 ;K0C0C<}0U> 0 0R0U> 00 0 0 ;K0C0C0U> 0 00;K0C0C<0x/1;K0C0C 0S @ 00$ 00KHЍ/!)"RTS"9"A"I"Q"4"Y`""e"m"r"w"" "0"D"T"h"x""""H-MM  $ 08 48 K 00 00 ;K 0C0C+;K 0C0C9 0S '7L0 80S ?0 $ ;K 0C0C;0C00;K 0C0C;00X`'`7- 80S 7 $8@$70,',7 80S @00 $8 ;K 0C0C000;K 0C0C00&6 80S 00 $8=0+K B BA  00;K 0C0CA004T&T6~ 80S 00 $8E ;K 0C0CI000;K 0C0CI00%5~ 8;Sg K A}>K 0C0C $8N>0([[[@[[[@ l 08[8[8[8[8[ 8[  0%5~K A=K 0C 0C $8<0([[[@[[[@  0{8[8[8[8[8[ 8[  0P$P4\~ 8 0S H7 $8`$$8`40/.4L~ 8@0S 000 $8F>0+K B B  C00;K 0C0C00\#3.~ 80S P6 $8$P60 p#p3~ 8<S L6 $8$L60,83~ 8<S 00 $8J ;K 0C0CQ? 00;K 0C0CQ?0t"2} 8;S 00 $8=0+K B Ba/ 00;K 0C0Ca?0/\2} 8:S 8 $8L%80("(2} 89S 8 $8P%80!1} 89S 7 $8T%70H!1} 88S 8 $8X%80 2.1} 88S 00 $8U> 0+K B B, 00;K 0C0C<0!1|} 8:S 00 $8R>0+K B Bs/ s00;K 0C0Cs?0 0^}0K!""""""4"`""""""" "0"T"h"x"&"+"-M 00 0S00 0S00 0S 00 0S 00 0S00 0K/-M 00 0K/-M 00 0K/-M 00 0S00 0K/-M  00 0S0S00 0 S00 0@S00 0 S00 0 S}00 z0S/0S00 q0 S00 k0S00 e0 S00 _0 S00 Y0 S00 S0 S00 M0 SJ00 G0S 0S 0S60S00 /0 S00 )0@S00 #0S00 0 S00 0 S00 0 S00 0 S00 0 S00 0S0S00 0K/H-M  00 0S 0S000C0S 00 0 0S#3|00S;.2 |000 0S 00@ 0 0S/2{00SXh"h2{000 0S 0T0@ 0 0S"2{0t0S!1{0j00@0S 00@ 0 0S`!1{0P0S8h!h1{0F00 0S 00 0d 0S!1{0,0S/0|{000S 000 0B 0SH 0d{0 0S l l0Z{00K!""""("<"P"d"x""""MH- M0 0 00 000000X0 0000000$4!{=K0C0C-000S 00 S @H$H4{0000 =K0C0CE.0 0 0S 0S 0;0 0 =K0C0CN>00 0S 0 00 00,1 0@0S. 0@00 00S 0BS  =K0C0CF>000S 00"2z0z =K0C0CF>000S 000 000 0 0S 0<0 000 0 0S 0I0S 00!1jz0h0<0 07 =K0C0CJ0b0 o0S X0$0 S X004C.P1Ez0C0;0 X0 =K0C0C=0X=0 J0S 090 01080 0;0S 080 0 =K0C0CU> 0 W>K0C 0Cd =K0C0Cf 0KHЍ/!"$"<"'\""tH-M00 ^ 0S 0044 40y0E.0y0K!L""H-M00 0 0 00 00 K K0K  0S 00`` `0y0T00<H0S00S00K!["y*("H-IM;K0C 0C+);0 0 0 =K0C 0C 00 0KH-EMME/K< /K< /KI? 00 0<3 0@3 0D3 00 j 0S 00ll#l3Oy0K -K?K  0S $,#,3=y0<@#D3 0#30y@3S0D383 E?K,0 0S 00"2y0KE/K< /K?K 0S 4X"X2y0 /KE? ?K 0S  " 2x0p!1x /KE? ?K$ 0S x!1x0V|  0S @!1x0HX 0S T!T1xP10L?K00/K  10mN@?K0u0/K  00qN@?KT0f0/KT  83S 83S0S|lܰ0K! 4"l""!!!("."1"6("<P"Bh" y*"H-M  0S 1Qx0=gq 0S# 0Ex016q0 Io1 0q0 =og 0Sa0 0`  ˆ 0S(2 80xla s0K"""" ""4"H-BM  $ ;K0C 0C+;K0C 0C4+J 0SD 1w0<;K0C 0CZg 0S014S mn 0S 00S 4S 0 4  4S lUn 0S 00S 0 4 0S a0 0 0K""H"" "H-M   0 0S00S0;0 *040 $0 &w 2~w000{ 2uw0S@04S 040K@0;070 0;0ᤋ0;00 0$04N0S 0=0,H0S 0=0 >0 &@0S=04S 040;0%0;00 0$0D040 040S 0=0,0S 0=0 0 &0;00t x0v040T \0v06S 0 <0v0;0q0K"\"p""""H- Z 0S 00,3u2{> v2727272727 27  0 # 3u2y27 27@@ u?K 0o/KA/D 2&0 2&0S!10u!1*u2<0  0 )0S 0S 0S2m>0o/KI/2q>0o/KY/ 000.\0t0K"t"""" ", "D "X "h "| " " "% "' " " "H-M00 00 0SY/2t"k 0S 00x|"|2tx2  p2  0&0u>0 $8"82t$200 " 2t20=0^/2t1060!1t1000!1t10<00p!1tp10<0L_/1vtL10 =0(l!l1mt(10<0P!P1dt10<04!41[t00;00-1Qt004S 0040 0Ct006S l00j> 00D 04tD00m>00 0*t0K" "k "y* y*v0 "w@ "L "y\ "zp "{| " "} "~ " " " " " "-006K/y*-00<K/y*-00m>0K/y*-00q>0K/y*-00 =K/y*-00<K/y*H-000<$0S00y*( "-007K/y*- M00 (007S 00 0K/y*- M00 (007S 00 0K/y*- M00 (007S 00 0K/y*- M00 (007S 00 0K/y*- M00 (007S 00 0K/y*- M00 800S (006S00 0K/y*- M00 (00Y7S 00 0K/y*-(007S 00K/y*H-`1061S6 L1065S1 81064S, $1067S' 1068S" 006!S 006#S 006'S 006&S 006S 006S 006S0h006=ST00<H-0S 000<($0S00y*4 "D "-00X7K/y*-(007S00K/y*-(00x7S00K/y*-(00z7S 00K/y*-00z70K/y*- 00z7000K/y*-00V7K/y*-007K/y*H-M 00 0 0  0Sx t0Er00 0/0 0 0S( (01r 0KT "h "l " " "H-M 00 0 0  0S| x0r0,00 0 0S8 80r00KT " "l " " "- M 0K/-M 00 0K/-M 0 0 00 D0 !0R0000 0 S0K/l#- M 0K/- M 0K/-M 0 0 00 D0 !0R0000 0S0K/ᤫ#- M 0K/- M 0K/H-M 00 0S 0S02S 03S 0S00 0KH-M 0S 00KH-M 0ST0S00K- M 01SJ 04SG 05SD 02SA 03S> 06S; 09S8 0:S5 0;S2 0<S/ 0>S, 0=S) 0S& 0S# 0S 0S 0S 0S 0S 0S 0S 0S 0S 0S 0S 0S00K/H-M 00 0S820<30S 10<*0S00 ^10<0S00 R10<0S00 Fh10<l0S=00 :0S7,10<40S 10<0S00 "00<0S00 00<0S00 x00<0S00 02S 03S 0S 0S 0S00 0Ky* " "0 "@ "P "` "p " " " "-M 00 0S 0:S00 0K/- M 0CS 0IS 0S 0S 0S00K/- M 0CS 0IS 0S 0S 0S00K/-M 00 0K/- M 0K/- M 0K/-M 00 0K/-M 00 0K/- M 0K/- M 0K/-M 00 0K/-M 00 0S, 0S) 0S& 0S# 0S 0S 0S 0S 0S 0S 0S 0S 0S 0S 0S 0S00 0K/H-M 00 y0S02S 03S 0S00 0K-M 00 0K/H-M 0SQ0S 00K- M 0K/- M 0fS 0gS 0hS 0S 0S 0S 0S00K/- M 0K/- M 0K/-M 00 0S00 0K/- M 0K/-M 00 0K/-M 00 0K/- M00K0[K/- M00K0[K/- M00 0K/- M 0K/- M 0K/- M00 0K/- M 0K/- M 0CS 0IS 0S00K/H-8M00 0 0 00K 0 0 0 0 0 0 0 0 0 0S00 0In0/00K$ 00 0 0S 00 05n000Kx0S 00K0DX X0!n000K0  -80n0K " "l "/ "5 " "= "8 "O- MM( , (0 ,4 ,4  (0 ,4 ,4  (0 ,4 (0 ,4 (0 ,4 ,4  (0 ,4 ,4 ,4 ,4 (0 ,4 ,4 (0 ,4 ,4  ( ,4 ( ,4 (0 ,4 (N0 ,4 (0 ,4 (0 ,4 ,4  ,4  ,4  ,4  (0 ,4 (50 ,4! (C0 ,4" (o0 ,4# (0 ,4$ (0 ,4& (0 ,4% 0 ,4' 0 ,4( 0 ,4) (0 ,4* (0 ,4+ 0 ,4, (0 ,4- (0 ,4. (0 ,43 (0 ,4/ (0 ,41 (=0 ,40 (*0 ,44 (-0 ,42 (20 ,45 (I0 ,46 (0 ,49 (M0 ,47 (0 ,48 ?K,B>K0C,,4004 ,4044 ,40,4084 ,40<4 ,40@4 ,4 0D4 ,40H4 ,40L4 ,40P4 ,40T4 ,40X4 ,40\4 ,40`4 ,4 0d4 ,4!0h4 ,4"0l4 ,4#0p4 ,4$0,4&0,4%0p,4'0`,4(0P,4)0@,4*0,4+0,4,0,4-0,4.0 ?K8<@ DHLPT X$\(`,d0h4l8p<@DHpL`PPT@X\`dh `0$44lB.K B?KD eB>K0C0,, ,0TlB>K0C KX ""l ""H-M  00 0S 0S. 06l0"0 0Sl4 p0'l000:S0 000 00S 0 C S0K"$"H"T"H-M 00 0SO 0k0)00 "0b   0b00 0b  0 0 0b D000@ 000 0S0K"p")H-M  0S 0S0j ,2k00 S0@So 1k0s00S 00St 1k0d0K![g0Sb0 0 K 0KAHT0?SO0@0 K {,0K!5p0KA100 *0b 00, K f0b  000p K@ Z K,0K0S  Kp0K0S0 000 0S $04k0K"""")"-0K/H-M 0S 0k0+ 0S  0 k0 0?S0@0T  0S  (0j00K""")"H-Mb/w0 0 0 0 0 0 0 0 0 0| |0 0 ~ 0S HA/D0jK) ")("V)4"w)@")P"ٱ)X"""H-M  0S 0S 0S 00S 0vjH@ E00 0RP P0ejD 0z  0R" 0VjKh""""H-$M  $0 0S 0S 0S 00S. 06j8$0#C!? c0100 c00 $0S0000 @ 0 00 0RX7 \0j$00H 0!  0R< 0iKh""gfff""H- M   00 0 0 0S 0S 0SH 0i0( 0S00N 0i00 00 0 0S 000T 80iO0K0Kh"""""H-M  K0 <0Sc 0i-0Sh 0i$6g0K 0 0S`p l0|i0KN0 KT } 0S u ,0jiKh" "4"L"""""H-M00 00St p0Pi.j^D* D0Di@) 0S - 09iK#"0"L"gE#X"H- 9 0)i/j"h"H-M  00<H 80i400S $00 3/K"")H-V 0h""- M 0S000 0 K/#H-m 0h""H-M   (v $0h/pjo0K""H-M   0S 0S 01D 0S ,0  $' 0i0K|))"tH-M 0KJ0KH-M`2 \0hX00S H0 J 0S 7 0|hK"@")X"H-MJ 0S D 0fhK"p"H-PM8 80S! ,00  K40K800hS d0Jh 0v> 0$ (,04   ((8 v 003/K"""")H-M 0S dlt|<0 <0 K?<0m 0h<0K""H-M 0S#$Dx 0gt| t0gT X0g 4 <0g 0gK""("P"p""- M 0S0?K/H-M   ?RH D0g < 010  0  K""(y*H-M   ?R4 00g( 01 0 K""(y*H- M00 00 9 010 . 010 010 QP 0  010  p0 1`0 T0 A00T07000 0SK(y*Xy*Hy*H-M00 h003/ 0ZSP0000< 0400dS$ 0gK褲))""H-0M00   1R>10S200#0C&? c020b" c2  b0  K40K+0 0"0b1 ,0t 400c;>P  D0 <0 0 ,0   00RhKY)ųH-M 00 0S 00S 00S44!41fG,10S !1f=3m0 0 0 0 0  0f 㢾0S 0f00S h 0zfL 0sf 0S 1U0#1zK" ")"")"8"!T"6h"H-M  L0K 0 0 0 0 0 0 0 0l0K 0 0 0 0 0 0 0 0 K@0 0S 0S 0S000 2 000000S000 00S00S0j0K@  K0K KK, 00cL K *0K+ 0S0J00 $1 000000S000 00S00S0/0K@ K$ K(0K,KK 00cl K 00c0 $00c$0 0@ $(,L K@lK K0K#""H-HM8 < @ (0K 0 0 0 0 0 0 0 000 80S <0S @0S02800 0 000000S000 00S00S0, K00K\} 800c( K8 {,00c,0 ,00( K@(0K#""H-M  0S 00S0M0K 㢿,0S ҽ 0K  Ƚ 0K o 0S{ 0d0%000K0 0d0K 0s 0S00K\ M0KH< s 0S00K" ","P"X"\"`"H-M  0 00 0S$ 100c|! %?0c 0 \1 X10?0c0c8! "?0c0 00C  ! 0国0S6 0K 0K s 0S0' 0R 0ed00K,0S 0K.0 K  0K#0 K  0K#ųp"P""|"H-`MH L H0SL0S 1,d0=00  K@0Kb,0v> 0~S,0v> 00 48<@ 0   0d0Lټ0L 0S@ D0c00 0 H00 0K0K""""H-M  0 0 00 0S 嬼0 0S 000 0S HH !r 0S000 0S00K"X"-0M( , 0 40 ,0 0 000 400 00 0 0 00 (0 @K(K/H-M 0S00 0 0'K"H-TMX \ \ KT0K᰼T0<S T00(0 T0<SP00P0$0 L0 0 H00 D000 @0v> 00 400 X0(@KXKMH-0M000 0,0 0(0 0$0 00C 0 0v>C 0C0 00 00KḼ0KHЍ/MH- M 0 0 00 0 0 0K?0KHЍ/H-M   0 00 0S 0S 0}S d00S T003/ <0R 0} S 00S 003/K贲) H- M   0 0S /0 0K 0KE 0S 000 0b 0[100 0[#100 0L4 L0b 0[100S 000S 003/K"X"")H-M   0 0S $00S 003/K贲)H-M   0 0S  0 0S 0 03/K贲)H-M h0S 0 0 0 0 0 t0 0 d0 0 T0 H 0%C8 0 C( 0CxC0K")xH-M   0 08#88 0o0KH-M   0 08#88 0o0KH-M   0 08#8 0o0KH-0M( 0K 㒼(00 0 0 0K 0 0S 00<D 80a0(00G 0a0K"""H-(M 0K e0 0 0K 0 0S 00 U 0a00K"("H-0M( 0K A(00 0 0 0K 0t 0S 00<f 80a0(00i 0a0K"<"\"H-(M 0K 0 0 0K 0I 0S 00 w 0da00K"x"-K/H-TH-106SMJ%]t106S `106S_;dN8106JSU12D106ESZ'2v:006SP0l0006MSZ2b&006SU 2Xp006SU<NH006SUPD 006SZ(:y*H-M 0S 00 S$, 0`K""H-XMH L P T0 H00 0 0 P0S T0ST0000!01`0D0S 0S00 0`05 0 0@0 0040 0000 000 000 T00 0<0 L080 00,0 0 0(0 00$0 0 0 @0KP T0`0= 00@0 0040 0000 000 000 T00 0<0 L080 00,0 0 0$0 0 0 00   1(0 0 0 @0KP T0 0S 00D @0|U0㍭  0sU0KH)\@ "!"""H-M  K0 00 00S0(0S 0S  K00Kd 0I0KR 0S 8' 404U00 0K舳)""0""\""""H-Mt00S0`R 0S H: D0U0(0  ? 0U0K舳)""\""""""-00K/ሳ)H-M # 0K000K 0K 0 0 0 0 040K 0 0 0 0 0H0K 0 0 0 0 0\0K 0 0 0 0 0p0K 0 0 0 0 0t0K 2x0K -|0K (0K #0K  K 0K h Kt0K 0 K40K 4 Kx0K 0w KH0K vH K|0K 0j\ Kp0K _\ K0K 0]p K0K 0Vt 0 x 0 0 0 | 0 00 K <90K""H-PMP 0K 0 0 0 0 0,0K 0 0 0 0 0@0K 0 0 0 0 0D0K ㏮H0K ㊮L0K ㅮ0K  KD0K 0,0K , KH0K 0@0Kp @ KL0K 0D P0 H P0 L P0 P00 80K""H-M  0S 0S~ 1S0<00S 0S01f0S a0S 0S0 A/Q0| ɭ J0d  ­P004 D0iS800 ,0bS0K#"H#"\#"x#"))#"#"H-M00 00S 0HS0tdA/c 0SH L09S0 ,00800 (0.S0K)#"#"#"#")$"H-M L K@0 ᶭ0P0 0T0 0X0 00 0\0 0`0 0d0 0h0 0l0 0p0 0t0  0S10 0R05 幮0S 僬0+L KP0KTK\K`KdK hKXKlKpKtK  t囮 0 S d0 P0SL0KȮ X0K4$"D$"#"H$"\$"d$"H-M P K@0 G0T0 0X0 0\0 00 0`0 0d0 0h0 0l0 0p0 0t0 0x0 0 0 ((O 0S 10 1R08H0S0.P KT0KXK`KdKhK lK\KpKtKxK * 0 S 0T0S P0Kᯭ0S0K4$"D$"#"H$"\$"d$"H-M M1 K1 K00 00 0 0 00 00 0 ;K0C0C+;K0C0Cl@ 0J 00 /+K B B020a2 1 Kg0S 020b2 K000 0K0 0 K000 0Q00 000  0R0S 0S 0SL0K0 00 00(F/,0Q0K""#"$"$"H-M 0S"2Q0xm 0S10!1Q0hA/090 0 0SN,0K ,0K 㓩A/# 0Kᆭ00SN/,1xQ0>0 0K@0t 0!) 0S00-0^Q0$A/0K0 0 0AS |00d 0KQ00 01 0 S/H0:QЪ0K#"#$"#"D$")$"$"%"%"F@%"p%"H-@M0K 0 0 0 080K 0 0 0 0 0 0 0 00K 0S 02 K80K 80K 㛩0S 80K 㓩0S0K0tt t0P00K 0S 004< <0P000 0K%"%"#"c%"i%")H- 0S 0 S00H-BM00 Z4㴨C?KA/7C?K0 00 0CKC/K  0 00 0K-(00S000 0 K/Ĭ#-00K/Ĭ#- M 0 p0061S \0065S H0064S00 0 00 0 0K/y*-00K/ᐳ)H-M00S㑩0S 0| Y_ 0S`00S T0000Dm/@0P0$00 n/ 0P0K蔳)%"#"%"&"H- M 0S 00S  ! 1O0@Ǩ0S 0O0400 0O崨0S000-S0  mҫ堨00x h` 0S \00X0000 D D0O00K#"(&"D&"X&"))%"l&"H-MT.P0OL0  0S ( (0O00K#"&")&"H-M   0 Q}/0sO0S0S lp p0fOlMw` M 0S $8 80TO00K萳)#"&"&"&" '"('"H-MC?KA/کC?K{ 0S 00LL L0/O0 1[S 0CKC/K  0K#" @'"-M  00 0 0 0 00 00 00 0 0R:0K/0H- 8M0 4 8 T1,K 0 00S 40S 000400 v 1N0:00 00 00 .00 4@040 00 0 P 000 0 K 000%00000 000  0R 80R00j00  80R0 K0'"\'"'"H-hMX 00 0 0 T0KX@ 㚦T KT0K@ T P3R T00< 83N0H00 H0, @0 0 0S 0 S00 2jN0 L0R L00 2]N080[S @0S @00t |2NN80[S P \2EN3[ P20R 3[ 820 0  24N0z0S  1)N 0o,0[0S  1N 0d3[ 10R 3[ 10 0h 1 N0Q3[ `10R P1 3[ 0  D1M0?70[(60[4 50[00 1 0(004 0000  0R'* 0M70[60[ 50[ 0t 0M|0 t0 l00 0< l0M$ X0M0 0KNRTS\'"'"'"("$("<("Ԭ#T("("("(")"\)")")")"H-XMP P0S0L0KD 2L0K0P啩Pc0L0 L0K0 00 0M0K\'")"H-PML0KD 0L0 L0K0 00 0fM0K\'")"-00K/<)H-,00s 0KM00Ȭ#\'" *"- M 0S $00 0 00K/̬#-00K/Ь#H-Mp00S`02' T D0 <00S 0000$$ $0 M 00K )Ь#\'":4*"H-M  0S( 0S 0L0)儤 0S U/0L00 0 |0 0 0 D0  .80L0K\'"NL*"$)d*"<)Ȭ#̬#x*"H-M  0,0 000 040 080 00 00 00 0<0 00 8 0 0(0 0S 0S'7L0 /N0,0 ,4 40S4 0R&6}L04 x,0,0,0 ,0 0 0\l&l6fL,0 40 0CC8 ,0 80R 800 f/ 6RL0{00 K0, @0 000 00S 00$0S%5:L0c00 00$0 0Rp%5+L0T00(@00 0  00$00T k/D5L0?00$ 000  0R % 5L0/000  ,0 0R: 0ឤ0@0 @0S ƣ00ሧ00d$4K000 0, @0 000 0K t0 0K52D D0S000 $ 4K0(0S K00$0 0P -K0$ t#3K0 0 0L#3K00$ 00 0 0 .t3K0{00s3< <0S<008#83K0(0 00 8 0 00 0 0$0 | 0<( 3D D0S p"2kK00C0 j00$ (0 c 0R*00$ (00c 0 (0 ? <$ 3D D0ST"T2IK00C0 H@I (0 ? <@ 3D D0S "21K00C0 0 0@$ 0S D/1 K00C0  0$ 0$0 (  00(0   000 00 0d 0 T1 L100L0K 5!1J0K 0S 00!1J0Z ? 0SM000  0,#.<1mJh0@ 0 00 0 0S.000  0 0NJI0!ߣ 00x 0@J  0 0S 008` `00J+0&0K\'"',"*-"-"-"78-">T-"Al-"H-(M 00 P 0Stt!t1J0T0K 㝤0K 0S 00$!$1I d0<00  0K  0% 0S  0I K0# G 0 0Sh 0I00<` `0I̡0 C Sʫ0K-"\'"V-"]-"̬#f-"o-"v-"H-]Mp t 00 00 00 0h1 0l1 t10p10#3It[00 0K 0K 0K 0K V?K >K  0R<D#D3]I00 Kt ᧣ KZ?K  0S 0 K  ᕣ00 0S 0 K  ᇣ 0S 0 K  {000 Z?K\ 0S0K<v0S0K0S 0K0S"2 I0s10L10<ԡ0V/K KV/K[?K à 00 0S 忡0.K  6000 [?KH ᬠ 0S K>K00S !1H05p1S p s0S  0H0$00S /0H0ph00 Y?K    '0P$ $0S d d0H00K\'"." ."X."\."h."y*."."."<)/"P0/"H-0M  00 0 0 00 0d   #?0c0 0d   #?0c 0 0d l  #?0c0 00 00008 40GH( ((K聀\/"/"H-M 0 0  0  0S+ 0$H00K 000 0S \1 \0H00 0044 80H00 圡0K@)/"/"\/"/"/"/"H-M00 0 0 N0S 0``姠 0SHI D0G0 0K 0tl 0K/"0"\/"/"H-M 00 0 0 堠000 00S]0 0 0S0$  H0 0 0 0 0  0 0 0 0 0 0 0 0 0  Ģ0KD)`)- M 0K/H-M00 0 0 00 00 000 J(00S~ 0bG000 003/ 0S000 0 0R000 000 0 0 000 0Sv 0KD)`)\/"0"H-M0 0 00 ,M 0SA 00S00  00S00  00S&& 00S 00/ ! 0 0S 0& 0 0/ 00S 0& 00/ 00"'H-M0K P)0NK\H-M   0 08#88 0wT0KH-M  00 00 0 0   00 K 㲞 00 0 K  㨞1[8C8S0c 00 00 0 0R: 0000 0S  0 t0 0j 0 H0% 000 _00 00c0 0K@4@H-M00 5069S00 506CS00 5061S 5065S 5064Sv00 p50<d厡0Sn00 po<506BS00 g506AS00 _406$S00 W406=Sv00 O406DSp00 G406HS 406JSt40<lO0Si00 1x00 .8406LSn00 &406Sn00 306ISs00 306fSn00 306&S00 306%Sl00 |306BS h30<d _0S p00 8306ES $30<$0Sb00 2063S20<0Sn00 20<ߠ0Sl00 n00 |206%S h20<t̠0Sx00 <20<L0S 20<,帠0S 10< 寠0S!1JEn00 106<S10<嚠0S |106;S h10<匠0Sv00 <1069S (10<X ϝ0S 106:S 00< m0Sp00 006;S 00<]0SZ00 006>S l00<M0Sx00 @006Sv00 $006Sl00 0Ky*<0"L0"\0"p0"0"0"0"0"0"0"0"1"H1"T1"d1"x1"1"1"H-M 00$$ $0D 0  0K0"E1"#- M 0 0 0K/#H-M 00$$ $0D 0  0K0"R1"x)- M 0 0 0K/x)H-M 00\\ \0rD0SL0 0S00  0  0K0"_1"|)H-M 00(( (0ND$0 0 0K0"n1"|)H-M 00 07D0 K0"v2")H-(M !K00 10S 10000 00!K1/h10S SX10SNM 0S00  ! 1D10S 10 1 00OS20 0 0 00 0 00C!? c0100 c0 00S0 p00pA?0c c`0 @0 <0 ,0 K茵))x)0"2"))))98##H-M 0S S SA00 K00 P00 00$n/ 0CA00 0K0"02"H-MJ( 1 x100lr/h1{Cd10S ㊛NL10SホG410S|@1 10 10  0 0TC0 0RS&00  0 0BC00Sd 09C00d 3/ 0S 00 T T0(CP,P2"#0"\2")x))|)#x2"@ )2"2"8H-0M( 00 0S~/0C06 0K 㘝0 0 0 0 00 0K 0 0S 00 0B00(   x0 00(`0J 0S D D0B00K0"2"g0h2"))j3"H-0M  $0  020b1 000 020b1 $00 0  020b1 000 00 00005 0B  0R  0R  0R0  0R  0R  0R00K03"t3"-00K/᜵)H-M 0SL 0VB0SN 0MB0StP x0DB0SPR X0;BTP0 0R @0 00  eK03"3"3"3"3"x)))H-M pl0 0R 0S000 D0 @0 0000(h $0B:Kx)#))03"3"-00K/ᤵ)H-M00 x00S hqtqtqhqtqhq00 00 4000( $0A00 0K蠵)03"3"H-0S000H-0M   0 0000000 00000 1A傚00 X 010b100SKd 010b10 @ 010b100   010b100    010b100   010b100   010b100 d 010b100 000 0S|0K03"3"x))H-4 004A,( ˛e003"\4"x))H-DM00 00  KD0KX00 R` 010b1000SB, 010b100 ,0R30S3  010b100  010b100 010b10 0x@ 010b1000<@  0S 00 000 0S0K贵)H-M  0S 0@00 0 0Sd h0@0T00Sq 0 000S(0 0 0K03"h4")4")-00K/ᨵ)-00K/ᰵ)H-Ml100 0S T10S00 810S00 10S00 10S00 0 00S 0S 00S 000 00S 0S 000 h0 0R dL0  PY8000<< <0@00AK蠵))))x)03" 4"H-M F4"H-M 0K  2)H0 H 0S 00 00? 0?Kx03"&4"*4"-00K/#-00K/#-00K/#-00K/ #-00K/#-00K/#-M   0 000 0S 0S000 00 0  00S 0 0 00S0+ 0 K/H-(M00 0K  0K-# 0sg 2Y?2+ 2+ 2+ 2+ 2 2 2 x2 00s&0t P27?0H" " 20," !20" !1|0! !1t0d 00S 0! !1f 0! \!h1^0x! D!P1U 0L! !$1M 00S 0!  0A0  08 00S 0  0,0 t 0# 00S 0| H T00X $ 000K5"P5"#### ####h5"))))H-M +E'㪖5"- M00 X006S SCS IS 0CS00 0K/y*H-M0S| x0i> 0K  2)P0{F 0S , 00U> 0O>K5"5"p~5"5"H-0M0 00 0 0 00 0 0*S00d  0S 0 00C0 00 Ֆ 0S 00K5"6"H-M00 00 00 00 ` $00 0S $ $0S0S 40 K0KKKKK 0 0@K@ ߘ30 =s/KԙI?Ktt I/K0K` ᔕ K?KD 0K4 ቕ S?K $0 0K K0K v00 0Su?K塙0S}?K噙0S?K呙000 0K` T 0S?K.' 0S# 00!.KwK;00c0CK/K ᯗK/Ku?Kᵘ0S h 1O= KVtn t1G= CN!>K00 0S00C0 00 s/K 01  3/ 0l0  3/ 0S ӏ00ᕓ00< 807 0 I 0 ,0K;";"<"H-M 00 0!K|IK00S0/ 0!KQP0403/0  0/K!0 0.050!KQP0-0H0  3/ 0S !K. 0/000S 0.00c L0R K8 0 0/0803/0 0Kp0uH-M  00  0-00S<"4>"H-M 00 00S  0400 0 0 oF 0, 0  0, 0Kh 0奎 0S 0u 0  0, 0,K;"|>"|H-M 00  0S ,!.(0400K;">"H-M 00  0S ,, ,0s40}0K;">"- M  0S0 40?0cd0c 000K/Q-M   0 !0 !0K/0H- M  00 0 $ 0!SR 0!  0#40&0d00d.0@ 0N 000 000  00/40400 0R000 K0;"B>">"H-8M0 4 0 0 50 00 40s0000 00S0\|EK!K"K00.0!K. oEK0 00  000S000S00 0S000S 04 0S00 00 000S0%00 000R 00 00 000dS0010 3/00 00 00 0000S  $ 4}30000S" 000 00 000S00 00,0"K 00/0000#3[3l/x3U3 0S00/ 00"KQP$8#83C30 0/00 00 00 000S00$0S000S000S 000S  0S000S0'000S, 0 0/00 00 "KQP00L00 0 p 3/D00,0 ? 00-00p000S 0010 3/00 180SJ00 !,0K 09,00\/t12,0S7ȭ,80dF 0S +0(000 !0400 0 0$00p00i0S  020010 3/0S K!KP40 ?QP*0ኊ0S 0K蠆;">"?"K0 0 s 00[00K0[2=0"K000S 0[S [42 N0[ 0K 0[SG!>K,D?K0 0SP\"\2.0/K!>K!>KR0K 0 ᓆ?K 60S!1}.0o2[$2[0 S 2[S!1m.0_!1f.0X 0[ S 0[ SL|!d1Y.0K 0[S$X!X1O.0A 0[S8!81E.07 0[S.1;.0- 0[S 01.0# 0[S 0'.0 0[S\ 0.0 0[S4[/0. 0.x0 . 0K?"-0@"AB"B"IB"NB"Q C"WZ,C"]LC"lC"cC"fC"iC"C"D"H-M     30KH-M   40K-00K/#- M 0S000 0 K/#H-0 1S/萷)H-0 2I/萷)- 0K/ - 0K/\-d0063S P006S <006S (006S;;K/y*-006:S 006S0.006<S 006S0"006S 006S0d0063S P006S <006S (006Sx0<K/y*H-M0K ˇ00 00 0 0 0KK  0S 00 c 0-00KXD"D"H-M0K 㤇00 00 b0 0 0K$  0S 00 v 0,00KXD"D"H-M0K }00 F00 30 0 0K  0S 00  0,00KXD"D"H-M0K V00 00 0 0 0K  0S 00  0,00KXD"D"H-M0K 0 0 000 0K  0S 4 00,0 0x,0KXD"D"D"H-M 1070S 0 S S  00  00 0070S 0S S 00 00 U0S0S00 0S00 0 S 00 0 S 00 0Ky*H-M 00 p10S0T 00CS4hhhhhhhhhhhh 00S 0+000  E 00S,0+00  3 00`p p0+00S 000C/D0+@倆00K#)XD"D"x)|)D"D"E"E"H-M00 PF2L C 0S ,,!,1+0Av000 00 0KR 0S  0++00 0 0 00CS4@XXXXXX(XXXXXXL 4XK$E"|)XD"0E"'DE"x)-00K/ጷ)H-M3  0S 00 0?+00 002)h0P3 0S 004D D0(+00 00!+0KXD"]XE")epE"iE"H-M  00 0 0 7 0S00< |0*0 00hd 9g 0S Â00ᅆ00B $0*0KE"E"F"0F"@F"HF"H-M 00 屆 0S 00S 00^00 N 0*00KE"\F"-M   0 00 000 0 00000 0S00 S 0 C0R0 0 000 000 000  0R:0K/#H-M0MßK KK #K00 0 00 00 :K0C0C0 :K0C0C:0 00 :K0C0C*:K0C0CD#< 0S000 00 000 00 S  0R:00 =K0C0C@ ̄00 =K0C0C @0n 0 00 =K0C0C@ 㶄00 =K0C0C @0X 0 00 =K0C0C "0K_0S9=K0C0C0=K0C0C0 1)=K0C0C!KG0S 1K0S 1K0Sp1 K0`!K qL1K <=K0C0CK0A0?=K0C0C K0S,=K0C0C 0K0S! =K0C0C Y0S00K0x K 7d0K T=K0C0CK0000  0R=:0Kd`\XpF"E"F"F"H- 0s)g0E"F"H- 0e)Y0E"F"H-M 㶂0S000K- M 0K/- M 0K/H-8M( , 0 00 00 0 0 00 +00 K( 0 0Kも0S 0K0 0)02,  0K 00 0 000  0K0@ @0) 0R 00R 0KF"E"F"F"H-(M 00 00  0  0S 00u0  0 0(0'0K   0St,t0(00K  0S 00J00 0(0KE"G"$G"yx40  0 $y 00wK)p) L"#H-M20S u0 |2 t20S`20)wL20S @x<20w0 0 20S xx00 W01 01 QP1 1 00c0 11 K 0l1 0\  0R00 )00 <10 ? P10 0 0 0 00 00 0 0S00 0 0  0 0 0 QP:`00S th00S X0 P00SD0@0@ QxK)d)L"#) p))L")L"L"L"H-M Pu 0S4x20K  Ix00 0 00000 0Sڄ00 x0 t0S uT00S D0 <00S00,0, wK M"M"0M"TM")L"L"L"H- M !K00!Kwu 0R0 0K hu0S00KH-0M8 < 8|w( (0St8w8v0T00( 0IuK"KR5 0"K 0!K!K"K!K 0!K(!K0SK!K 0 00b #K(#K0S #K"K#K!K!K R0KP"K 0"K(u"K`@ 0"EKCU 0< 0K\M"H-M ppt 0S 00w0S4Pwv 0SsKxM" M"M"0H- 8M@ D @0S @0< S@0S4D0/ S0480 80S S-S ZS - S Z S  040 000  040 000 040 000 040 000 $040 000  040 @000 5 80K t0S s00vj408#(5!008#(5!80S% S-S ZS Q- S< Z S- LX5  L5 @5p  45  D$5  5 5p  5  74  40S 00$ 04  4  $4  4 4  4  p4  h40S 00H$ 0@4  44  @0S@0< S3 0K s0S r00iv0S1 S-S ZS o- ST Z S? jp3 !d3 !X3  L3 @3p  43  `$3 !3 ! 3  3 2p  2  M2 !2 !2  20S 00" 02  2  4t2$ !h2 !\2  P2 D2  82  !(2 !2 !2  20S 00! 01  1  v1 !1@ !!b1 0K r0S ul1? !`1 !q00DuI0[ 01!0[ 1!1  1  1  10S1  0SA R00S u0 00 S0 0 0"EK#U00 0 S *0 S*0S000 0( 00 K0#M"M")\)`M"N"XN")p)d)N"0H- `M00 00 ?0 S$> >80 d?0S . > 0 q0/= 0 q>0S >0 > ?0 S >  > > > >0S =0 > =0<C4 t> h>0 \>04 = @>0S >0 (> >0<C4  > =08C8 = =0 80 =0<C4 80 =08C8 80 =0C< 80 |=0SE800| :qX=, 0"( \=0 SX0<0 -08=0 S;<0 ;1S t; !,;Z i? q<0 <] <0C4 <^ ,T;> = pl,8;X<(+ <0S8<0 ,<0  t;0S $<0 S 00+0 ;0 Sx;0Sʘ `;08#(; \;0S8;0d dt ;0 l; `;0S t;0 S(:0 8; :08#86K90#88S &[:!: U"[E;0 ? 000 :0S%90":00  c:00c@0 90S 9040 40 <: 040 90S: 0@ t90S9 0s@0@P:0 0P 0 0t9 00)  9 0000 ?V 00(0 ( 00000 D90W0D0 80D @  c8 0b0(0 80D  700 0S>0 D80S>0d(D 0s0 C(0R*0(0 70S(s@0@PP80 07 0( h7000 ? 00,0 ,000 700H0 70H @  cP7 00,0 l70H 0 0 6R 6 0 60S50,H  0`0 (=0R 8=00R L=00a `=00A `0|- 0 C`0 `0 =0?0- =0k0 = =0S = =0 l K0H-pMX>0 SL>$0@>10 0!K>0 !Kmk!KQP: j00 mX>0S H>0m8> 8>0S (>0m> >0S =0m= =0S =0wm= < K=0l= =0s00 S<0 0 T=P= 0 k 0R; i00 ,m=0S <0Dm< <0S <09m< <0S <0.m< <0S |<0#ml< L<0k<< 0<0s000 ;0 R 0"K;0 "Kj"KQP: Yi00L ,m;0S ;0l; ;0S ;0lp; \;0S L;0l<; 4;0S $;0l; :0qk: :0sL<00 : 00< -k 00R; i00t t,*lx:0S h:0lX: X:0S H:0l8: $:0S :0l: 90S 90l9 x S90#k9 90s90 SG 93)  ?#K\90 #Kj#KQP: h00l90S 90Il8 80S 80>l8 80S 803l8 80S 80(l8 `80jP8 D80s<@0 (8(8 @0 j @0R; eh00'7l70S 70k7 70S 70k7 70S x70kh7 `70S P70k@7  70|j7 70sW60S 60t&  ?$K60 $Kwi$KQP: h00k60S p60k`6 `60S P60k@6 ,60S 60k 6 60S 50k5 U50%j5 50sk4 40S 403k4 d40i|4 p40s40#  ?%K<40 %Kh%KQP: lg00?k30S 30k3 30S 30j3 30S 30j3 30S p30j`3 @30i03 $30s_00 20`0 23 `0 :i `0R; g00"j20S 20j2 20S |20jl2 X20S H20j82 020S 20j2 `100i1 10s 00C 0 L10d0 11 d0 h d0R; f00TTX"$Y"M\Y"|)Y"[Y"Y"k(Z"t#)xX"^"HZ"#)))) 00C 0 0H  B/ bF b 0S|000 00 Rڐ00h0 00 h0 Zh h0R; 9f00  j00S 00i0 00S 10i1 (10S 810iH1 P10S `10ip1 10Ph1 10s+10S 10i1 10S 10i2 20S 20}i,2 420S D20riT2 KH-BtZ"-K/0H- M  00 00 0 0 0+K0S 00S 0 > >0/zf$ $0S $0 > g> > *(0A0C5S$BJCJJ DJJEJJJJJJJJHIJJJJJJJJJJJJJJCxCJJCJDEJJdEtEHJJJ4HHJJ|J=0S000 |= t= @0K {f X= @00S@=0S0=0S=0  ie= 0 0 < @0K Vf < @00S<0Sڨ<0Sڈ<0 h@h< @0K 8f `< @00S H<0 S 8<0S (<0 S <0 h< ~; @0K f ; @00S;0S;0 hed; ``; @0K e0 4; @00S T hML;00 H;0(5h0S :0 e 0S:0}g:00 0S 00 00 0,0 ,0H0S ,0 ,00R*,00, 0,%f0,~f000 000S9@GG\G\G\G\G\G\G\G\GFF\G\GG0S 0  ) 00 0  ) $0  ) 000 00S  9R0  h) 0  0 D)000 00s  9R0  ( 8R8 !00s h80 R e\80 7g@8 @0K .e t8 @00S\80SL80 S7 @0K e 8 @00S70S70Sgfx7 @0K d 7 @00S70S 70S |70S l70S \70S L70 S <70@S ,70S 656 @0K d 6 @00S60 S 60 S 60 S 60 S 60 S 60 S |60 S l6 `60 T6 @&f( (0s,6 0R601 0 6 0S 5 0KK0S 0N0 C50R(5001 0 @0K d 0x 0S-d5+KQP' P50L @c85+K( $ f0 C40R  0S +K 4@0 40 c1@00S 4001 00f"40S 0S t` 0S<40M,40`f <4 440Sub00fE03 U"[E T0#K00K30#?f 3 30S b00f$0x30 #Kd#KQP b00XnfP,30d03 0K d0S b00Vf20d020  0c 0 ib00g"Bg"Fg"H-8M $ ( 0K ] 0D0 $0R*$0 0D00 0 + 1=0t(  0030C>0>0R : 00 30C>0>0(0 - 00 30C>0>0( S  00 30C>0>0(0 (  0D00R(0 0D00 0 5 00/0K$  0/0S0$ 0$01 0 0 K(0"0>00 00 0KK * 00S 0 K 0K  00KHh"h"h"H-M   0 0S001 0 0 K 0}0SF HQ D10J4]0S001 0 0 K 0_0S( W 00,]0S00!01 0 0 K 0=0S H\ P0`0 00 0"0 0#.0 0KHh"4i"Ti"\i"di"H- M 0 0K00 0[S50 K&0KK 0Su 1/0a0 K 0K 0v0SPz P10L K 0 K00 0KP<00! 0 K&0KK 0S 00'0!K P0K 0<0Sh h00 K 0 K00 0! 0KP0KHh"i"i"H-M  00 0K V\0K| 0 0S\ X000S0 000 0D0 0R0KTi"Hh"i"H-0M( 00 00 00 0 0 0K \$0K \(00SYl h1s( 0%(0 $ 0K@ (0 $0K( (0 0S0S 0S03 $0R 00 0F0 0 0S (0$0S(0 $ (0% 0(%000 (0D0 0R 0S D0@00 00 0KHh"i"Ti"\i"i"i"j" j"(j"H-0M0 00 0 0 00 0K [(0K [000S0d 0S 0K 00, (0K 00% 0S0S"20 00030C 00030C0"0S0000 ( 00030C 00030C0"0S0000 0S 0S " 200D000 T0S !100 0e0S0S !100D000 50S Ll!\1y00 0F0S 0S  .,1i00D000 0S  0Z00 0'0S 0S 00  0G000S 00 H| |08000  \ \0.0KTi"\i"Hh"i"Lj"pj"j"j"")j"/@k"Jpk"H-M  0K Z 0K 0E 0030C>0>0R000KH-M  0K Z0K 0$00 00 30C>0>0 0R\\ \0000 30C>0>0 0R00KHh"ck"H- M $ 0!K0 0 NK0K EZ00 /D!KP$0 0QP!1090K  00S 00)0S 0S 0 $ 00 0 000 0D0 0R 0 0 0QP4H H0b0 0 0 %0KHh"vk"Ti"zi"k"- M  0#`p0 0 R0@P0@0 0 0K/H-M 00 0 0 0K Y 0%0 0 70K 0S0S 0 0. 0030C>0>0R0S   0S000 0S00% 0% 00 0 0D0 0R0KTi"Hh"i"H-0M0 4 00 (0K 0 0 0 0 0 0 000 0 00( K V 00( K  V 00( K  V00 04  00(K0 V000 0 S0KH-,M( 00 00 00 00 (MW0 0SD 2k0(00/S(0@(@(4W00C( 00/S(+W00C(&W00C TVW0 0 00  000/S000 000  000S00 0ST 1!0^00 R 000/S  000 SC01 @000001 00S00] 00401 00 U00 @00 0V0 iW00 0V0 0 00 000 000  000Sn 0Kl"\l"ll"-M   00 00 =0S 0 00`S&0 00zS 0 0   0 00@S0 00ZS 0 0   0 00 S0 0 000  0RK/H-M  0K 0 0 000 0 K W00 K W0 0SD괄\00K n0K i!0K c0K ^0K X0K S 0K M0K H0K0S  K0K8X0KU0 K @W0Kl"H-M 00 01 00000 01 00S0S yKH-8MK8 00 0 0 ,0K YWC0S(!0[S ,0[@0S ,0[ 80 80 000100C 0S 008 000000 80 0 c00010 0, K80 0R02#K 0,K 0?0S 80  800 80 0Kl"\l"l"H-@M8 < $K00 0!K40[S K!K 0 <0 !K 0!KK!K 04K 00S 0KH-M K 0 00 00 Kd0 V<0K V40[S40[S 40K T0S 40K| T0S000 40K V|40[@0SQ )0[SN02*K 0<@T0 T0S$8 000C2 0 8 000C2*K 04K 004 K 0 S<0#W0F<0W0<0 80 00 40K ;V&4 K0K-kT0 K AT0S04 K 0 S02 0 0000 40K V02*K 04K 0>0SR 0Kl"l"H-8MK8 00 0 0 80S07$,0[S1,0[S ,0K S0S 028 0, K 0 @S 00 0 ,0K U000 002#K 0,K 00S 0Kl"0H- `MX \ ` d0 00 00 0 0 0!K0$0 \{( JP0K( UX0!K 0(PK 00S# 000 d0S01( 00S% 3[ 3[80 0 00C@PX0@0 0!K!K01( 000"2(0x01( 00Sd0S S*:S5 fX0!K 0`PK 0p0S`00d.h1O`00DP!P1X0!K 0X`' >` U`0P K 0 {R1P0K0[/0jX0@0$ $0S 0\0X0!K 0$  X0!K 0@ 0  $0$(S0 K0l"Wl"l"bm"8m"o\l"H-BM  ! 00 0S c/10;0K 0S 00 0 0* K(0K 0 0S 00x 0000K K(0K 0 0S000 00o0Kl"Xm"hm"m"m"H-M  00 ~0S 00#0Kb 0S 00lt t0@00K 0 0S00, ,0,0Kl"Xm"hm"m"H-8MK8 0 0 00 ,0[S ,0[S02#K 0 80 0000 02#K 0,K 080S 0KH-@M8 $K00 0 0 A1[ 2[80 0 8  0S-040K800 0 04K 0 0S800 30C>0>08   0 080% 08%X` `0080$K 04K 00S0Kl"m"0n"H-DM@ $K00 00 00 80K S80[S 0 S-0[S -0[S -0[ S 000 000 80KK 0S 壴@場0-00 G 0< <0ϳ0S (( (000K蚙?l"pn"H-XM` 00 00 0 0 @0K 3S @0[S50[S000 `002 ? 0@K 0P0S 20` 0 050K040K0$0 !@0K 0"( `0$0`0 `0$ `0$0 0 08#82K 0#88#82K`0"@K  0S<0>0`  0S 0(0.`0% R0`%0\K `0b 00C@P`0@0 0 0\K 0T0S 4 400Kn"n"l"6n":n"n"Co"H-@M8 $K00 0!K0S0640K sR"40[S 40K jRK!K 04K 0!K 0!K0 0KP0S000 K!K 04K 0}0S 0K0H- `MP %K 0!K00 00 0 0 @0K +RH0K &R@0[SP0%K02 ?@PP0@ 0=0b200P 0000 50[ 0S6 @0[S3 P00 P0 $ P0@0ׯ0S P0 $0 0 0P*P0J$ P0@0ᘯ00P @  0 0P*50[0S P00 P0 02 P0@0R9:50S5 500C@PP0@0 0%K%K00 40P 0S 0s$4|4  h4 P0 P0@0 0 0P*50[S @0[S50[0S @0K O0S @0K O0S P00 P0 P0 P0@0 0 0P*50[0S P00 P0 2[ 2[80 0 00C@PP0@0 00 P0 3 0P0S1P0%K00C2 ? 0!K@0K0 00!K "20@0K@0KK !K R0!K@0KK H50[S0@0K@0KK fH0K8 P00S"2Y0uH0S(@0K0!1MP00 P0 P00 30C>0>0P  0S`!130OP0% R0P%H P0D00RH P0 0R :H 0 0 H0 0!110 1 102S 00 P^P0%K02 ? 0@K 00Sc x00S h00 C\0 P00 K0)l"$o"l"l")Po"o"o"o"n"o")p"H-M   00 0 0  0 000 U0S000 0S0* 00 0   0R 0 0030C>0>0 300 ? P0% 000 0$ 0K0H- PMH %K00 00 00 00 <0K PD0K P<0[S000 10[ 0S, <0[S) 2[ 2[800 H0@0ȭ0S H0@0ᕭ00  H0@0ጭ000 H0D 0R:H `02 H0@0R4:(30S0 /3300C@PH0@0 0%K%K00 20H  0S 0s"2t2 x `2 t10[S <0[Sm10[0Si <0K4 M0Sa <0K M0SY 2[ 2[800 H0D 0R:H 00C@PH0@0 0 D0K H00SHd!d10ID H0D00RD H0 0R :D 0 0 D0 0!110 0 002S 0~0 HH0%K02 ? 0@)q"q"p@-@[K0ZS'0SP 5. F0P0P03/xMp`h`'NwJ#:'-<6@U 0S 3/BMp)$#)q"@ȠA-\HMpP`$H! \ \TC T5 T K0ZS@DTD,t0ZS7 @ЍT0ZSTF `J0ZSq T񟗮T<$l llܲIJ|30ZS  5@Ѝ30ZS  5@Ѝ TC T0 0 CRS @ 0=@*@ 9@LЍ #@ @ @ v@ h@*@~L@z :@ x?@ a"@ !@ D"@ "@ e<@ L<@ /<@ U<@ @ `8J0ZS@D TꄴllT<$ ܳij bC@| VB@v E@p WE@j E@dd )B@^d A@X B@R A@Ls)@ 0/<@))/)8@-PQ@ h KTK 0  @  $  (  ,  0  4   8   < @$ D ( H  , L  0 P  4 T  8 X  < \  @ ` D d H h L l P p T t X x \ | `  d008@)0O-,$M\p`0000- \00\0\ 1?A1c10B\0qHX00CX0J0P0 Sx 3/` p1/ P40P0S 3/`)#'gfff ),r"4r"@-@xII)@- @sJP K)@r"C-pX@ QP 0#211AS% `0 `0 Y#$ @3G \0  FC1a10B0GX0F0X0QJJ))gfffPr"@-4AP0pS8 W6 aGDG 0Rh0 00(0S 3/00J00%J^ڸ0 P CQP0CQQC p0JP @FDGI4I0JF)$#'$#dr"H)e)d)pr"O-R0 DMR@0000 0$0 TrTbT 4/P JP XJFT 4/P iGPf 0$SS! 0KS40IDЍ(1# 9/P 40S $0S 0 , ( (07HP ((<#0(@8 $S0<S0>S000C S 0 B R\0cQLP:S 02 00FS)x)A-`@pE(PUaa, PG`(P@h><\"\h68b0RV4”,"SX``hPl\d T ,Ġ!T0 1|B 1;븡1Q01< 10 17>>P|0 P3P10P1P1P1ڟWBT1 듡000(Qp<?08S#8?.0! Q /): !S1!1 PS1R!Q$0R0!1Ѝp ! RЍp1h))Q4@u"@-T@M ,@ < >40  0L($1 0(DЍ[ \3:h))w"0P  >h)w" 0P /h)@0PZ $ /P $ /P P8/ /h)0-00 QR+0  R   RZ $  R $  R R 8(   0 00/P @ 08(P@ 00/ h)G- L M0p`P V  :U 0 <(0Q;  R<( Pq2/$0[ZS @8S 0 R 2/ 0R S R 2/0S 0S  3/0@8WT P03/0PU0@0L0H0D0C000:;40j (1S 9-: x:R  Q@ L H D C *+4  03/T(ʟ0S * hPU  0 P 5/0 D8 2(211l1p12/ Ѝ0YS 0S H80 Qr0R 3/0S 0 0Q\0S 3/PD VL!!R7ЍT] TI 0\0 3/P0l\03/P0T\03/PA,9L 0E8 0 L 7A L'9L+8010\0 3/P 9L 7( (0}Ϡ  0  }0  0 wꄷ#Xz")z".pPF'lz"z"z"z"z"z"d C-T0dpXh`\lPrp $M p `P @6$ЍC6)z"O-\$bM M LDt8H$b΍0 H0007P 0"P0L0 51SqZ_1ß0S1H5PAL`5!L73UL50 4$b`3Rv Qs w vÕ3T v T0 )S0Yr0a6T0Y 0T08T0 t0ST0" u0ST0" qt0ST20Su0Sf `1S 3/bލ Ѝ^ T2T"b΍0 Ch FhYHJ`FPV 00S0 [ 0 B CQQS` V p\101l8bލ Ѝ  qZY s  R s w0!S00v0…w0•bލ Ѝ0j,117F`1S 3/l0P0Yl05T0Y9T0%8X1S 67`l6  0v.0 7Y5T0Y@0T08\1Si 3/f)"({"D{"0|/)0/)0/)Q@0 #$" P4"8#8 //4x"O-܀`@Ę M4P 784S$ R ڸt RW@gO@ k/ P@ {4@TP 0 p$8 Ѝ Ѝ)\{"l{"0/)O-ĉ0DM$0p 3/ P) Q4IiP" J44|Y4!S P \ 8 0< P  4S -<$44040T 04P80@10C80) 8PP0 00 删7 10 $ ( 0 PPP,P0P4P8P5%0,P8P4PPP 00 82 4 P40140uĴ4 [3 PG 4HQ S$. 760 'H03/$60060H0& 3/4 04 5505I 5505C\h6\y60P&H03/$@6 =ZϠ w P 504g  0P 6045T0'T 50Su0S z0r0T0YQ. T00+T @ R y\5:Iq000q0"! 0C r0z Rs 00r0U0U56 PPUUĕ05T0  3t0S0Ct0u0S0Cu0T0  `0SLT0  x000Sx0*T09T06 3T00T06233@0 10C80!0PPPP0 00 50 S0SCP 0U004 * 0 q 0CS`0T x09T0T0:T0Ÿ{P `NR5=:l3T0@0T0T0B=T0T0MP 5̐ "3PPu 5Ÿ L u20ؐ*0! !5820D0S $3/p 0ȴд464 L ^*+3| T0 0| T0~5{53| T0 0l| T0q5000 dP0 S CP)  # 10SS B\R 0S0SPA5UMU0 PP BR \\P$#|{")I)##{"h){"t"x)"\){"{"P/ 0Q5 5005 5/)@-p0`$03/P) P@P# 1Y2T0Y  T0:T04X1S N5x xxJ5h0T 0 h0X1p3/0p0Y40 03/ $#|")|"a|"4z"$|"C-`R Mf/4Y1_1 +1PHv 40 S2 բ ոPE P__2APLZ -> 08 <0A 1P`N p1h!/2b1 `c0i/ X`p\`q`r`u`Ttzy0{0 1Pp 3> ЍY1YTpJ4$1LP ,1Lp@P z4000l@P r400hs2Lf/3Y1YT`%40LP 1L`)#Q<|")8@-|@PY1YTP40LP 0LP@PP ?4000 @P 7400 i48)@|"QP@-00M@ R 00! P00ЍQP@-  M@ 00!0P00Ѝ8@-0@SPH408xC4 !R  010U : T8 08$0!8(40x|"T|")l|"@-H@T0 Y61T 0 T T Y)T t03)@-4@T0 Y 1T0Y0T0v3)@-@PT0`p$ Y 1cU \00\0T0; ː5 _r(- Wj0# M`8 8  +( 0 0 8/P40 (088D/)/8 880࣐ ,P@# .( d dD@尵IH@S~ 0FA4B (0t/0d `/TX X/^/`4@/4$4 /` xy*7}"`}"}"mu"}"[A-M`V. --PN-@P" p00S" X \ 0t Pp \ p@ T 80Hp`ph d0bP` pPD\ P,$P P0 00 (P0@ < $ 00@< 00($ [F  0σ000000 00R:[:0 K { $08<@0 0 S$0<@0 X04x HD`0 SDh PZ\ (T H0S 0σ000000 00R:[:0 0σ00>0#>0 00R:[:0`h d0l\.,0,80 0@0 0 0Lq-PЍ`h d0l,0,` %.XXX ЍO.( T0H` h0dl( T0` h0dlxy*T~"h~"u"|}"O-QPM,R,P 0 8+4#R 0<+, 0H+%L0!  t4 000[XYPP*pP D 6-P 0+P 0$PL @(@*`P  ,$\/ L P04(\ [ [4 i( @1U @0#,R㤰! P㤰(( X@:0$08#8[002@ R @ a#,RP0, PPP R P t0W,0,(4#<(0tx_)t) P[0  t0,,0,(4#<(0xt8)t)0|,,Ѝd0-XA,+D*@,T L@T 0R0S  R S 0S,Ѝ -($P 0XH` ,0S,*,*(0 ͠Z ,($T\L` 0$,T!BM #)xy*~"~"~"~"0@-DAPM)U0,S;,Ѝ00S Q @ET 0P @T 0P0S  R@Q PX(0  P P+0S 0SDQ \T$ ,0 +xy*0@-APM)U0,S+Ѝ00S Q @ETT^,@T 0P0 S  RHQ= PX (0P  Pd+P0S 0SLQ" \T$ ,0 M+P $T \0,\, X0P (4+0 , ,0xy*8"~" "p@-$AP`)@T&@T# 0UV``3 0S 3/PP0S  Rʠ   S 0Sʠ0 000PP`H+p0S  oQ  f0`P xy*QP@-@@ @0@-APM(U0,S+Ѝ00S Q @ETT+@T 0P0 S  RHQ= PX (0P  P*P0S 0SLQ" \T$ ,0 |*P $T \0,\4+ X0P (4*+0 >+;+0xy*8"~" "RQp@-00P, R)  [@P `008(0S0S T  <*4*pd 000  pxy*X"PR@-@@ @//0@-DAPM(U0,ST*Ѝ00S Q @ET 0P @T 0P0S  R@Q PX(0  P P)0S 0SDQ \T$ ,0 )xy*p@-`'@T"@0PS0  R@P 4*0S 0SDP **0S   R00 *U40P00 0 *@4@)Z) ]*pxy*|"O-q0$M$0`3/ 0'AP4Q &&?&PP\ l*PQH)PPPh7*d0 4 @0000PPP VP,P6'0S0S U  )P0,cS00E&P0 03/$Ѝt)ppp )4P )040P)H)@)$#"xy*'""))"u"}" """@-@)&@T$"Q8@-8T0$@T H'PP *0'JP@'888xy*T!8@-`P@< ~(T$@ @@'PP *0r'j'%8xy*"T!Q/Rp@-00P5@R$@( )  @P `00&0S0S T  \(TD)pd 000  p N)p459l/xy*X"l|"/// @-P@ '0 0P@-@ P '0 0P (00000'O-ԲOM $ 0(,048<$  2/P 0S P@ Ph ('PdT  D'D0@ L0DP & 0 2P 5Sd0 0d0l0\ 0l000Oߍ, 0P0Sp $ -3/$j)@@#D"8"0@-S@ P O$%P  00G(P"0-lPlH$I4IHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHdIIIIHJ,J`JJP.@ 0P@ 000/@+!0 @000 0/@+0 ( 000P3@*0  P@00 0/P3@&003P#@ 00P@ P.@P@ < P+@ 0@(@ 00P"@( O-tM`@3Z  R 0[ B@0D0H0L0P0T0X0\0`0d0h0l0 0PRfNLNOO ONN <0000 4 V @p4p*兰0$ 0H0\l PP`hDLpTXd&@ %PP 8< "'pP8< ,&80?0 <0#8< 8p"@ \P, 0S2"/")|)@ )G-@(M p`P  P@ OP〠 0@ `$P o P@d ?"(Ѝ@  n0 P @ P6 d P . ^ P ( X PPC  QPV@@fxD" ! 0. P1 0W004 0:P  @ P U@~7/P  0&P 7/P  0@ U @- @@   XX 0PD @Tx4"x!,"4"8"@"( `"@H"O-頢MS0@ 0S& 0S p2\ @  B0 SЍЍP !00BP !00ЍܑU00C1 0$  T ȁ? 1R0 WpTN0P0X"0PUCτE嬁Hਁ  ρ ` ˁ7K` (,*` ᷁ሁ 묂 ᫁0`{럂0唠!Q<C!,JXP!_)#7A>l"x"p@- M! 1 0 \0S` 3/ P8 P5  0@ZS0 P00 CPP P$P(P,P0P4P8P $P V d\  0P~ P P0lG@=U?%@@@@_@@o_?/n?Mb-PM P0!80<0 4Ѝ$0 0" ")G"8@-(% $: @@#T""u"@-CBMM|;TZSPs Z0;DY`PBލЍ+  #Pbڄs##0 xx##0  h 0 \.-D@0 --DH 0 8 0 {  0 $sP PE  0gP P4 MU 0S 3/wP 00@P& "0|tl hBލЍ$*8TP 00 n2 i2@P@P 7P000P00/PX*P |$P( htP# TdPDP ,@P0 P P P P P tPs `Pn LP j%*|"*"$*"H*"""̉"ԉ"h"**"؊""T!*0""|#" """l*("<"D"X"""x"""Ċ"p""8@-\@(0S8PLLPP808 ((( 8@*@"P"T!0"!@-$010`0S x3/P`hPDXP> 8H}P 8xP,,sP: nP  iPdP) _P ZPUP PPhKP PF0PX|>Pp`d`$*"*|#Ќ"Ȍ"،"""H*"<""""("0"<"""<"ċ"l"@-p3p@-P@0`T\ 0P @1S d3/pdr00PPH1S 3/ OV, LY  9/P  D1S d3/  d"s0QD 0d2p Q! p <y**"""8@-J<@_-.B8*"@-4`p`q"RV P@P1S@ 3/"TP **@-P@`P:T5ȣ8P@r @1@Sr e3/PeR00P <1S \"e"3/P H1S e3/`*p@-@P@Pb @10PSb d3/@dB00p*@-@P <1S "d"3/*/@-@P H1S  d3/*/@-@@P8 0@ F3 *8""u"0 /*0/*A-B2`\P0sq01S/ /SX3SZ S< q H0SHVA D @0xS<%  B cUPT `PA6 04/P3@!T"p `P 0@P \ p` P 3/0@UdPxPIPPEPPEqY  iyjP i j kU ipijpiijP(PLPPx R *BQRp@-@  / 0S,0PZ00 `s0P $\ Z R 0V0ڢɐ0000 0 p   R0 `0 P @0U k 0k 0d'e#f@TP0 0pW0 0 0 0$Ѝ/ U p0#2"S   QB/b @/B/0C#("( )p0!'"(#230c0C @/C-p M`PV@ X Q p 2/T Ѝ f`P ,-0` x`*4l"C-p M`PV@ X Q p 2/T Ѝ 8`P ,-0` J`*l"G-@Pp 0b 0)b @ 0:ac( (R xxg`00X`XcIe4$IG T @0R@h?@?xG-`@0PG VT8a@Pa 0b 0(0 00 @P@ a 0a 1`6c P$@(TP, P 00xxrpnxxO-PP,M 0 0\0@` $`||f?d@0 p @ 0g@0d\\)(@ 0QR1030# \0000S@ @0ㄠP0: \ @ p 0@00p0 p T\p  X* @T Pa D5Da@5 V`b0,媠 S( * ᣗቐ ჈ᨈah!0Q Z 0b 7C@'x0 @7C@00dp @W"@h0 Q\1 3 # W    R 0㈐  R0: W @@0ቐ0Pp  P@ h\\\( @ @000RX13#0 \00S @0ᄀT0\ @00@刀0 @l @P @w` @0QV1030#@ P0000S 0`p @ V@0W 0p0 ,ЍP P P , @`@VR13#@ PQm `p@V@0W0   `\",`@ 0TQ1030# \0000SB p0㇀ ` R`0:\ 000ሀ0,Ѝ@@0S \7@T@d($ ,Ѝ@0SY00[}0 S0@0Sn?@?@-@P(,@H-M  \ 0 0 0 000 0Y0S > 0}0Ky*"""H-M  00 0S 0SeK- M 00S' S S SS S ( S S #9S 9SS 'S @S S d0`0\0X0T0 P0 L0H0D0@0<080K/ᬐ"""Đ"̐"Ԑ"ܐ""""""- M 0< S  S 000K/"""H-M 0$0S 0$00 $ 00S 0000S 0 0S 0 0KH-M  00 UK- M 00K/- M 0 0K/- M 00K/- M 0,0K/- M 000K/- M 00K/- M  0 0R0 01000K/- M  0 0R0 01000K/- M 0S 0 00K/- M 0$0K/- M 0S 0$0S 0$000K/H-4M( , 0 (00 (0 0 h30@T300@<300@$3 00@{0 00 00 ,00S 00 0R*,00S ,0020 ,0 00  ,0 |20(0 0 0SHH D2 0R0$ 2(0,0S! ,0 00 c1 (0,0r 0S 1  000  0R 1t100$0 ,0 0L1 $00 9 $000  0R 1,0 0(0 00 i 000  0R 0o0 00$0 ,0 0l0 $00  $000  0R<0 ,0P 00 ,00K(#p"x""""H-M00 00KH-M 000 0 0 0 0  00 0S0  'KH-M  00 0r0S0SK- M 00K/-M 0 00 0S 0 000K/H-M  \U0 0 0 000 00S > 00Ky*"đ""H-M  00 0S 0S 00S 003/0 0SKH-M400 W0 $ 0KH-M 000S 000k0 0 KH-M KH-M   K- M 00K/- M 0,0K/- M 00K/- M 00K/- M 0 0K/- M 00K/- M  0  K/- M  0 , K/-M   0  0  K/H-M 0S@0 0S V00Ss 0L 4 003/0  0 0 $ 00S 0 0S 0 `0R 00 0 0D  03/0 00 Kԑ""""dH-M   0 0  0  0  K- M  0  K/- M 00K/H-M  0 0 0 0 0 0 0 0 000 0 0 0SPP L0f0 0 00 0  0K""Ē"d- M 000K/H-M  000S 000#0 0 0S 000K- M 000S 00000K/I-DMP T 0T00$0 $0A(0 0 0q~a0 0Q^A0011M00,0 ,0T0 0 P00S , $0PH"T0 , $0P"T0 $0R 1, $00 10S 1 P0P,!,00 00S0040 t10S h1P,@400XL!040CD1H0 P00D0 P008#84KP008#83KP00<0 H0K 000S P0 P00 00 P00R 0080 x00S l0P,@800dP 008000РK"$"4""Ԓ",*#<""`"d"zimg"H-y*H- *`H-M  \0 0 0 000 00S > 00Ky*"""H-M   000 00 0 0 00R:0 000001 0 0 010  0 010  KH-M  00 0S 0SKH-M  0 0 0 0 0 00S 000S 00S 10 g00S0 0  0$0S 0$0^0S h\ X10$000$0  0$0N0 $ 00 0 0023S000 0S0S0 0S 0a0 0m0 0  00 001 000 00 0 0 0 0  00 0SvK"$""8"<"H-M  00S 0 00T 0 0 0 0  0KH-M  0000 0S 00S 0S 0t0 0t 0 0 0x0 0x 0000 0 0 0S 0S 0|0 0| 0000 0S 00 0 000S 0000 0 0 KH-M   00 00 #0R000 0S0 0 0 0! 00 0 0S 0 " 10 " 00C0 0S 0S- 0 000 0 0 0! 00S 1n0 0! 00 C000 40 0 00 0 0  0 0 0  0 , 0 0( 0$0S  090S00C 0 0 0R$* 0 0S 0 04  0 0^0 0  0 0S 0 0! 0 0  0 0 0KH"$""`"H-M  0`00 900 00R00 00R00 0 00 l0S 0( 00(00cS00 0 0 00 000  00 00 00S00KH- M $ 0\0Sd $ 0S"$0 $000   0 $0 $00 3$0(0}.C0( 0 , 0` 0 0 ` $0( 0(00c 0 $0( 0( 0R0000 0R0000 0,00?00 0S0S 0S 0 , 0S0S 0,0 0, 0, $0, $0 , KH-M  0000 0,0S0 0S0 0 0  0 0 0 0 0  0,0S00 0 0 0S0  #KH-M 001# 0S!10 00 A 0 0 0 80 0c 0 0 00 *0 0 0 00  000c 0 00 00c 0 0(01 0$000 0$0S 00 0c0 0 00 0 0 0  00S0000  0 0S000 0,000 000 bKl"$"j8"0H- 0M8 8d 8k 0S 0@S`}8%$ 8,( 00 00 0d00S% 000,0 0(0@0$0P0 ,0 0000 00S 000 0,00 0,00 000 00000 %0 0R0 (0R0 0$( 0S000 00 0d00S  ! 0 00 0S(00  7 0 (00$ 0d00S   K0H-MF00 0S00 0 00 0 00S 00S|00000L" 0 0 h 0 l  00KH-M <10S01 0p0  ! 10S 1 0t0x 00S 0 0|0 00Sڈ0 00x 00 X00S L00 "! D0 0000 0SK,*#t"D""Г"","H-M 000S 0000S 0000000 0 00S 00K0 00S 00{0  00 0 0! 00 0  0 00 0 0 0S000 0S00S 00!0  K-M   000 0  0  0K/H-M   0 0S00  007 0S020S  0R0,C0 0#0S000C0 0S 0d 030 0d 0S0d 03 0d 00KH-M  0`0S 0`00 ` 0S000 0\ K- M 000K/H-M 000 RPKH-`MX \ P0KP0/L0 ?0c0000 X0 X00X!\0 8R \0 8R 0)X0\  X\ X0000 0S X00 X0000 X0p0 X0p \0 0 \0000 \0040 \0 080 X00<0 X0l0@0 @0S80 0 00 00 X0 40 C@0R0000  400R4000  000 00  0 0 X0 , <<70S 070   '0X0 $ X0$ X0 X0 ( 00A0K000 00 0 A0[< 00R:00  008  0R ttt&t6X*00C0  @000 @00 0C 0 0 X0 ,  40R:P50S 50   %0X0 $ X0$ X0 0 X0( 00B0K00C0 00C 0 B0[<0S00  008  0R ,,+.,5:X000  @000 @00 0 0 0 X0 ,  40R[:X0  X0h0@0 @0S800 0 0 0$0 00 C@0)R000(0 ( 000R000(0 (00 0 (0 00 X0 , 30S 30$    # 0LX0 $ X0$ X0 X0 ( 00C0K$00$0  0000 C0[<2$ 40R:00$  008  0R ,,<#,3XX @00 0 $00C$0 @ 000c 00 X0 , 00R:Q20S ڠ20$    " 0X0 $ X0$ X0 4 X0( 00D0K$00C$0 000c 00 D0[<$0S00$  008  0R !1gX @00 0 $00$0 @ 000 00 X0 , 00RZ:X0 X0  X00X\ ^00S3 X0\0S/@0S X0l0S(00,0 H00SH00SH000SH0 ,0 00 C0 H0 XHHH0 0,0 ,00H0 H0S00S X00S X00X  \3/00KCY800GREY,*#T"P"p"$"`"""Ȕ"H-M 0#00 0  0   0KH-M KH-M 00( 0 0 00S 00,0K- M 0,0K/-M   0( 00c00C0 00c0 0S 0230S000c 3K/- M 00S000K/H-M 0 00 0 0R*0,0S00)00"0(00c 0 0 0 0,0FP00 010  0R  00c0 0 0R*00 0 00KH-M  00S00 $ 0$ 0( 0(0S0$ 0( 0$ 0(0 c0, 0$ 0( 00S 0 0,000KH-M 00S0000200 0$ 0R00S000c 0 $ 00 c0 00 , 0  00S 0000KH-M 00  0R 00 00S00( 0 0 00S 0020KO- M8 < 800`0F08 0! 0PpV <00e 010!02p08 0! 0p80<  80 80 80 80 80 80 80 Pp0F08 0! 00F08 0! 0@hj/$/B?)?CR ?  0?00"0S @0?0e00p0?0h00 P0(0 W WU_U]8 ?$?CRV800Sڤ?0T000)0K)0[S 8( )0[S800/#/B?$?CR880@?$?C 010b00"80 80 800R*80 80 0e00 80 $ 00S80$0 80$ W 80$@200N0 c80$ 80$ 2 80$ 0 80 (0 KpH-M $ ( ,0 000C0  0! 0` 000C0  0! 0@ 000C0  0! 0P$0S 00 C$0 (0S 0$ (0 ,0S 0( ,0 0S 0@0S  e0 0S 0?0d00 0 00 0S 0 0 Kp- M 0  0 0 0  0 0 0 , K/H-M 0 ( 0( 0$ 0$ 0 K- M  000 000 0;>>00  K/- M  000 000 0;>>00  K/- M  000 000 0<000  K/- M 0 K/- M 0000K/H-MG<00 0 L 0L0 0 0T 0 0 0 0 0 0 0 0 0 0 0 0 0 !0KH-M 0T0S 0T0KH-M L 0`0500D00W00j0<}KH-M 00@ 0 H 0 0`00000100D0<WKH-M Y0K- M 0T0K/- M 0P0K/-M  0\00 0 \ 0K/- M  0 X K/- M 0X0K/- M 0D0K/H-M  00 0! 0  0 D 0D00 00S   0S 0 D 000S  0S0 D 000S  0S0 D 000S  0S0 D 010S  0S0 D 000 0 0D0S 0\0S 0\03/0H0S 0D0S0 H 0D0K-M   0 00 0 S S S# SS : S S 5'S' 'SS S ,@S& S '000 %000 !000 000 000 000 000 000 000 0F?0 0D0S 0S0<0S 0 030 0 0S0 03 0 0!00 0000 0000 0000 0000 0000000 0 0K/-M   0 0'S S S 0 0C2 0! 0  0 0C8 0! 0  0 0C< 0! 0  00K/H-M   0 0S8  0 0  0  0  0 0 0' 0 09 0@ 000S  00 0S 0!S  0q00KH-$M $ $ 000 00 (10S  10R10S 00B0o0 0  0 0@0 $0Q01  000 00 0S x0t0   X 0 00 000  $0R: 00K$*(*p"|"""- M  000CS/(/4/L///@/0D00H0 0L0 0P00T00X00K/- M 0000K/- M 0 0K00 0[0c 0! 00K/H-M 0  K0K00 0[  K0 00 0[ C KS0KH-M   0 00jJ00C00K [00CR*0[0K- M  0H0S 00 H 0K/H-M 0!0K!0[00    !0[S 0S  000#!0R0-0 0K!0[0c0K!0[ o@0[00 h000 0[1@ 00 0 0K0[S00[00K [!0[0R 0[(@(00 '0F( P(00 04@(P(00 02@(P(00 00=(@(00 0F(P(00 04@(P(00 02@(P(00 000 0S0R T10S 0 00K1[s0@({0S(@(}0@(x00 (r@(n0@(i000 0,  @00 0[00K0[0C 0R0[0 0R*00[008C8C28#88C(00 0 ( x(0T ,00(0T ,0 (0>8C8C28#88C,00c 08#828C8C28#(.83200 .00 400 (0T ,000000K(0T 000 0[1S0[20C0K(0T 00( T    0[S0[0C0K(0T 00( T    0[S0[0C0K(0T 00( T    0[ S0[ 0C0K(0T 00( T    (0T 0009S$1@(0T (0>8C8C28#88C80L! H! ,  0      0!M?0;0[ S$0@(0T (0>8C8C28#88C80  ,  0      0|| 0x0(0T 000 [0  000 000  0R@:0K#P"""Ș""7pH-TM@ @00,0 0-0K,0000Sn 00 %,008C8C28#88C(00c0C40 @0T 000-0K@0T 00@ T4  @0T 400- [ 000 ,008C8C28#88C8/008#88C(0R@0T ,008C8C28#88C80C00kSU x7@,0000P@0T @0>8C8C28#88C830$' ' P 0'70@0T ,008C8C28#88C80C00jS" 6@,0000P@0T @0>8C8C28#88C80X& d& P 0DD&U?0@0T00-0K-0[fS-0[iS5@@0T @0>8C8C28#88C80% % 0%V?0_-0[g0C0K-0[iS000$0 00 00 @0T 000%0K%0[8C8C28#88C80$ $     `P$  0$4A00[0S %0[cS%0[_S%0[ 0%0K0[S 0[S%0[_S%0[`0C%0K@0T 0 0% [ 0[8C8C28#88C8G0t# #     `P$  0`D#d30@$ 0s8  8000 800 00 0$0 %0[bS%0[bSB0[<<0K=%0[fS: %0[fS0%0[bS%0[eS&x2@%`[P[@0T @0>8C8C28#88C800" \"     `P$  0"(20u%0[e0c90K9 [0[R 90[0K0[0S 00$0 000 ,008C8C28#88C80C 0R0[0S3 $0S&<1@-`[P[@0T @0>8C8C28#88C80 !     `P$  0 0H0&@$ 000 00 @0 P @0T 00 08#828C8C28#@.l0200 .0Kp#D"T""Ș"O"""`""cp"yx"H-0M( (000 0@(0 c0 0@(0 0 008C8C28#88C8S0000000 0 0 0000000S (0 0000R 0- 000(m00K008C8C28#88C8S?1[fS1[kS1[jS0($ $0S (0 000#!$0R0(0S  0<000 0<001[kS 000 000, 000'1[S008C8C28#88C8S008C8C28#88C80({0S (0 H  0<000(0L 008C8C28#88C8R$2@(0Lp008C8C28#88ChQ[(0T (0L0s0H" D" p `P0,,",20(0T@008C8C28#0028C8C28# 1200 8C80 [ 008C8C28#88C8ST0000S 1[fS1[iS00001[jS000S; 00 (k0S(r0S 00 008C8C28#88C(0 0R00S008C8C28#88C(00R00  0<000S(0 H 00K# """Ș"- M 0000K/- M 0 0K00 0[0c 0! 00K/H-M   0 00900C00K [00CR*0[0K- M  0H0S 00 H 0K/H-M  0L 0R0%0 S0 0L0 0R0L000 0 S<0 0T0c 0S00 T 0 L 0KH-M0  0K$ 00K0[S0 0[0 0K0[S 0[0 0K 0[KH-0M 00 0 00S000K00K0[O 00[ 00K0[S00[00K0[S0[Sl20[  \X HH"000[4"00K0[S0|0[ 00[ 00K0[S0h0[00K0[S0[0S 0[?0 0[100000K0[0S 0[?0 0[#100000K 0[0S 0[?0 0[#100000K0[+S00[[     0B0 [000 00 00 [R 0 0 0 0000S 0000000>00>00S 0 H 000 0R* 0 H  0;>>0 0000r 00K007C:8#8S  ',0S  0;>>00Y1[S007C:8#88C8S007C:8#88C80 0S 0 H  0;>>0031[+S00[    =70 0T@007C:8#0028C8C28# 8020 8C80 [ 0K#("""l"- M 0000K/- M 0 0K00 0[0c 0! 00K/H-M   0 00i600C00K [00CR*0[0K- M  0H0S 00 H 0K/H-M  0L 0R0%0 S0 0L0 0R0L000 0 S<0 0T0 0S00 T 0 L 0KH-M0  0K- 00K0[S0 0[0 0K0[S 0[0 0K 0[KH-M 00K00 0 00 S0P00K00K00K+ 0000S 0[0[0c0 [0 0K 0[= 00[ 00K0[S0(0[0S 0[00K0[0C00K0[S0[S 00[00K0[0S 0[ S00K0[0C0K0[ S00[KH-M 00 0 00 S00 0K 00K0[  K 00 [ ^0 0K0[  K 00 [ N0 0K0[  K 00 [ >0 0K0S 0[S0000[  K 00 [ #0 0K 0[S000S 0*0[  K 0S 0 000!0R0z00 0000 0000 0;>>00>00 007C:8#88C( 0P 0T 007C:8#88C80 0;>>00>0000K0[ S007C:8#88C8S007C:8#88C80<0S 0 H  0;>>00b0T007C:8#0028C8C28# H120 8C80 [0  `00K0[ S 0 H  0;>>0000T@007C:8#0028C8C28# 020 8C80 [0   0 000007C:8#88C8S000K- M 0000K/- M 0 0K00 0[0c 0! 00K/H- M 00K0[@0[0000KH-M   0 00200C00K [00CR*0[0K- M 0A?K/H-$M( (0<0 0@(0 c0 0@(0 0 000 (0S0S0s(0  0S e(0  0S X(0  0S K(r0  0S >(O (K 00 00 0   0@(<00 0 0 0@(100 0 0 0 (% 00@(0 0000 0 @00KH-M 0< P0EKH-M u00 0K( H-M 00S x0 0;$\\ V0;S 0;0;S 0;K,*#L""- M 0 +0 +K/-M  00 0 0 0 00R000 0 00Q0000c 0 00Q000 0 00Q0000cK/H-8M0 4 8 <0 <00 0 400 00 00 0 00S0 0  01018  0  01018 000 000 0 00S 01C1 00$0  01018 0(0 $000C1,0 0 c$0!0c(010c/#/B,0Ru$0 !(010c/#/B,0Ra$0 !$00 (01 c(000c/#/B,0RN$0 0S(0 0S$0 !$0 0 c(01 c(0 00/#/B,0R3$00S(00S$0 !$00 $00 (01 c(00 c(000c/#/B,0R 0 1  01018 00(00 00 000  <0R` 0SI0 0 00000 0101 0R5010 0  010 0  00 01 00 800cC!00000010 0 000   0R 01 00 000 000 <0 C0R 0K-$M  $0 00 e01 000 0 0 T0 01000 0 0S02 0  02 0   02 0 "   b 000 00S"02 0  02 0   02 0 "      000 00 0 0 0R000  $0R0K/-M  00 0 0 0 0 0R000 0 0 0Q0000c!0 00Q0000 00P0000c0 0 00Q000 0 00Q0000cK/- M  0 00R 0 0000R 0 00R 0 0 000R00K/H-XMH L P T0 T010$0 010(0 T00,0 0000 00 0 0 ( 0, 00S 01P 0 01P00010040 00 00 00 F00 00S=01 0 0100010080 48}0S( 00 0 800 8000 00 80 0S 800S80 80 00c 00 0  1( 0 ! 000  0R0S400 4000 0 40 0S 400S40 40 00c 0 0 01P  $0 00 000 01( 00 01(000010080 000 F0, 00S=01P 0 01P00010040 480S( 0, 0 400 4000 0 0 40 0S 400S40 40 00c 0 0 0  1$ 0 !P 000  T0R0  2H 0<0 0 00.0 <0  0 00|.0 <0 <0L  00L$ 0@ 00L@( 0@ <0@  @02L 0L0 00 0 T0R0A,?(=$;0H 0r0K謚H-XMH L P T0 P0;0 P0;0 P0;0 P0 ; 0 01I0$0 001B0(0 00($ 0^, 0 1? 01.000 001'040 0040  0C8 ,0ST80SQ0 0 00 01( 00 0 0 000  ,0R00 014 00 0 0 000  80R 00 0 020<0 8 ,0 c8,0Q0000c ,0020@0 400800@<( ,0 H0@  L0<  00 40($0KL-M   0 0 0 00    K/- M  0 000c    b00 0000c a0K/-M   0 000c     b 000000ca0K/-M   00 000 0000K/H-(M0 4 8 <0 < 00cS0c0 00c00 qP0 0 00@05QP01Q`0S0c+Q0`c0S0c$Qp0 Q0W0000c00c0@0QP0Q`0S0c Q0`c0S0cQp0P0W0000c00c 0000cS0000c00c$0  $030(0 < 0R (0 $0R#00 000 ( $ Q"   0 (0 $0R#00 000( $ Q" 0000  40  8 b KpH-dMX \ ` d0 00 00 1$0 $0,0 1 0 0(0 0<0 j<01\ 00 00 <01\ 0 0 c<01\0 0Q0000c0 0 0 <01\ 00$  c<01\0$0Q0000c0$ 0c$0 <01\ 00 00 <01\ 0 (0 c<01\0(0Q0000c0( 0(0 <01\ 00,  c<01\0,0Q0000c0, 0c,0 <00<0 < `0R`0 00`+0@0 `0 00`+0D0 $ @0 c$@0c @00c@ 0c$@0 0cP0000c0 c$@0c$@0c @0 0c@ 0 c$@00c\0000c0c,D0c(D0 0cD(0 c,D00c\0000cD,0 0c0,D0c,D0 c(D00cD(0c,@D00c^0000c0 c$@0 c$@0c @@00c@@ 0@c$P@00cT0000c0 0cP0000c00c` O0@c$ @0 c$@0c @00c@ 0c$@0 0cP0000c0 c$@0c$@0c @0 0c@ 0 c$@00c\0000c0c,D0c(D0 0cD(0 c,D00c\0000cD,0 0c0,D0c,D0 c(D00cD(0c,PD00c^0000c0 c$@0 c$@0c P@00c@P 0Pc$`@00cU0000c0 0cP0000c00c` O00CS0000c00cH0  H030L0 080 8040 4000 0<0 ,<01\ 0 @0 cL0 H0R3P0 <01\ 0 D0 cL0 H0R3T0 P0P 0 000 P0T 4 040 T0T 8 080 <00<0 < `0R400800d00X@D 00pKpH-M     L0S00 c0 00  b 00  b KH-$M $ ( $00(  $000(0c0 0S0R$000(  (000$0c0 (00$  $00(0c0 0S00c0 00c0 00c0 0 0?0 c0?00c "00*0 0 0@0 0?0 c0?00c "00*000KH-(M $ ( ,0 $(,  (0 $000c 0 ,0 $000c0 (00 $0000c0 ,00 $0000c0 0  0  0  0   0#003?0c03?00c0!0)0 0 0 c0#00c03?0c0c03?00c0!0)0 0 0 c0#00c03?0c0c03?00c0!0{)0 0 0#0 03?0c 03?00c0!0a)0 0 $0 0 $0 0$ 0 ( K-M   0 00   b 00 $a 0 00   a  $ ` K/-M   0 00  00 0(00C3 0(0R# 0 0 0 00     (  B" ( Q $  K/K-Mp t x |0 | t00c 0  t00c$0  t00c(0  |00c,0  00c00  x00c40 x00c80  x00c<0  00c@0  00cD0 0 40 D00cH0 $ @0, 800cL0 0 @0, D00cP0 0#@ 0/#/B40S0cc40/#/B 0S0cR0000c00cL@H P00S0cL00T0 $0#@$0/#/B80S0cc80/#/B$0S0cR0000c00cL@L P00S0cL00X0 H0#@H0/#/BL0S0ccL0/#/BH0S0cR0000c0@cH0#@H0/#/BL0S0ccL0/#/BH0S0cR0000c0 cP0S0ccP0#LH0#@H0/#/BL0S0ccL0/#/BH0S0cR0000c00c\0000c00c6L\ T X0cX T0R0000c T0 b\0cT X0cX T0R0000c T0 b\0R0000cT X0cX T0R0000c T00c 00cT X0cX T0R0000c T0bT X0cX T0R0000c T0 b\0cT X0cX T0R0000c T0 b\0R0000c0 c000CS0000c00c`0  `030d0 0@_H P000`0pd0 ? 0` a Q2JSS p0 $0@_L P000`0pd0 ? 0` a Q2A@  JS̀ S p0 p t08040@_H P000`0pd0 ? 0` a Q2A@  JS̀ S p0 80@_L P000`0pd0 ? 0` a Q2A@  JS̀ S p0 p x0<0H d0 `0R#p0 L d0 `0R#p0 ` 0R d 0R#P0` 00cQ# `0 cP0"p00 0#@ 0/#/B$0S0cc$0/#/B 0S0cR0000c0@c 0#@ 0/#/B$0S0cc$0/#/B 0S0cR0000c0 c(0S0cc(0#L 0#@ 0/#/B$0S0cc$0/#/B 0S0cR0000c00c\0000c00cJ@p00#@p00/#/Bp00S0ccp00/#/Bp00S0cR0000c00cJ00T0 40#@40/#/B80S0cc80/#/B40S0cR0000c0@c40#@40/#/B80S0cc80/#/B40S0cR0000c0 c<0S0cc<0#L40#@40/#/B80S0cc80/#/B40S0cR0000c00c\0000c00cAJ@p00#@p00/#/Bp0 0S0ccp0 0/#/Bp00S0cR0000c00c"J00X0 P0S0cJ `00c\0 T X0cX T0R0000c T0 c\00cT X0cX T0R0000c T0 b\000CS0000c00ch0  h030l0 ` h00`0 d h03d0 p0 0@_P00`0pd0 ? 0` a Q2A@ @ JS̀ S p0 p000c@_P00`0pd0 ? 0` a Q2A@ @ JS̀ S p0 p000cP0 ? B0Pd0 ? 0` a Q2A@ @ JS̀ S p0 p00@_P0 0d 0` a Q2A@ @̄ JS S p0$ p00@_p00 0p `p@_ l @_ R0h a Q2A@ @̄ JS S p0( p00@_p00 0p`p@_ l @_ R0h a Q2A@ @̄ JS S p0, p00@_p0 0 0p`p@_ l @_ R0h a Q2A@ @̄ JS S p04 p0 @ KH-$M $ ( ,0 $080( 0c(0 $0<0, 0c,0 $00( $00,00 $0 0( $0$0,00 $0(0( $0,0, $040 $0@00C3 $0@0R30 0S0S11 0 0 0S110040S00c0 00c0 00c0 0 0?0 c0?00c "00$0 0 0@0 0?0 c0?00c "00#000KH-M   0 0S0S11 00 0S110:0S00c0 00c0 00c00 0?0 c0?00c "00#0 080 0 0@0 0?0 c0?00c "00#0 0<000K-M  00 0 0 0 00R000 0 00Q0000c 0  0 0Q000 0  0 0Q0000cK/H- M $ 0H00 0 0  0   00 0 0S00 S0 020 00200K$ 0@0 c 0D00cK 0/#/B0S0cR0000 0 0K000?00 0 0  1 0  0 020  0 020 K 000 0 0R0 0 0 |00 0 0 0  0 C 0 ! 0C 012 0   00 0 0SKH- M $ 0H00 0 0  0   00 0 0S00 e0 020 00200K$'0SA 0@0 c 0D00cK 0/#/B0S0cR0000 0 0K000?00 0 0  1 0  0 020  0 020 K 0 020  0 020  000 0 0R0 0 0 |0p0 0 0 0  0 C 0 ! 0C 012 0   00 0 0SKH-hM` d h 080 80<0 00 {`0  1S\`0  10 `0  10 0 0 0C10 02 0 0 0 0 000 0C1  c0R0C10 0c0 0 0?0 c 0?00c " 00!00 00 70!K 0 0 70K0  G0!K 0   W0!K 0   G0!K 0  G0!K 0 W0K0 000 0S`0 0S`0$0S`0@ <00 c`0@ L <0\00cL0 H <0X00cH0 `0(0S`0,0S`0D 800 c`0D D 80T00cD0 @ 80P00c@0 \ X00 0 0S0~ 000 0 H L00c$0 $0 0 00E!0$0 $0S0e$ 0>0b1 d0 $011!0(0 (0S(0+S0NT P00,0 ,0S0E, 000,0 @ D00c00 00 ,0 ,00 !000 00S0,0 0>0b1 h0 001 040 40S40+S0( 400cS0cS0 `0$  `00  `0(  `04  0KH-hM` d h l0 `0l  1$0 `0l  1(0 00 (0S 0 0 00 (0h*@0,0 (00Ch#@00  ,0R000 ,02$ 000 02$ 040 00 0000@KdB40 4000HKd9`0@0 c`0D00c@K `0@0 c`0D00cHK l0 ;0!K 0 l0C0K000c/#/Bl00c;0K0l00cC0K000cS0cRo0402|C080 00 0 0 * 02$ 004 0/#/B80R 02$ 0 "$  000 02$ 0 "$  00 0 (0R 0R.0 0 02$ 0 "$ 00 0 (0R00 (0 0R( 0200 030c0 C(000 0 000   0R00 00 +02$ 0 00S  0R02$ 0XK02$  02$002$ 0X0K000 000  0R`0l  KH- M  $0 0  1 0 0S0: 01៿00 0  10 00 01 0 " 01 0 "   000   0R $00H0 0H00 90KH-0M( , 0 40 00 10 40 10 0 C0S0000c0  c0C0S0000c00c00 01800 0S#00  10 0 0  01 0 " 01 0 "   00 0 0R'00@0$0 00D0 0 00 0!K 0 0001@ 0K0 $  0,000 0S'40  10 0 0   001 0 "   001 0 "   00 0 0R+40@0$0 40D0 0 00 0!K 0 0401@ 0K0 01 $  0,R000 ,0(0( 00H0 00H00( NK-M   0 0S  0R0S 0R 0S  0R 0S 0R0:0 00 00S000 0R 0 00 00S000 0R 0 000 0000 00S000 0R00K/-DM8 < @ D0 D00 00 0 0 00  D00cS0c(0 00cS0c$0 $ (0R000 0 00 0 c#0!K 000 D 0R0000  0R00,0 0!K 0 0K00R0 0!K 0 +0K00 0K0  000 0 #0K00R" 0c 0 c0!K 0 0c+0K00 0K0 #0!K 00 0c0 0< 008 00S000 0R 00 0!K 0 0K00RY 0!K 0 +0K00 c 0K0  000 0 #0K00R" 0c 0 c0!K 0 0c+0K00 c0K0 #0!K 00 0c0 0<  008 00S000 0R   0001 0 00   ! 0K/0H- (M( , 0 40 (00 1,  (001,00 00 c(01,  00c(01,00 0S00c0 00c0 40@@0S0c@00@c40@P0S0c@000CS0000c00c0  0300  0 0R30  0 0R30 0/#/B0R0"40 c00 0 0?0 c0?00c "00N0 0 0/#/B40R00  0 K0-M    00"0 0 0 00C 00 00 0 0R0S 0K/-M   0 0C10 0C100 C0 c0C0Q0000c 00 c0C0c0C0P0000c00S0000c00c  0C0c 0C0P0000c00c 0C0c 0C0\0000c00S0000c00c 00S000K/K-M  0 00c<0  00c@0  00cD0  00cH0  00cL0  00cP0 00cT0  00cX0  00c\0  00c`0 L0P <0`0cd0 @0\ H0T0ch0 d0Sh0S L0\ H0`0c 0 0 0 d  00< l0 h  00@ p0 d  00P t0 h  00T x0 x0 $0 p00c (0 t00c ,0 l0 00 t0h x0d0c40 p0d l0h0c80 l0x p0t0c|0 $0S $0S0c |0?0 c|0?00c "|0 $0S0c 0 $0?0 c$0?00c0"$0 (0S (0S0c |0?0 c|0?00c "|0 (0S0c0 (0?0 c(0?00c0"(0 ,0S ,0S0c |0?0 c|0?00c "|0 ,0S0c0 ,0?0 c,0?00c0",0 00S 00S0c |0?0 c|0?00c "|0 00S0c0 00?0 c00?00c0"00 40S 40S0c |0?0 c|0?00c "|0 40S0c|0 40?0 c40?00c0"40 80S 80S0c |0?0 c|0?00c "|0 80S0cX0 80?0 c80?00c0"80 00c0 ( 00c0 0 00c0 0 00c0 0 (00c0 $ 00c0 , 00c0 4 00c0 4 $00c0 4 ,00c0 0 00cd0 0 00ch0 0 00c 0 0/#/B0#A0S0cc0#@0S0cP0000c00c#>@d  00S0c>000 0/#/B0#A0S0cc0#@0S0cP0000c00c=@h  00S0c=000 d0/#/Bd0#Ah0S0cch0#@d0S0cP0000c0cd0/#/Bd0#Ah0S0cch0#@d0S0cP0000c0 c 0S0cc 0#Nd0O#ODd0/#/Bh0S0cch0/#/Bd0S0cR0000c00c^0000c0 0c= 0 c0Q0000c0  c0 c0c0P0000c0c0Q0000c 0c0P0000c00c0 0 c0Q0000c0 @c 0 c0Q0000c0  c0c 0c 0R0000c0  c0R0000c00c0CS0000c0 0c0  0300 0@_d  00 0 0 a Q2A@ @̄ JS S 0l0 0@_h  00 0 0 a Q2A@ @̄ JS S 0p0 0@_d  00 0 0 a Q2JSS0t0 0@_h  00 0 0 a Q2alJS`Sq0x0 $0S $0 l0?0 cl0?00c "l00$j0@@,0S ,0 p0?0 cp0?00c "p00,S00 0 (0S (0 l0?0 cl0?00c "l00(:0@@00S 00 p0?0 cp0?00c "p000#00 0 $0S $0 t0?0 ct0?00c "t00$ 0@@,0S ,0 x0?0 cx0?00c "x00,00 0 (0S (0 t0?0 ct0?00c "t00(0@@00S 00 x0?0 cx0?00c "x00000 0 $0S $0 d0?0 cd0?00c "d00$0@@,0S ,0 h0?0 ch0?00c "h00,00@40S 40 0?0 c 0?00c " 004|00 0 0R#0 (0S (0 d0?0 cd0?00c "d00(_0@@00S 00 h0?0 ch0?00c "h000H00@80S 80 0?0 c 0?00c " 008100 0 0R#0 0 0R#0 00< 00P00 0 0< 00P00 00< 00P 0 000 0 00c0 0 00c0 00@ 00T00 0 0@ 00T00 00@ 00T 0 000 0 00c 00 0 00c 00 00D 00X00 0 0D 00X00 00D 00X 0 000 0 00c 00 0 00c 00 00C!0 00C!0 0 $ 0 ( 0 , 0 0 KH-M   0 0S0S11 00 0S110:0S00c0 00c0 00c00 0?0 c0?00c "00A0 0$0 0 0@0 0?0 c0?00c "00(0 0(000KH-M   0 0, 03 0c0 00 03 0c0 00  00 003 0 0 00 0030     cKH-0M $ ( ,0 0P00$ 0c0 0P00( 0c0 00 0 0 00 400 + 0101 0 !0 0101  0! 0 000, 0 03 00 000 000 0S 00 0 0S0KH-oM  ! 1 1 C1,00cL0 1 C1000cP0 10L 10P 100 0 1 0L 10P 100$0 10L 10P 1 00(0 10T0 1 0X0 10\0 10`0 10d0 10h0 080 9 0,0 $000 (040 0<0 eK8 010< 0104  , 00, T00,0 0 X0000 4 \0040 <00<0 <0S `00 0 $ d00$0 ( h00(0 80080 80S410 010 e?K    0   0Sڤ1,0!0cL0 100!0cP0 10L 10P 1001,0 1 0L 10P 100100 10L 10P 1 00140 080 8000Cl0 T `00, 0c,0 X d000 0c00 \ h004 0c40 0<0 mg?K4  , 00!1eK  0p 00p 9t t 0Rp00 t00 10 10 l0 <0R< l0R000x0 1x 1, 0,0 1x  10 000 1x  14 040 l 00 <0R000x0 1x 1, 0c,0 1x  10 0c00 1x  14 0c40 0S<00<0 l0!<0R0S80080 0!80Rg0S4!1 100! 041 0c|0 01 0c0 0K 0K 080 :8 !0  8000R|8 0  00 \:80010 @:! K 0 |00C10 0S  0R8 0  00 980010 9! K 0 00C10 0S 0Rl8 0  00 cL980c010 09! K 0 |00C10 0S  0R8 0  00 c880c010 8! K 0 00C10 0S 0Rc800    0g?K0  0P0SP!00cD0 !00cH0 800S 0@0 D00D 0D0 H00H 0H0 0@0 8080 0! K 0 @0 0 K0 8080 0! K 0 D0 0 K0 8080 0! K 0 H0 0 K0 80080 80S080 B80 0! K 000 800 0! K 000 0S 0S 0 c0Q0000c0 0c0 80@80 0! K 00 8000 K000 0800 K008000 K 000?0c800 K008000 K 000?00c0! 0l0 0 K0 80@80 0! K 00 8000 K000 0800 K008000 K 000?0c800 K008000 K 000?00c0! 00 0 K0 800 0 K0 E8080 0! K 0 8000 K00 0 K0 8080 0! K 0 8000 K00 0 K0 8080 0! K 0 0 0 K0 80080 80Sڼ 000 000 000 0SI 00?0c0?00c0! 00|0 00?0c0?00c0! 0v00  |0 00eK  0p 00pd t t 0R |000  000 1  10  0K?"Ԡ"x|O- kMp t x! |1 t 0^| 0YF?K t!|1|1H0 |1H00FK 0S x1H0 x1H00FK 0S0t 0.x 0)F?K0 t!x1|1H0 |1H00FK 0Sx1H0 x1H00FK 0S0x1000 x 00(0F/K x -0S-t1H0 t1H00FK  |0S|1H0 |1H00FK  m0S0F?K 0K/K  00S00,1 x1@x1 000,!0?0b00@0 x1D 0?0b00D0 |1000 | 00(0F/K$ | 0S-t1H0 t1H00FK$ 0Sx1H0 x1H00FK$ 0S0OF?K$0.K  0n0S0A001 |1@ 0?0b00H0 |1D|1 0000!0?0b00L0 x140d0 d080 |1D D0 c000C0 800<0 <01#040 00 014  x1020 u000 x14 0R|1<0|0 |0,0 x1@ H0 c000C0 ,0000 0010(0 00 01(  |1020 C000 |1< 0R0 0(0#0(00C300 0$ 0(0#0(00C300 00@ 00D 00P0 00@ 0 0D 00T0 00,!000X0 00,!0 00\0 00x! 0 00x! 0 00H 00L 00h0 00H 0 0L 00l0 00 0000p0 00 0 000t0 00|! 0 0 0|! 0 0x0 x0`0 |1D L00 L0 c|1DL00L0Q0000c L0 D0R`0S000 x1@ @00 @0 cx1@@00@0Q0000c @0 H0Rx0S000 0S0SD H0RP 0 0(00R30 T 0 0(00R30 P 0 c0(00R30 T 0 c0(00R30 8 <0R <000<0 <014I4 0000000 0 0K 0S8014 0     0 0 0S|0Sv8014 0 801400K/ !@000@0 !0 D0R!D000D0 00@ 00D 00P0 00@ 0 0D 00T0 80080 d0C!d00 cd0Cd00S0000c0 c80R00(0F/K 48 F?K 0K/K  0b0S00,!000X0 00,!0 00\0 80d0 0`0 `00`0 ,1@ 0@0 D 0 D0RD 00D0 1`0 P X00P0 T \00T0 0Sh 0 0(00R30 l 0 0(00R30 h 0 c0(00R30 l 0 c0(00R30 , 00R 000000 001(W( 0000000 0 0Y 0S,01( 0     0 0 0S{0Su,01( 0 ,01(00K= !0 H0R !H000H0 !L000L0 00H 00L 00h0 00H 0 0L 00l0 ,00,0 |0C!|00 c|0C|00S0000c0 c,0R)0(0F/K$ (, F?K$0.K  0p0S00 0000p0 00 0 000t0 ,0|0 0x0 x00x0 H 0 H0RH 00H0 1x0 01L 0L0 h p00h0 l t00l0 80S 0(0F/K 48 zyx1@x1 000 x1D0JK0(00@00/#/B00#A0 0S0cc0 0#@00S0cP0000c00c00@c00/#/B00#A0 0S0cc0 0#@00S0cP0000c00c0 0(0000cS0000c00c0  0300 0 0 0R3 1 00  c0R31 1(!1$00c1 4h,0S0(0F/K$ (, z|1@|1D|1 0000J/K <0(00@00/#/B00#A0 0S0cc0 0#@00S0cP0000c00cn00@c00/#/B00#A0 0S0cc0 0#@00S0cP0000c00cN0 0(0000cS0000c00c0  0300 0 0 0R30 00  c0R30 1(!1$00c0 (߮00 F01 0 FK000100 FK00010 i0S001 0 00c1R01 0 01R01 0 00c1R01 0 01R0000 0S0000 0000 t1 t1 0 x10 |1 000 0S{000 0C00C1 0C0C00p00`00P00@000000[/K000010 p` P$@(,0 00 C00CNK[K 0S1000   0000c0 00 0000c0 00 0000c0 00C 0 0Ca81 41 c000000 0?00c0 0S0c0 00C @_81  ?00 0C8!`00  0c ? B0P0 0000ȟ41  0c` & 0 00 ?0 ?@ P!KG000C @_81  ?00 0C8!`00  0c ?B0P0 0000ȟ41  0c` &0 00 ?0 ? "0#?0 c00C @_81  ?00 0C8!`00  0c ?B0P0 0000ȟ41  0c` &0 00 ?0 ? "0#?00c0, ?LK0 ? 000 00C  @_410c  ?00 0C4!`00 00 ? B0P0 0000ȟ81 00` & 0 00 ?0 ?@ P!KF000C  @_410c  ?00 0C4!`00 00 ?B0P0 0000ȟ81 00` &0 00 ?0 ? "0#?0 c00C  @_410c  ?00 0C4!`00 00 ?B0P0 0000ȟ81 00` &0 00 ?0 ? "0#?00c0, ?LK0 ?  000 00 000 p 0 KH-M 00 0 0#60 0S0(S0 C01   0S0 C0!0 0!00 0 0#6R h0 1   0S<0 !0 0000 0!S0Kl"H-pM` d h l0 0P0 `0  !`0110c G0K0 0c0 c`0 !0c`0110c G0K0 d00L d00H00 d00L d0 0H0 0 d00L d00H d00000 0 cd01 b` !,0 0 cd0 1 b` !00 0 cd0 1 b` !40 d0 1` !80 d0  1` !<0 d0  1` !@0 00 00 B0 0 0$0 0(0 00 'X0K(  d $0X0T  hl 03 P00P0 800 0 $ <00$0 ( @00(0 000 000 0S ,000 000 0  4000 000 0SP0KD D0SP0#6D0KH-M  0 0\0 0@0 010040 0D 0010c080 004 00800 004 0 0800 004 008 00000 00  <0 0 0  @0 00  D0 0$0 $0(0 $0S2 T0K   0n\@T0P   C (0( 30\0 $0S0d0 000c  <0 000c  @0 000c  D0 5 <000  @000  D000 $00$0  <000  @000  D000 $0S T0K   0d@T0P   (0( 30d0 $0 C$ S0X0 0@0 000040 0D0 010080 004 00800 004 0 0800 004 008 00000 000c  <0 000c  @0 000c  D0 0(0 #T0K   0X@T0P   (030X0  <000  @000  D000 (00(0 (0S0`0 0@0 010040 0D 0010c080 004 00800 004 0 0800 004 008 00000 00  <0 0 0  @0 00  D0 0(0 #T0K   0B`@T0P    (030`0  <000  @000  D000 (00(0 (0Sd `0R 00H0 \ X0R00L0 00 0$0 w$0 O0! K 0 $0W0 K000;#0#0 0K%', 0#50 ,0S0,0 000 0 0R0 0g0 K0 0 w0! K 0 0 0! K 0,  000 00 g0! K 0 0R"0 w0! K 00 0w0 K0 0 0! K 0 ,0R0 0! K 0,  00000 $ L00$0 $ H0R0 0 0$0 F 0! K 00S$ 0! K 00S/$ w0! K 0 w0 K00R$ w0! K 0 w0 K00R$ 0! K 0 0 K00R$0 0 $00$0 $ 0R 0! K 00S g0! K 000K-$M  $0 0020 0 0 )$00 0 002010   " !   " 000 $ 0 0R 00 0 0 0RK/-M   0 0 00202010 00230K/-M   00 000 000  0RK/O- KM  0 01080 0, B!?0c0<0 80C800C0 80C80C00p00`00P00@000000 K000000 p` P$@(,0 0<0 C04 <00C<  B4 {0 0 0(0 (0 C0!04040( (00(0 04 (0R8 80021ဣ0 0 00 008 0800C   8 800C  8 00S80 0C   8 80 0C   8 0800C0008 0800C 08 00S0 0K4 d,<0< 10@0 <0< 10D0 00 <0C80 C0$K0 0S00C)0H0 <00C(0 (0 0!$K 0 H0 c(0$K0 (0 C( S@0 @0  0 D0 0 D0 <02C1@ 08  B <02C1@ 0  <02C1D 0  <02C1D 0   <00C< 1@ 0 <00C< 1@ 08  B <00C< 1D 0 <00C< 1D 0   000 <0 C00 c<0C00Q0000c 00 <0C00Q0000cL0 <0 C00R000 <0C00c<0c000S0000c00cP0 P0,0 LP ,0 cL00(0 (0< ,00T0 , 0!$K 00X0 ( 0!$K 00\0 T01@ 0X  T01@ 0\  X0 C\00C8(0SH,0SE(0 C0!,0440C0 KX \0(0 C0!,04h0C0 KX \0(0 C0!,04h0C0 KX \0 0c0P0000c0 00"`0 `00"0 `00"0 0c0P0000c0 00"d0 d00"0 d00"0 0c0P0000c0 00"h0 h00"0 h00"0 0c0P0000c0 00"l0 l00"0 l00"0 0c0P0000c0 00"p0 p00"0 p00"0 0c0P0000c0 00"t0 t00"0 t00"0 (0 C0!,0440C040 T <00c2C1@ 0`T <00c2C1@ 0PT <00c1@ 0@T <00c1@ 0T02C1@ 0T02C1@ 000 T01@ 000 T01@ 000 T <00c2C1D 0T <00c2C1D 0T <00c1D 0T <00c1D 0pT02C1D 0T02C!D00 0  p$(, 004 0&(0S ,0S (0 C0!,0440C040 (0S,0S (0 C0!,04h0C040 $I""0K40 T01D 0     4X \0(0S,0S(0 C0!,0440CT <00c2C1@ 0T <00c2C1@ 0T <00c1@ 0pT <00c1@ 0T02C1@ 0PT02C1@ 0`T01@ 001 T01@ 001 T <00c2C1D 001 T <00c2C1D 00 1 T <00c1D 001 T <00c1D 0@T02C!D00T02C!D00T0!D00T0!D000P`! ! ! ! ! @$(,00  0,00,0 , L0R00000 <00 C00Rr<0< D @夣D墣00400C1 K  *0400C 0! 08  00  0t00 040440C 8000C 0`0040 C0!8000C P0040 C0!040440C800 C8000C:0(0 (01 0 b b( !  A( !P @b Q( !` U   b  b( !  A( !P @b Q( !` U   b  b!\   b  b (01 0 b b( !  A( !P  @b Q( !`  U   b  b( !  A( !P  @b Q( !`  U   b  b!\   b  b (00(0 (0Sa KH-M 00ᝢ00ᙢKH-@M8 < @ <00200 @0S[\$]H]]^`_`U00 0 0  00 18  001 ᙡ00#0 00 0 <0R<00 18U ᆡ00 0 0  00 18 0 001 r0$0#800 00 0 <0Rc00 00  000 3 00 000 0 S0 0 $00 00  00 0018 0  0#!0000 000  00R0 0100 00 0 <0R"0 0 0 0  00 18  000c0# 001 0 020 0 00 0 <0R0 0 L0$0 00 0 3? c0000 cR000 03$ 0$0 000 0S00 $ 03$ 0$0 000 0S00  00 0018 0$  $0#!$020$0 000  00R 00 0 <0R0 0 L0(0 00 0 2? c000 c0 00 03( 0(0 000 0S00 ( 03( 0(0 000 0S00  00 0018 0(  (0#!(020(0 000  00R 00 0 <0RT0 0 L0,0 00 0 ,1? c000 c0 000 03, 0,0 000 0S00 , 03, 0,0 000 0S00  00 0018 0,  ,0#!,020,0 000  00R 00 0 <0RK諪*VUUU0H- hM` d h l0 l00dh /h002@0 00 00 `0 0! 00D0 00 00 `0 0! 00H0 `0 !040L0 L0,0 0cP0 L000 0cT0 L00P L00T L000 0 L0 0P L00T L000$0 L00P L00T L0 00(0 0,0 ` 000 $040 (080 0<0 A`h, <00S'\0K8  L0 40,0@ <0201d @,0@ <0201d 0P\0X   . <0030%0L000 000 L004 040 L008 080 <00<0 < H0RL00 0 0 L0 0$ 0$0 L00( 0(0 ,00,0 , D0RH00 000 `04 0RKD00 000 `04 0R3 K0-LM@ D H L0 00240 L D0R0L0 00 0 0 00 00 00C0 # 00C0000 04 80 400 p8 001 00 0 8 001 00(0 8 0 400c1 00$0 8 0 400c1 00,0 D( 00230S 0 0013000 00 0 , 00230S 0 $0013000 00 0 0S 00C 0 0  1@  0 1"   D0R 000  H0RL000 00 C0 S 000 0 C S00C0 0S00C0 04 80 00 8 001 00 0 8 001 00(0 8 0 400c1 00$0 8 0 400c1 00,0 02  c0 00c 02 0c S0000c0000 H(00S0 0000 00 0 00 0 (00(0 ,00S0 $0000 00 0 $00$0 ,00,0 0S 00C 0 0  1@  0 1"   D0R 000  H0RL000 00 C0 S000  40Rp00C0 0SK/-M   0  0  0  0 0 K/-M  00c 0 00 00 0 000c0 0S0!0R 0 01 0 0 0 0=0S080 0000 00 00030 0S000 003 00 0S 000 000cR3 00 0 01 0 0 0 08#8 32K/- M 0 000c!000cK/H-|Mx | 0 x0 x0  x0 00 |0 S000 |0S0000@0 t0K Jt0K[D D0Sx0 0R0000 x0 0001z x0 x0x00x  00010H0 H0 D00CSooruuvyvwty :@ 1t KL L0S0tL0)?0c0 L 9?c0000cP0 t0Kk 0100P00 010b P0010Q0KD H0 L0ᩚ00 H0  H0L  8t0K 0T0 T0S:010  T(" 0  T0("d0bT0 0  T|(! 0  00 TP8#!0100 c000000 C SP0S&t0K0T0 T0cS00  T'! 0  00 T7#!0100 c00000P0S t0Km0T0 T0 S00  T  0  @ 0! 00t KQ 0S0 00$0 00X0 t0K$ 0100X 00000Q0D H0 000 H0  H0  .t0K 0\0 \ 6R0v0  \%b " 00 \5# c 0"000" c b500 00C 0 $0 C$ SX0S t0K0\0 \0,S0@0  \  D H0 t0K` `0S0)`0C600 H0 H0 x0 `0C40000 H0 H0 x0 `0 H0 H0 x0 (@ 0! 00t K, ,0S0t0K ,01R0D H0 ,0K0(0 H0(  H0,  (@0(0 t0Kw000,0 C, SʵD H0 t0Kfd d0S0d00Sd000 2d0@0Sd0?<00 t0KNd d0S0d00 000 d0 0Sd0800 t0K8d d0S0d00 000 0 X2R00D H0 H00  f@ 0! 00t K< <0S0nt0Ku< 00010Q0`D H0 <00὘040 H04  <0 H0 *t0K 080 8 H13841##0003 c0<@080 80 S:80980 40 4 8 "$  40 4 8   <0 C< SD H0 0t0K0SRx0 x0x00 0001ڗ x0 0K"VUUUQml "?BH-M 00 #0 000100 0001000C0S 0 000100000 0 0R00K- M 0 0  0 0 K/H-M 00 0 00020000 0 0R00ÚKH-M  0 00R000 0 000 0002E 0 000  00020 0 "K-M 0S0! 0 c 0#100 02   0100C 010 c0S$000S01K/%I$H-M  0 0 x0K       00100 002 1h00 x0K       0U 010# 0 00C# 0000$0 00C"0 0 200(0 0 $0,0 0$O0$ 0c00 $01-040 0(080 408  00 014 0 !B!4 0 P  ,   000  $0R, (00c`    4$ 00x0K4忙0 0 00 00 00 7 00R000 ,00<0 08 0(     <00S00 < (00c@0 08 08  @0 ᠗ <000 @00 0 000  $0R0S8  0Y 0SD0 0 0 0 8b0K""P"H-M  ! 1 00000 000  0S00D0 D080 80,0 0S00@0 @040 0S00<0 <000 000 000 0 0 00 '0 ?0!K 001 00 0?0K00100 0R0 0 00 000 0S 00  ?0!K 001 000 0 ?0!K 001 000 0 ?0!K 001 00H0 !0 c1Q0000c0!0c0C00c$0 00 H0fK$0 00K@fKb Kf?K? $0#$03K |0SGH0 H00K@fKF Kf?K# $0#$03K `0S+ 00cS0cS#0 00JK@fK"J/Kf?K $0#$03JK <0S !00cS0cS !00cS0cS11̃[KJK K0KfK 0S0 00JK@[K0 00K@[KH0 H00K@[K K[?KI 0 c00cK 0S K[?K5L 0 cL00cK 0S 0R0S00 N 00cS0cSڐ0S K[?K!10 0 0cS0cS00 00 0Sڐ K[?K!1 0 0cS0cS00 00 0S0S  0R O0SK00 J/K[?K P0 cL00cJK j0S !00cS0cS !00cS0cS'JKK K[?K( (0S0 0H( 0S0000 0 0RQ0KH-Mh l p t0 t0ㅓ00 00 C00 0 2 000 !0 00S02p 000 02p 0,0 02p 0(0 `0K 0 K h 0 0S`0Kl900 Bl0l00 000200Cl0l00 000200C0  1C!00!l0l00 000200Cl0l00 000200C 0! 00C!00 000 0S0  0 0   0000 00 L0 00SC02p 0` K` K  >0S402p 0` K` K(  /0S%02p 0` K(` K  0S02p 0` K ` K  0S0 0 000 000  t0R0S102t0$0 00 00 0 00S 0  2$  02p0000  t0R0000 00hl$ 0$00 0 00S0 0 000  t0R000 0 00S t0R 00 0 0 00S t0R000  t0RޕKH-M    0001> 00 0 00R00 0 000 0 00 0101T 0 000  01010 10K-M  00 000  0R00 02 00 0 0  00 0 0 0R000  0RK/H-@M( , 0 00 00 00 (0;S(0 ;S0\ K0K( 0 P10 S D1 (0;(    !呔0  0S-00 000 000  $0K400  0  $ K( 0 0S$0K,0  $0K(0S 00S 00K,*#`""H-M  \U0 0 0 000 0奔0S > 0ɒ0Ky*"""H-M   000 00 0 0 00R:0 000001S 0 0 010  0 010  KH-M  00 0S 0S}K-M  00 0 000!K 0 ,00,0 , 0R0,0 F,0t 00S=, 0002h 0 0 0R1, 0002h 0 0 0R%, 0002h 0 0 >!K 00S, 0002h 0 0 =!K 0,  ,0t 0 ,00,0 , l0R0 1 00 00 0 0 0,0 V, <=!K 00SJ, =!K 00 0002h 00 000 300 000100 040 000CS$ 00 0 0 40040 40040 0 000C0S0 403 00 00000 0 00R,00,0 , 0R00/00 00 0$0 00 |00 00 0 0 0(0 00 0K80 0,0 @  80 800  , 8;!K 00S2800 ,00,0 ,00,0 , 0R, :!K 00S, 0Rb0   0 800  800 080 @ З 80 , H:!K 00 0002h 00 800 00 800 0$0 800( 0,0 800 00 000 00 000100 000CS|ܤܤܤp 0 c00R: 00 00 Ҏ00 00 0(0 000 000 0SH 0% Ց< <0S<< 00c@0  0 c@00R*0 0 0@ 塎 @000 @0 0R *<000%S%0A0K@00@0 <00<0 0A0K0   0A [ @00c0C0 <000 0<0 <0S 0 c0R*0(0 ] 0 0 `0 00 O000 000  000  00c0 $0S0S@00S<000S7000S2000 00C0 0s K K0KK0s00(0 (0S 0 00c0 0K< 000 000  000  00c0 00S 0K 0H0 pH 0!K 00sd H0S,H 0!K 0 |0R" 00SH00L0 L0CL 0!K 0 0K0 L00L0 L0S|00 H 0!K 0K K0KKr0s000(0 (0S0 00c0 H 0!K 00 K000 000  000  00c0 H00H0 H0S 0s K K0KK 90s00(0 (0S0 00c0 \[000 000  000  00c0 0s K K0KK0s00(0 (0S0 00c0 32000 0S0S 0S 0S 0 C0S0000c0 0c0C K 0KP0 1P0 0S 1P0 0$0 P崌 00000 0 00R(0S $0S0$0 0s ,00,0 800 080 , 0R(0Sk 0s ܐ(0S0   0 0 0R 0S0T0 @ ^T ݐ T0$ T0$0  10X0 0\0 10`0 0d0 n0|00ST0 >0,0 6" ","4"@"H"`"ux"0 ,01000 X 0R00CX0 \ 0Rʘ00\0 0 ,01000 ` 0R00C`0 d 0Rʘ00d0 ,00,0 , 00R:0   0 0S 0 0000 00R444!41婍0   b B 0 00 0S\0sTX` TXd T\d T\` T0  T0  0 CT0 T=0ᨓ兏000  l0R0s 0s |0s |tmx0K-M  00 0 0 00 , ,00 < 0 0 03c000"00 00 0 0S0 0 <  00   00 0 0S0 K/-M   0S 0S   000 000 < 000K/-M   0S   000 000 c< 000K/-M   0S   000 0 < 000K/-M  0S0 0000 000c 00 < 00K/H-dM` d h l0 d0S`h0 l0 0Dh0S l0 l00d   07` d0000 ` h0000 4##"020 cR0000 0S 0 `< 000 ` 0000 0 `< 00h0 ` h0000 d00 0 `< 00` 0 0 0 `< 00` 0$0 $0 `< 00` 0(0 $ (0 `< 00` 0,0 ,0 `< 00` 000 0 `< 00` 040 40 `< 00` 080 80 `< 00<0 0 0 `< 0 ,40`<000" (80`<000"0 <00"` @ ` @00 (2#0200c0S 0|(0 `< 00 00"`@ D `DD @`D 0 $h0 " 00c` H `H L `L @`LL z00$` P `0!`010"0`P T `TT d@`T 0 $L00"`" X `XU @`T 00$`  D00"` 0 0 `< 0 l0 l00l d   !  0KH-0M( , 0 40 40S(,0 0 00S 0   0 0(,0  400" 0 (,,  000"0 0SJ 0S,0 0 0(  0000 H3? c000 cR 00#?0c0 (<  0 ,000" 0 00 U(, ,   !  00 ,   !   !  0( 0000 000c 0000  0 (< 00(  (  0  0S0o00( 0 0 0Sb 1# 000 cR 0[ t10 0 (<  0 0c(<000"0( 0 0 (< 0 ,000" 0 0U0 0 00(,   b(,  ! (  (, ,   !  00    !,   !  0,0 0 0KVUUUH-K 0C0C@$ D$ 8< 000 @3  K 00S .KB>K 0C0C#K D 8 0s$ $0S$  0 c 00c0R03.K>KD8 $0+ $0R000 X2  K 00(0 00 (00c,0 0 0 00 2  K 008 0 0"0 ,0 8< 008$0 0 000  0R00 ,0 8< 008$000 <4( `1##040b c,00 0 00 01  K 008 G0 0"0 00 8< 008$0 0 000  0RD$(00c0C@$@D$(00c0C@$0P8 000%00000  $0Ru$0000  0R10 K00H- M $ ( ,0 ,0SI(,(0 00 <,0 C00S00 $ 0 < 00 00 00 0( @00C( 0P0( 00  000%0000C0 0S(00  0 (0 000  ,0R K00H- (M( , 0 40 0SZ0 00c, 00 800 H0, 0 000"00 0S5 ( 000 0 00 0 @00 0P0 C00c4 00( m000%00000 0 C0R00C @400( V000 000 0 0 c0R K0-,M( (0;00 (000 (080 (0((0 8(0 (0 80 0 00 01 000 0&0 "0010000 01 0 /"!!     01 0 "% !    000 01 000 0##0 "0010000 01 0 /"!!     01 0 "% !    000 01 000 0!0 "0010000 01 0 /"!!     01 0 "% !    000 01 000 0#(0 "0010000 01 0 /"!!     01 0 "% !    000 0S ڀ00 01 000 0&0 "010C10000 01 0 /"!!     01 0 "% !    000 01 000 0##0 "010C10000 01 0 /"!!     01 0 "% !    000 01 000 0!0 "010C10000 01 0 /"!!     01 0 "% !    000 01 000 0#(0 "010C10000 01 0 /"!!     01 0 "% !    000 0S(0 ((0 ((0, K/-M 00 01 0 !    !   " ! 0001 0   !  !  0001 0   !    !  000 01 0 !    !   0" ! 0001 0   !  !  0001 0   !    !  000 0StK/ᨡ"H-HM@ D H @0 (@0 (@0(@0(@0(@0;00 @000 30 0 0 0$0 $0(0 (0,0 ,000 0040 4080 00 80K;000 0SH0 S;H0 D00 00 $01 0 !   !  ( !  $ !  000 H0C!0RH00S- 01 0 ! 0 0 01 0 !      !" 00 0 H0  0R000 01  0\"-00K/h%*H- M  0S 0R000(0S0# 00S0000 000 00n@00n0T 00n@00n00cKH-M o000 @003/ 0S0  n 0KD#- M 0Sp0p l0l 00S 00<04 000S 000 0K/D#H#H-M800(3/ 0S ( Iq0KD#H-M 3000 0 0<S00S 000 0<S 00S x00  3/0 0<S 0 0S <00  3/$003/00 0SKH#0H- (M0 4 0!K \3!K 0"K0(0 0,0 400-S (3!K40040 4000S40040 4000S"4009SK 2 0@P40 4 000C 0 0!K400/S4009S400.S24000/S-40009S(40040 K 2 0@P40 4 000C| 0 0!KK 1 0"K400/S4009S400eS 400ES*40040 400+S40040 400-S0,0 40040 ( 0100 404 000C0(0 400/S4009SK!Kf 0@P(0, & 0"Kl 0dp 0M 0!K0!K!K 00 00 40 K0?$@- M 00C0 00 00 0C1 00 0C2 00 0C4 00 0C8 00 00K/- M  0S 00S000 0 0 0 0R0 0000K/H-M 0S 00S0 0 0000 00@m00KK-(M0 4 0 0 00!"KK 00S 40S 4 203/ 0S l2 0 l000l 0"K 0< 8 K 20S% K!10S K 10S 40S 4j 103/ 0S 000  oSR40S 4@R 410@3/ 0SB Kl 0"Kg 0D @ K 00S ,(0  00S "Ko,`(0q 00S ,@(0Q p00S \"Kqo L"Klo 0KD#x"<A|"DcL"ư>eA""-M 00 00/S 009S00 0000C0 !00@S 00FS00 0070C0 00`S 00fS00 00W0C0 0020 000 00/S 009S00 0000C0 !00@S 00FS00 0070C0 00`S 00fS00 00W0C0 0p020 000 00/S 009S00 0000C0 !00@S 00FS00 0070C0 00`S 00fS00 00W0C0 08020 000 00/S 009S00 0000C0 !00@S 00FS00 0070C0 00`S 00fS00 00W0C0 00K/H- M $ $000 00 $00"S 4$  0,0  0\S000 00"S 00S 000 0S\40  3/ 0S0$000 0 0 00\S 0   000 00b0CS,///,///////-/// -/8-P- 0  0 0 0 0 00 000 07 S:0 S:0S 06 S$:07 S!*000\S000uS}00p 000 07 Sr:0 So*0;#;%0;#;080 00 0S00 0 S*00 0S*00 0 0 0 00CS=h/,/.. 00C 0 00?00<<  0 0#30 00C 0 00?00<<  0 0#30 00C 0 00?00<<  0 0#30 00C 0 00 000  0 0 0 0  0   000 00"S 00S  0 00"S000 0  0 0Kh%*D#"H- M $ 00 00 00 00S 00S00"S 00\S00 00 000 00S0S0  00c0 $0S 00$ 30  3/ 0S00 0 0 "  m0 0" 00 0 0 0S$0S $a 4303/ 0S0  3 0 i0 00 0[%m0S 000 0[S000 000 000K0[S 000 0S$0S 00$ ,20  3/ 0S0}0 0 00 0 " d00S00"S 00\S 0   O 0 \ 0  00K0[ S! S S/ S! S 0"S \S S ) 0 \ , 0 " & 0 b 0 f  0 n  0 r  0 t 0[ h l 00 0 00S 0 " 0 0KD#"""H-M  00 0K- M 000 0S 00S 00 S0K/H-M   00 0 0S0%0  0S 00S  00S 40  00S 0  0Kh%*H-M  0KH-M  00KH-M  00KH- M  00 0 0 00 0K 0KH- M  00 0 0 00 0K 0KH- M  H00 3/00 0 0 00 0K o0KD#H-M  0S0Y h h0S0 00L 8 h0S0 00?  h0S0 0  00/ 00"S v0& 00-S 00/S 009S h0 00[S 0 00{S 0 0  0K褨"""h%*H-M   0 00 0S00S[ 0 00S񟗆:(;:p;;;;3 0S  1 0 g<;! 0S  1 0 {g*) 0S  `1 0 ig= k  0  0 00 00S*<(<<8<L<`<|<5 1 -   9  0z  0 0K褨"""H-M  00[S |1  0X0 00 00]S00I3 0  00S0>00 0S0/ 0S0'0  0  00 0000 0S000,S 00]S000  0Kh%*H-8M0 4 8 <0 00 00 0000 00 00 0 0 0$0 000 000 0S0S<0S < @503/ 0S   5 0 of0;<0So <000 < 0S0, 0[ <00 <0 0000 :4008 <0< <0 00S' 80S 000 00< 0S0 0 , 80S 0 0 <0 0 <0 000 0S 0S < 0S0 0 ] 0 <0 000 (30 !3/( (0S001( |h0000 &4008 0!, 0  1( 0,  ,0S ,f 80S 00 0000 0 0 000 0S 0S 0S20 3/ 0S0 0 0S 00 01( 00S 10 !( 3/000  0Rx10(3/0T0[ 00 0 0 00 501( 00?f$ 01( 00 $ ie $00 0 0 C0R 0 , 80S 0 0 00 !( 3/000  0RH00(3/ 0 ] 0 0KD#"H#H-M  00{S 2  00 000 00}S00H 0  00S000 0S0q0 0 0  00:S 1  0a0000 0S0P@ 0S0H0  0  00 000F0 0S0/0 0 0  00:S 0  0000s0 0S000,S 00}S000  0Kh%*H-LMH L P T0 000 040 00 00 00 H00$0 0(0 0,0 080 (00(0 $00$0 $0S(0SJT0S P0S L000T l: P0S L0002/ 0S000 0  { P0S 0  00 0  000 L0 C0R0  } 0  0]T0S T000 P0S 000 00T 0S0E0  { P0S 0  0 T0 0 T0 H00$0 L00L0 P0S TLj 0S00 0 0  00 0 L0RT0 L0 T0 $0 0TTk T0 P0S 000 T; 0S00  : P0S 0  T0 0 T0 $LP T0T> T0 P0S000 $00S00000 00T 0S0$00S 0  , P0S 0  0 T0 0 T0 $00$0 $0SnP0S L000T 0S0P0S 00 0  000 L0 C0R0  } 0 T0 000 e50( !3/0 00S0Zp50( !3/4 40SL5003/0J(010 e(014 eH00$0 L00L0 P0S  L000 98014 @$0 0< <000  10 @$LP 0 @ @00<0S @0S @c@<c0 P0S L000 0000 0,0 $00$0 $0S,0S30 3/ 0S0,0 ,0S3 00 "014 00S l30 !4 3/010 00S ,30 !0 3/000  (0R2043/2003/00{ 000 P0S 0  0 00 pP0S 0 0 0  00 0 L0R014 00b8 014 008 &b 8000 0  : P0S 0  010 00 f010 00b0 00 (0 C0R 0  , P0S 0  0 10 !4 3/00 !0 3/000  (0R0043/0003/P0S 00 0  000 L0 C0R0  } 0  0KD#H#-M 000 0 0  00 0 000 0S 0K/-M  0S0000 00C0 000 0S 0S0K/H-M  0S0000 000 0S 0 00S0K- M  0  0  K/H-M z 0S0( 5a0 0 0,0 0  0 0 0KH-M  0S000 0S0S0  000 0S 00SKH-M   0S 0S0 0S 800  3/  0 KH#H-M   0S 0S0 0<S 0 0S D00  3/0  0 0,0 KH#H-M  c0KH-M   U0  K-M  000 000 00C0 0S 0S0S0"00S 00  00S 00   0 0R0 0 0 0 0 0K/H-M   0KH-M  00 00 0 000 00 0 0S 0 00S 0S 00KH-M   0aKH-M   000 000 00C0 0S 0S0S0  0 0 0  0 0R0  00  KH-M   000 000 00C0 0S 0S0S%0 0 0 0 00S 00  0 0R0  00  0  0 0 KH-M   00 00 0 000 00 0 0S 0 090S 0S l 0  KH-M 0S 0 0KH-M 0S 0 0KH-M 0S 0 0KH-M v 0S 0S000 0 0KH-MKa 0S 0 !K!K- 0 0KH-M I 0S 0  0 0KH-M5 0S 0 0KH-M& 0S 0 0KH-M  00 0 0  00 01 00@ 0 0S0   h0 0 000 0S  0R0KH-M  00 0 0  00 01 00 0e 0S0   30 0 000 0S  0R0KH-M  00 0 0 m 00 01 0 4 0S0   0 0 000 0S  0R0KH-M  00 0 0 < 00 01 00 0S0   0 0 000 0S  0R0KH-M  0 0 0S0eC 0S0^0 0,0 0 0 0!!00S 00 0 00S30>0 0S 0 0 0 0 0S 0+0S0&000  0S 0 0S 0  0  0 0 0  0 0 000 0S0K-M 00 00 S000 00 S000 }00 S000 u00 S000 m00/S000/S 000 00S 00 SW00/S000*S000 00S 00*S000/S000 900"S-0    00\S0    0    00S 00"S0    0    00Sm0 K/H-M 003/KH#H-M  00 0 0 0S000 0 00#11 0  u  0S0 0  0  0 0 0KH-M 0S0b 0KH-M    0 00c0Ca0KH-M   0 00cO0KH-M 0S0 00 00 0KH-M 0S0 00 00 0KH-M 0S 00S0 0d  000C᛼0KH-M    00c0   0S0KH-M    00c0  k 0S0KH-M 0S0 00 00 0KH-M 0S0 00 00 0KH-M   00 0 0 0S 0 0S 050  0R00 0S&0 00 0 [0 00 0020 0 00 0  00c0 0 00 0S 0KH-M   00 0 0 0S 0 0S 050o  0R00 0S&0 00 0 y[0 00 000 0 00 0  00c0 0 00 0S 0KH- M  00 0 0 000 0S 0 0S 0? 0R0720 00    0R 00 0S"0 0 0 [ 00 00ዻ00 00 0 00c 0 0 00 0S 0KH-M  00 0S 0S0X  0R00 0S00 00 00O0 0 0KH-M  ] 0S0_0Kn Q]08K\0 0K0 lH!H1[0K0x[000 0K0*]0K 0  5Z0S00 *0K0L\0S00 0Kn ]08K0K0}^K[000 0K 0  xZ0S00  0 6Z000 \0Z0  0KȨ"Ш"H-AM M  04  [000 0 S:`^0R;K 0C0C+\8p 0S$]0@;K 0C0C K 0Z Z ;K 0C0C0 &Z0 ;K 0C0C^ 0R Y0@Y00]0x ]$\0;K 0C 0C 0Z0S \0\4Kب""""H- M $ 00 0 00 00 0 0 0$0 0(0 0,00 0 $0 $00 $00 $0 0 $0$0 $0(0 $0,000 $0 000c0 $0 000c0 $0 000c0   0R  0 00d  00c00 00 0KpH-KM  10 AZ 0S00 kYG?K [ 00`P @$(,GK`P@  [ZKp<"H"#L"d"H-FM 10 Z 0S00 0YC?K p[ 00CKXy[C?K b[ 00CK k[ ZK|"H"#""H- M$0K [$0K0S   00cd 0U00 00 0KH-hM80K0 [h0K0 [80K[Xh0KV8 Kh0K 0S00 0K- M00Kd009#9X [H00 <0 40 4000c S00)C0 K/pe*l%*le*H-M 00 LY0  000S[ 00cKte*H-M  00 0 0 0S 0S0&^Y00 0 0  09#9x00 00 0 000 T00R 0 C0R$[0 0 0Kte*le*l%*pe*-M 00 0 0 00/S 000 00 0 0S 00S0K/- M l0K@00 P0?c0100c 0 0!K 00K/"gfff- M (0##!010 c0 K/L#0-I-GMd h l$ 00 h4S 0SnA>K0C0C+ZE>K0C0C ~Zh d4S0d4 l10 d4R*QE>K0CXX4P4 -K B B=K0C0CY0\4 1d$QDDHLtT4 B#?`cd4{ 0S  A>K0C0Cp`  l$  0Z A>K0C0C  0;c \4Z 0"0KA>K0C0CA>K0C0C,,[KIЍ/L#P#Mb""D"H-M0 0 00  010b1P 0 0 0W 0  0 0 000 06S0Ke*H-M0 0 00 00 00 . 010b1 0 0 0X 000 000 00( 0 00S 0  0\Z 0X0 0 00 00 000 06S0Ke*H- M  $0  010b1`!0 0 00 00 0W 000 00 W0S  0"ZX 00500 0R00(00 00S,q 0S  0Zxd x000 Y0$ $ 0  0 0( 0  0Y0Ke*L"""H-M   010b1 0 0 00 00 0oW 000 00 8W0S000 00( 0 ' 0Y000(00 00S 0Y 0e0Ke*L"Ȫ"H-M   010b1 0 0 00 0*W 000 0$0S 0000 |0;0$0 3/0000@ @0+0(00 0S 0[Y0Ke*L"""H-GM00 00 t20S 0``V 0SU00Y0," 0$2 20~G?K,XG?K &X0S0@U00{Y0@09 1KG?KV0S00t> x1=G?K0TB \11[#S1G?K@Y0S 00 '0 S0S ! QV00 0 1SS 0 0 1G/K< U000 #W0S LU 0S XCYP@Y0S00Kk*P"p"t""Ы"""8"X"|""H-`MP T X 00 P0S T0S,p (1U0C7 0S 0<L0K@ WL0K L0KP2 V0 0 "0 10 020 !L0KX0S t0 !T0X3/0S00 00 0 0S(0 1S0Kt""Ĭ"k*"H-(M  $0 00 0S 0S 0S0VGX 0S 00000 ,10DU0 0 0 00S00 001 "X 0S 00#  00c0 $0 C0R $00C  0X d0$00C0 0   V0 0 , HX0Kt"̬"""" "H"H-M  00 0S 0S080 0u0S  0u0(00 0d0S  0d0xt 0U0S 0 XT 0K0S 0,0 @ 0KT"t"\"p"|""k*"k*H-M  00 0S 0S 0,0" 0 0 *T0T0 @0T0@0cL 0S  (0 00Kt"""ȭ"ԭ"H-M  00 00 0 0 0S 0Sl h000KX 00S , 0000 0Kt""""H-M |0@0S h0 0 S0 @0 0 S 0@ 0@ 00Kk*H-M  00 0S S:S `D 0VTT & DD   44  0Kk*"""- M K/-K/H-M T0KH-M   #S0KH-M VKH-M W0K-K/-0K/H-M  0S0S0'0  0100 0Sd" `000  0  0 0 001  0 0K$"`"H-M 0S K-M   0 0S 0 0R00S 0 00  0 0S 0 01 0 0K/- M  0S00 0R0 0R0 0 0R 0 0R0 0R00K/H-M  0S0 0 00E0 0 0K- M 0S000K/- M 0S00 0K/H-M 0S00 0 000 00R0 0 0 000 0 0 0KH-M 0S00 0 0R0 00 00޲0 0 00KH-M 0S0 0 00 00 c00ῲ0KH-M 0S00 00 0 00c C00ᤲ0KH- M  00 00 00 0S 0 0R0 0S0P  K0K  0S0   0 Q0  H0KH- M  00 00 00 0S 0 0R0!x0S0  K0K  0S0  0 0S0 {Q70KH-M 0S 0QKI-TMP P0HKPTHD@< 8040p,`(P$@ p` P@K0 0 0  10cS0%10/S 10S 0 1[S >K 0S 1 0 000 101 !0R: 0KH-xMx 00 t0Kh Mt0KxL 0Sd09S 00K/00K$""H-M 00 0 0 00 K 0S10!10e>K,MN 00NN0S 00hFN0S= 00H=N 0S3 0 >K !1K>K 0S >K 0S L0'0S >K 0S L0>K0`.t00N 0SL 0S 00K$"A""""""H-M 00 0S0j_K 0S10!1s0[Q1 000000SFT0K@ L0K@ L00T K  ]MT0K M 0ST0K0.0D$0K? sK 0SZL0KM0S00M0xM00M  (N@L N 0S L0Kб"$"ر"#"""H-M T K@0 L K@0 L00 ,J 0S10  ! 10:00 000000S%00T K2 LT0KJ 0S0K M0K!M0SWK003M OK M 0S K0Kб"$""#"0""-H-$M 0 0 00 0S 0S!108JJ 0S XI00M00z/0z0#0K L00  I 0S;I00L0  08H H0[ J0 J0KH Ѝ/$"4"H"L"d"H-BMM  00 0 0 4S 4Stt!t130UA>K0C+KLI 0S40(!(10?I 0S40 0 0/0A.K B 0H0 0 0SH00L0$   0\".t0 A>K0C+0J00 0SvJtJ0K$" "0"|"H""H- M   00 0S 0S/00$wI 0S00px x000 0BJ00 0S00 /,0 .J0K$""0">|""H-M 00 0Sxx x0~0H 0SHH00 L0  0 /$0h00K$"V"IJ"H-M   ZL(I00C 00/S I0  H0 0 HH H00 05Kܲ"$"q"H-bM 00 0 0 00 1S/10e_?K,J|0Kh J|0KI 0SPT!T10Ll0: SoDl0: S@H 0S10 002( 0 _?K 008K0S 000K0S_?K 0S Lh h00 _?K-HK 0SI0K$""""""8"H- M   00 0 0 0S 0S 0S/00(KH 0S00 000 0I0 0 0S 000 -<0lI0H 0K$"X"0"h"|"H- M   00 0 0 0S 0S 0S 0D0(G 0S00 0400 0 G0 0 0S 000D D0 H0H0K$"X"H"h""H-M 00 0 0 0S 00S 00tG 0S00D/L00  INJ wH 0K$""0""H-MM J 80 0;K0C0C+\I+XI0S1.00;K0C0C H;K0C0C0S ;K0C0C@FF0S (H0K0"$" ij"k*г"H-M  0Spp p00 0S 0 S<D D0r08CG0( rF0K$"!"& "k*0H- M00 0K5F 0S 00 ?@0P0 ?$ 0z 0 0 K0@BH- M   00 0S 0S0$F 0S00t/p000 0G00 0S00$( (0 G0K0"$"|"N"H- M   0 00 00C 00/S00C0 00C0 0S0S0< F 0   0F 0K蠱"D"H-M  $ (! ,1 G/K< QH00 00 00 G?K$! ! 1F 0 S00/10iG?KUF 0S cE00%I00px!x10S,00 0 0 "0(! 0 0fE00  0R 0000 0cF0/ 000 00 0 0R,100 0(! 0 09E00  0R 000049.D06F0F0KL"$"T"x"~L"|"-$M  00 0 0 0S 0S00   00 0K 0R( 0 0" ["!  0 0x" [ " 0 0= 0 0= 0   000K 0R2 0 0! ["!  0 0! [  [""   0 0d! [ ! 0 0= E0   000K 0 0  ["!  0 0  [  [""   0 0|  [  ["#   0 08  [?   0RG 0K/d#-$M  00 0 0 0   004"0 0K 0R0[s 0[s{0   00!00K 0R0[s 0[sg 0 0 [! [0 B"    0   000K0[=S 0L0[8!00K 0R0[s 0[s< 0 0 [" [< B!    0   000K1[=S 0!1[ 00K 0R1[s 1[s 0 0 [#  [    0Ro 0K/"H-M  00 0 0 0S 0S0tD00 0S0y00 l0 00/S 0 009S0 000 0 P0 00@S 0 00JS0 000C 0 =0 00JS 0 00ZS0 000 0 *0 00`S 0 00jS0 000 0 0 00jS 0 00zS0 00 0C 0 0 00 0 0 0   000  0R0 0B 0KH-M  00 0 0 0S 0S0C00 0S0~00C 00BS 0u00 l0 00@S 0 00JS0 000C 0 P0 00/S 0 009S0 000 0 =0 00`S 0 00pS0 000C 0 *0 00pS 0 00zS0 000C 0 0 00JS 0 00ZS0 00 0 0 0 00 0 0 0   000 0 C0R0KH-jM  ! 1 1@Sf?Kf?K! Kf?KF0K1 01 d0K00 !00060# 1K0 000  1R:10 1 K 06 000 0?Sd KO?K@ d0K! Kd0K 0K00 !000\0# 0K0 000  1R:10 0 K 0\ 000 0?S KO?K@ w K0K q K0K00S 1 #0 00 K AK- M 0 0  00  0( 0  0  K/#EgܺvT2H- M  00 0 0 00 001?0 0 0@0c0 0 01 0 0 01R*00 0 0 0> 0 0R$: 00 0 A0 0000 0 000@00 0@ 0R0 0 00 00  0 00c fAKH-M  00 0 0 001?00 07S080c0x0c 0 0 K 8 v0K q00 Kh#-M   00 0 0 3  00 !  00 0 ! "$  00 0 ! "(  00 0 ! ",  000 00 0 0R:K/-M   00 0 0 $01 0     $   (   , 000 00 0 0R:K/H-FM  100 10 0 100 1 00 E?K@ 0  000 1 0 ?00 0<0   000   0 000 1 0 ?00 0c:0  000  0 0 00 1 0 P?00 070  000  0 000 1 0 >0 0 0c5 0 00 0 0  000 1 0 >00 0<0   000   0 000 1 0 T>00 0c:0  000  0 0 00 0 0 >00 070  000  0 000 0 0 =0 0 0c5 0 00 0 0  000 0 0 X=00 0<0   000   0 000 0 0 =00 0c:0  000  0 0 00 0 00);CO0C0 070  000  0 000 0 0 X<0 0 0c5 0 00 0 0  000 0 0 <00 0<0   000   0 000 0 0 ;00 0c:0  000  0 0 00 0 0 \;00 070  000  0 000 0 0 ;0 0 0c5 0 00 0 0 000 1 0 :00 0=0   000  0 0 00 0 0 `:00 0;0  000   0  000 0 0 :00 0c90  000  0 000 1 0 90 0 0c6 0 00 0 0 000 1 0 d900 0=0   000  0 0 00 0 0 900 0;0  000   0  000 0 0 800 0c90  000  0 000 1 0 h80 0 0c6 0 00 0 0 000 0 0 800 0=0   000  0 0 00 0 0 700 0;0  000   0  000 1 0 l700 0c90  000  0 000 0 0 70 0 0c6 0 00 0 0 000 0 0 600 0=0   000  0 0 00 1 0 p600 0;0  000   0  000 0 0 600 0c90  000  0 000 0 0 50 0 0c6 0 00 0 0 "0 "1 0 500 0c>0   000   0 "0 "0 0 8500 0:0  000  0 " 0 "0 0 400 0c80  000  0 "0 "0 0 40 0 04 0 00 0 0 "0 "1 0 `400 0c>0   000   0 "0 "1 0 400 0:0  000  0 " 0 "0 0 300 0c80  000  0 "0 "0 0 30 0 04 0 00 0 0 "0 "0 0 @300 0c>0   000   0 "0 "1 0 200 0:0  000  0 " 0 "1 0 200 0c80  000  0 "0 "0 0 h20 0 04 0 00 0 0 "0 "0 0 200 0c>0   000   0 "0 "0 0 100 0:0  000  0 " 0 "0 0 100 0c80  000  0 "0 " 1 0 H10 0 04 0 00 0 0 0 0 "1 0 000 0c=0   000 0 0 0 "0>xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ 0 P000 0c;0  000 0 0 0 "0 0 000 080  000 0 0 0 "1 0 00 0 05 0 00 0 0 0 0 "0 0 4100 0c=0   000 0 0 0 "1 0 100 0c;0  000 0 0 0 "0 0 100 080  000 0 0 0 "1 0 20 0 05 0 00 0 0 0 0 "0 0 d200 0c=0   000 0 0 0 "0 0 200 0c;0  000 0 0 0 "0 0 200 080  000 0 0 0 "0 0 H30 0 05 0 00 0 0 0 0 "1 0 300 0c=0   000 0 0 0 "0 0 300 0c;0  000 0 0 0 " 1 0 ,400 080  000 0 0 0 "0 0 x40 0 05 0 00 0 1 0 1 10!   10!   1 0!   K-M   0    ""  0  P     00 0 0 C S0 K/ᨻ#-H-xMx0K0 0 0 0 0 x0K  0 00 0Sx K0K_0K 0KHЍ/H-`M` d \0K0 d@ :`00 0 `000 `000 `0 00 `000  0 "0 0"00c4( 00c<4< 0 00 0= 0 ?00 0c10  0 " 0 0"00c4( 00c<4< 0 00 0= 0 p?00 0c1 0 0 "0 0"00c4( 00c<4< 0 00 0= 0 >00 0c10   0 "0  0"0 0c4( 0 0c<4< 0 0 0 0= 0 `>00 0c10  0 "0 0"00c4( 00c<4< 0 00 0= 0 =0 0 0c10  0 "0 0"00c4( 00c<4< 0 00 0= 0 P=00 0c10  0 " 0 0"00c4( 00c<4< 0 00 0= 0 <00 0c1 0 0 "0 0"00c4( 00c<4< 0 00 0= 0 @<00 0c10   0 "0  0"0 0c4( 0 0c<4< 0 0 0 0= 0 ;00 0c10  0 "0 0"0$0c4( 0$0c<4< 0$ 0$0 0= 0 0;0 0 0c10  0 "0 0"0(0c4( 0(0c<4< 0( 0(0 0= 0 :00 0c10  0 " 0 0"0,0c4( 0,0c<4< 0, 0,0 0= 0 :00 0c1 0 0 "0 0"000c4( 000c<4< 00 000 0= 0 900 0c10   0 "0  0"040c4( 040c<4< 04 040 0= 0 900 0c10  0 "0 0"080c4( 080c<4< 08 080 0= 0 80 0 0c10  0 "0 0"0<0c4( 0<0c<4< 0< 0<0 0= 0 800 0c10  0 " 0 0 "040 0!00!000!000 0= 0 t700 0c1 0 0 "0 0 "080$0!0 0!000!000 0= 0 600 0c10   0 "0  0 "0<0(0!00!000!000 0= 0 \600 0c10  0 "0 0 "00,0!00!0 00!0 0 0 0= 0 50 0 0c10  0 "0 "0000!00!000!000 0= 0 P500 0c10 0 "0 "0040!00!000!000 0= 0 400 0c1 0   0 "0 "0 080!0 0!000!000 0= 0 H400 0c10  0 " 0 "00<0!0$0!000!000 0= 0 300 0c10  0 "0 "000!0(0!0 00!0 0 0 0= 0 @30 0 0c10  0 "0 "000!0,0!0$00!0$0$0 0= 0 200 0c10 0 "0 "000!000!0(00!0(0(0 0= 0 8200 0c1 0   0 "0 "0 0 0!040!0,00!0,0,0 0= 0 100 0c10  0 " 0 "0$00!080!0000!00000 0= 0 0100 0c10  0 "0 "0(00!0<0!0400!04040 0= 0 00 0 0c10  0 "0 "0,00!00!0800!08080 0= 0 (000 0c10 0 "0yZnܼ "0000!00!0<00!0<0<0 0= 0 l000 0c1 0   0 "0 "040 0!00!000!000 0= 0 000 0c10  0 " 0 "080$0!0 0!000!000 0= 0 t100 0c10  0 "0 "0<0(0!00!000!000 0= 0 10 0 0c10  0 "0 "00,0!00!0 00!0 0 0 0= 0 |200 0c10 0 "0 "0000!00!000!000 0= 0 300 0c1 0   0 "0 "0040!00!000!000 0= 0 300 0c10  0 " 0 "0 080!0 0!000!000 0= 0 400 0c10  0 "0 "00<0!0$0!000!000 0= 0 40 0 0c10  0 0 00 000!0(0!0 00!0 0 0 0= 0 500 0c10 0 0  00 000!0,0!0$00!0$0$0 0= 0 500 0c1 0   0 0  00 000!000!0(00!0(0(0 0= 0 D600 0c10  0 0 00 0 0 0!040!0,00!0,0,0 0= 0 600 0c10  0 0 00 0$00!080!0000!00000 0= 0 l70 0 0c10  0 0 00 0(00!0<0!0400!04040 0= 0 800 0c10 0 0  00 0,00!00!0800!08080 0= 0 800 0c1 0   0 0  00 0000!00!0<00!0<0<0 0= 0 (900 0c10  0 0 00 040 0!00!000!000 0= 0 900 0c10  0 0 00 080$0!0 0!000!000 0= 0 P:0 0 0c10  0 0 00 0<0(0!00!000!000 0= 0 :00 0c10 0 0  00 00,0!00!0 00!0 0 0 0= 0 x;00 0c1 0   0 0  00 0000!00!000!000 0= 0 <00 0c10  0 0 00 0040!00!000!000 0= 0 <00 0c10  0 0 00 0 080!0 0!000!000 0= 0 4=0 0 0c10  0 0 00 00<0!0$0!000!000 0= 0 =00 0c10 0 0  00 000!0(0!0 00!0 0 0 0= 0 \>00 0c1 0   0 0  00 000!0,0!0$00!0$0$0 0= 0 >00 0c10  0 0 00 000!000!0(00!0(0(0 0= 0 ?00 0c10  0 0 00 0 0 0!040!0,00!0,0,0 0= 0 (;0 0 0c10  0 "0 "0$00!080!0000!00000 0= 0 :00 0c10 0 "0 "0(00!0<0!0400!04040 0= 0 $:00 0c1 0   0 "0 "0,00!00!0800!08080 0= 0 900 0c10  0 " 0 "0000!00!0<00!0<0<0 0= 0 900 0c10  0 "0 "040 0!00!000!000 0= 0 80 0 0c10  0 "0 "080$0!0 0!000!000 0= 0 800 0c10 0 "0 "0<0(0!00!000!000 0= 0 700 0c1 0   0 "0 "00,0!00!0 00!0 0 0 0= 0 700 0c10  0 " 0 "0000!00!000!000 0= 0 600 0c10  0 "0 "0040!00!000!000 0= 0 60 0 0c10  0 "0 "0 080!0 0!000!000 0= 0 500 0c10 0 "0 "00<0!0$0!000!000 0= 0 400 0c1 0   0 "0 "000!0(0!0 00!0 0 0 0= 0 x400 0c10  0 " 0 "000!0,0!0$00!0$0$0 0= 0 300 0c10  0 "0 "000!000!0(00!0(0(0 0= 0 p30 0 0c10  0 "0 "0 0 0!040!0,00!0,0,0 0= 0 200 0c10 0 "0 "0$00!080!0000!00000 0= 0 h200 0c1 0   0 "0 "0(00!0<0!0400!04040 0= 0 100 0c10  0 " 0 "0,00!00!0800!08080 0= 0 `100 0c10  0 "0 "0000!00!0<00!0<0<0 0= 0 00 0 0c10 `0 0 `0 `00`    `00`    `0 0`    `00`    00 00 00 00 0 0 Kܼb- M 0X 0P  0H  0@ 08  0  0 0 K/#EgܺvT2H- M  00 001?0 0 0 01 0 0 01R*00 0 0 0> 0  00?S$ 00 00 @ b  V/ 00  000@00 0? 0R:0 0 00 00 0 0 00c ,/KH-M  00 0S000 0! 0 000123  0K0 000 0S r  m00~? S0K c00  00 "    !1"  000 0S00 00@ f10 a100 [10K V1 00K脵""H-pMh l p p0S@0p0 `0K`0Khl `0Kpvp0Ks*H-4M0 4 8 401C10 000 0000 00 1 0 44Ҏ00$0 $0 0 l0#10(0 400C0 401C10 000 010 0 !0   !   " , , @(  $!8@ @  $   b 010 000 00C0 0S401C10 000 00 001!0020 0 0(00,18000,00! c00 0000   00c0 0SKy7H-4M0 4 8 401C10 000 000 0 00 2$0 44@000 u $000 0#10(0 00 40010 00 0 010 0 !0   !  " , , @(  $!8@ @  $   010 000 000  400CR:000 0 401C10 04 !B!0   !  " , , @(  $!8@ @  $   401C10 000 0 C SKy7H-M  00  0KH-M  00 00  G0KL"0H- M 00ᱎ@P008C8ᩎ 0,q0 0֎ 0 K0$@H- MK K 00S 0$00 0&01 00KK!K0S 0& 0! 00 000 021 0R0K@@H-,M  "KK 00S "K  -+K 0ݏ0S G0 0K00 K 0я0S M0 0Kp00 k0 0K?0 @. 0K 0 [  -K@@l"eAʚ;.A@Bp"H-@M0 4 #K00S =0:00K(0K #KK 0勏0S 4 0[(K0h -0S 4 0[(K04 -4 0[(K0 {-K@@x"""H-M   0  00 0R0!b-m0;S= 0S  1 0 @,\ x1 0 6,000 00 00S 0  (!0 ", 1 0 ,000 000  0R+00 /000 00 00S 0  p 0 +0 00D .000 000  0RK谼"""ļ"ȼ"H-4M $ ( (H 0!KK 0Վ0S G0 0K00 K 0Ɏ0S M0 0Kh00 k0 0K?0 $@& 0K 0 [   ,KeAʚ;.A@Bм"H-8M( , 0 40 0S 000S0000S 0000S, 0000S =0:004,(8$, 0( 0(0 , 00c,0 0000K0C0CG)I>K0C0C0 G>1K01K(0K#0S0I>K0C0C0 1[KS*0 !01SI>K0C0C/ 'O)I>K0C0C '4.I>K0C0C 0 &4( I>K0C0C0 &44 I>K0C0C0$ &4 I>K0C0C08 &4 I>K0C0C0 &4 I>K0C0C08 &40 I>K0C0C> &`10SM41 SD10<$o),10,H &10 &41S0 41$W)00 Q)00 u&41 S4!41R*t0 41x$9)T0 41\ 1)400L U&0 0K t*#""H"h"""@""H-MH 00 0 0 ?K/( 0S0?K H  0S 02[0 0KH-M    (0  0  0 KH-8M0 4 8 00 0 0 00 000 000R0;0004 &400S0/400# S*400C 0  t00St0  x00 020b2>C 0t  |x00 020b2>C 0 t00W&kh0K! $t00S t00S t0 t00hK D"t00S' t000Sx00 020b2>C 0t000h K )%9x00 020b2>C 0 h0K&)x00 020b2>C 0 4 0 "t00S t0 t00hK !t00;8#(t0 t008#88C8Sx00 020b2>C 0 x00 020b2>C 0 x00 020b2>C 0 x00 020b2>C 0t  p00Sx0  x00 x0 x00 020b2>C 0t  x00 020b2>C 0 x00 020b2>C 0 0 0 t00 0 t00$0  0 000S S m0(0 0  (0K$ 0 000S(0Sx00 020b2>C x00 020b2>C 0000A 0 000S(0Sx00 020b2>C x00 020b2>C 0000 0 00S(0Sx00 020b2>C x00 020b2>C 0000 00 000 0 0 $0 C 0RzK/!+("0"H-M M  $ 4 0 0 00 :0 @40 ?K 00?0$0 $0S 2[ S30$z#003 33 e?KO/B#0H0 04K04KX0K#70Si 00S 0S `3@_ 00!$0L$M#003 3 0c0 G>K 0C(0 00 (0 000 0S0,0 ,0 G>K 0CK 0!0 00S, 00 S ' 00Sl`20l = 000Sa0X 4 40S 0S #20  ""0u400 0H0 04K08#84KX0K!0S500S2[S 4[ 0Rڴ4[0 000 00 S 03 P13 3 0c0 0S{j#0@00#0$"0-4[S"e03 03 4[/K 2[K/K 8 80SKK/K?K$ 80S Lg#/#0K#@"p"""`"""H-IM M  $ 4 0$0 00 :0 40 00 =>K Y00?0(0 (0S 2[ S440,$K"003 43 f?KO/"0L0 04K04K\0K#0S:00S$0S 3@000"0$"003 3 0c0 G>K 0C0C,0 0 0 ,0  00 0 0S000 00 G>K 0C0CK 0q 4 40S00 S 00Sl20 040Sa0'8 80S 0S {"020<<"!0800 0L0 04K08#84K\0K!0S500S2[S 4[ 0Rڸ4[0 000 00 S 03 13 3 0c0 0Sy9"(1@00V"0,$!094[S.c04 03 4[/K 2[K/K < <0S KK+K=>K($4R<0S 40C0 L*"!0K#@"p"""t"""H-KMM  $ 4 0$0 00 :0 (50 00 %?K0(0 0#K>>K 00?080 80S 2[ S40$!0# (0R(000S000 Cl4! K 00X$ ?#K03 @43 j?KO/ 0\0 05K05Kl0K$0S00S$0S 3@00!0$ 003 3 0c0 I>K 0C<0 0 0 <0  00 0 0S0@0 @0 I>K 0CK 0D D0S00 S 00Sl20 0D0Sa0H H0S 0S !\20pp"m 0H00 0\0 05K08#85Kl0K0"D0S5a00S2[S 5[ 0Rڸ5[0 000 M00 S 03 13 3 0c0 0S{ T1@700 0`$% 0C5[S8e04 04 5[ ;K 0C0C 2[ ;K 0C0CKA+L L0S;K 0C0CKAA.K B>K8 0C$4RL0S R40C0 X  0K$"#@"p""""""H-M | 0S0 0g0KH-M   00 b 0S0  0. L0KH- M   0 00 F 0S0 00  0M .0KH-M  0S 00  A   3/) 03S 00  G   3/ 0=S 00   B  3/ 0 0>S+0/0 2/KH-M 000 00 0 000 0C100" 0C2000S 00!0C3000S0?0K-M   0  0  0  K/H-M   0 0 00 00    00 00S0  000  0R:KH-M 00S 00 0 000c y00 00  =3/000 00 c0RK-,M $ ( 0 0 00 c0 000 0 $0R00 0000 0 $0R00 0000 0 ( 0`! B! 0 ( 00!   B"  0 $0R 0 ( 0    B#  0 $0R 0 ( 0  ?  000  $0R 0 ( 0= 00S 0 ( 0 K/л#H-(M $ ( 0 0 00 c0$ 000 0 (0R00$ 0000 0 (0R00$ 0000 P1 0C100 @ 00 0 1 000C2000 0 00 0 0 (0R0 000C3000  00 0 0 (0R x0 0?000   00 0 000  (0R=  00 0 00SKԻ#- M00K0[0 0K/P"H-M   00 :000 00C0 0[S[ 0[SX 0  [! [""     0[SF0  [" ["!     0[S40  [# [   0S&000 0K 0[S 0000 0K 0[S 0000 0K 0[S 0000 0K 0[S0  00cKH-M 800S,0 0 00 Kt*#"-H-M0 0 00 L000 0H0S 0 00R*00   i .00KHЍ/t*- M 0  K/t*- M 0  K/t*0H- M0K%0S 00X{@P0S{ 0 40| 0z 0!K!K K0耄.A- M 00 000cK/- M 0 S 0 S 0 S 0 S00K/H-M 00 0 0 00R*0000SKH-M 0 00R*0000KH-M    0R00 0 00s00KH-M    0R00s00K- M 0`S0zS0@S0ZS00K/- M 0/S09S00K/H-M 0S 0`S0fS0@S0FS00KH-M  00"0CSS񟗃,wHwHwHwHwHwHwHwHwHwHwHwHw,wHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHwHw,wHwHwHwHwHw,wHwHwHw,wHwHwHwHwHwHwHw,wHwHwHw,wHw,wv 0S#000}0S 000u0S 000m0S 000e0S 000 0S000KH-M   00S" 0 0 0R0 0S 0 00d00 0 02[ 0S0-0  0  00S 0 0S00 0 0R00 0020  0 0020  00 0 0K-M   00S 0 0S0# 0S0 0R00 020  "  b 0 020  B  b 0K/H-M L00S0600 [ 0S0*00 0 0 00R*000_S 000i0S000x0S00 C00 0K- M00K0[000+S 000-S00 0 0 00R:0'000(0S000 0 0 00R*0000S00 C00 0KH- M [ 0S08 000C  0S 0+ 000C0   0S0 {0,S 00 0 q0]S ] 0S0 00  0K-M   00 000  0R 0 0 000R  0R000K/H- M  $0  00$ D 0S0200   0R0)0 00 000R 0000   0R0 0 0 00 C00 j 0S00KH-(M( ( 0"0CYS񟗡̄ȅȅȅȅȅȅȅȅȅȅȅ8h( 0S 0GE( 0S0><( 0S053( 0- 0S0)'( 0! 0S0(| 0 0S 0($ $0S$00s000K"""H-M ) m0S  0S 00"S% 0S00s000KH-M  0S0: 0S 0 0S00KH- M { 0S08 000C  0S 0+ 000C0   0S0 0,S 00 0 0}S } 0S0 00  0KH-M 00 00S 0 00R*0>0 00R06{ 0S 0S 0'[ 0S 0S0000 t 0S00 00 0KH-0M( , 0 40 0K X,0( 0 0 (00 000 400 0K 0S00 (00cKH- M $ 0K 4$0 00 00 00 0Kp0S000 0K-M 00 000 0 00S 0 00[S 0 00.S0K/H- M $ 0 0 00 00 $ $00[SG 0 0S$0000S000 00 0$ 000S0 01000 0$ 0000C 00 000 0$ 00]S 0$ 00S0  $ 00]S 000  0 0S 0 00 0 00 R0s02 0 0S 0u 0R 0s02 0 0R02 00$ 0S 00C 00 +0 C002 0 0S 0 C002 0 0S 0 C002 00 00  000 00 0 00C 0R 00C 0R0 0$ 0$0 $00.S$00$0 $00S02 0 02 0 0 $0S $00S0KH-(M $ ( 0K4 (0 $0? K  0K"H-0M $ "KK"K 0 g $0? K  0K"-$M  $0 00 0 0 0 $0 00   0R*0" 000 0 00K0[ SN S S S] S1 "S \S Si   0R*0\ 000   0R*0" 000   0R*0\ 000   0R*0\ 000 r  0R*0\ 000   0R*0b 000 ]  0R*0\ 000   0R*0f 000 H  0R*0\ 000   0R*0n 000 3  0R*0\ 000   0R*0r 000   0R*0\ 000   0R*0t 000   0R*0 [ 000 0RF:  0R*0" 000   0R*0  00cK/H-M   0 0S0S 0S00 0 E 0R0 0 0KH-$M $ ( ,0 $0 00 00 ((00 0CtSPPPPPPX\PPPP 0R*(0 0 00 0   0 c,0, 0  0 0 0   0c,000 , $0 0 0 ~,0 , 00 ,0 , 00   0 c0  '0 0 0 g,0 , 00 ,0 , 00   0 c0  0 0 0 P,0 , 00   0@c0  0 0 0 <,0 , 00   0@c0  0 0 0 (  00c  00 0 0   00c  00 0 0   00c x 00 0 0 0(00(0 (00S 0R* 0 00cK""" -H-M  0 0  0 0KHЍ/H-M  0  0 0 0  KH-M 00S 00%KH-M  0 0R :0 0R0 0R00 0S0S 0  0  KH-M 00KH-M   0 00 0Sddd"d20 00RH8D"820 0R*($"200 0R*0u0 0 00R#0 000 0 000c 0S 0 00 -0 0 0 H0 00p 0 1p 0>r0 0 00  0S) 0  0 000 0 000c w0S 0 00 0 0 0 0  00 0K"""","?H-M   00 0B0KH-M  0S 0 0R:00 0 0 00c '0 0 c0 K- M  0 1c4( 0 1c<4<0 0 1K/H-dMh l `0Kl@ vh000 h000 h000 h0 00 h00 0  0 "0 0@"`0K0 0= 0 ?0 0 0c10  0 "0 0@"`0K0 0= 0 ?00 0c10  0 " 0 0@"`0K0 0= 0 8?00 0c1 0 0 "0 0@"`0Kw0 0= 0 >00 0c10   0 "0  0@"`0K_0 0= 0 x>00 0c10  0 "0 0@"`0KG0 0= 0 >0 0 0c10  0 "0 0@"`0K/0 0= 0 =00 0c10  0 " 0 0@"`0K0 0= 0 X=00 0c1 0 0 "0 0@"`0K0 0= 0 <00 0c10   0 "0  0@"`0K 0 0= 0 <00 0c10  0 "0 0@"`0K 0 0= 0 8<0 0 0c10  0 "0 0@"`0K 0 0= 0 ;00 0c10  0 " 0 0@"`0K 0 0= 0 x;00 0c1 0 0 "0 0@"`0K 0 0= 0 ;00 0c10   0 "0  0@"`0Ko0 0= 0 :00 0c10  0 "0 0@"`0KW0 0= 0 X:0 0 0c10  0 "0 0 ",@0!X0!`00!?`0 `0 0= 0 900 0c10  0 " 0 0 "(<0!T0!\00!?\0 \0 0= 0 p900 0c1 0 0 "0 0 "$80!P0!X00!?X0 X0 0= 0 800 0c10   0 "0  0 "`40!L0!T00!?T0 T0 0= 0 800 0c10  0 "0 "\00!H0!P00!?P0 P0 0= 0 80 0 0c10  0 "0 "X,0!D0!L00!?L0 L0 0= 0 700 0c10 0 "0 "T(0!@0!H00!?H0 H0 0= 0 H700 0c1 0   0 "0 "P$0!<0!D00!?D0 D0 0= 0 600 0c10  0 " 0 "L`0!80!@00!?@0 @0 0= 0 p600 0c10  0 "0 "H\0!40!<00!?<0 <0 0= 0 60 0 0c10  0 "0 "DX0!00!800!?80 80 0= 0 500 0c10 0 "0 "@T0!,0!400!?40 40 0= 0 ,500 0c1 0   0 "0 "<P0!(0!000!?00 00 0= 0 400 0c10  0 " 0 "8L0!$0!,00!?,0 ,0 0= 0 T400 0c10  0 "0 "4H0!`0!(00!?(0 (0 0= 0 30 0 0c10  0 "0 "0D0!\0!$00!?$0 $0 0= 0 |300 0c10 0 "0 ",@0!X0!`00!?`0 `0 0= 0 300 0c1 0   0 "0 "(<0!T0!\00!?\0 \0 0= 0 200 0c10  0 " 0 "$80!P0!X00!?X0 X0 0= 0 8200 0c10  0 "0 "`40!L0!T00!?T0 T0 0= 0 10 0 0c10  0 "0 "\00!H0!P00!?P0 P0 0= 0 `100 0c10 0 "0 "X,0!D0!L00!?L0 L0 0= 0 000 0c1 0   0 "0 "T(0!@0!H00!?H0 H0 0= 0 000 0c10  0 " 0 "P$0!<0!D00!?D0 D0 0= 0 000 0c10  yZnܼb0 0 00 L`0!80!@00!?@0 @0 0= 0 p00 0 0c10  0 0 00 H\0!40!<00!?<0 <0 0= 0 000 0c10 0 0  00 DX0!00!800!?80 80 0= 0 h100 0c1 0   0 0  00 @T0!,0!400!?40 40 0= 0 100 0c10  0 0 00 <P0!(0!000!?00 00 0= 0 `200 0c10  0 0 00 8L0!$0!,00!?,0 ,0 0= 0 20 0 0c10  0 0 00 4H0!`0!(00!?(0 (0 0= 0 X300 0c10 0 0  00 0D0!\0!$00!?$0 $0 0= 0 300 0c1 0   0 0  00 ,@0!X0!`00!?`0 `0 0= 0 P400 0c10  0 0 00 (<0!T0!\00!?\0 \0 0= 0 400 0c10  0 0 00 $80!P0!X00!?X0 X0 0= 0 H50 0 0c10  0 0 00 `40!L0!T00!?T0 T0 0= 0 500 0c10 0 0  00 \00!H0!P00!?P0 P0 0= 0 @600 0c1 0   0 0  00 X,0!D0!L00!?L0 L0 0= 0 600 0c10  0 0 00 T(0!@0!H00!?H0 H0 0= 0 8700 0c10  0 0 00 P$0!<0!D00!?D0 D0 0= 0 70 0 0c10  0 0 00 L`0!80!@00!?@0 @0 0= 0 0800 0c10 0 0  00 H\0!40!<00!?<0 <0 0= 0 800 0c1 0   0 0  00 DX0!00!800!?80 80 0= 0 (900 0c10  0 0 00 @T0!,0!400!?40 40 0= 0 900 0c10  0 "0 "<P0!(0!000!?00 00 0= 0 :0 0 0c10  0 "0 "8L0!$0!,00!?,0 ,0 0= 0 x:00 0c10 0 "0 "4H0!`0!(00!?(0 (0 0= 0 :00 0c1 0   0 "0 "0D0!\0!$00!?$0 $0 0= 0 P;00 0c10  0 " 0 ",@0!X0!`00!?`0 `0 0= 0 ;00 0c10  0 "0 "(<0!T0!\00!?\0 \0 0= 0 (<0 0 0c10  0 "0 "$80!P0!X00!?X0 X0 0= 0 <00 0c10 0 "0 "`40!L0!T00!?T0 T0 0= 0 =00 0c1 0   0 "0 "\00!H0!P00!?P0 P0 0= 0 l=00 0c10  0 " 0 "X,0!D0!L00!?L0 L0 0= 0 =00 0c10  0 "0 "T(0!@0!H00!?H0 H0 0= 0 D>0 0 0c10  0 "0 "P$0!<0!D00!?D0 D0 0= 0 >00 0c10 0 "0 "L`0!80!@00!?@0 @0 0= 0 ?00 0c1 0   0 "0 "H\0!40!<00!?<0 <0 0= 0 ?00 0c10  0 " 0 "DX0!00!800!?80 80 0= 0 ?00 0c10  0 "0 "@T0!,0!400!?40 40 0= 0 20 0 0c10  0 "0 "<P0!(0!000!?00 00 0= 0 0200 0c10 0 "0 "8L0!$0!,00!?,0 ,0 0= 0 100 0c1 0   0 "0 "4H0!`0!(00!?(0 (0 0= 0 X100 0c10  0 " 0 "0D0!\0!$00!?$0 $0 0= 0 000 0c10 h0 0 h0 h00h    h00h    h0 0h    h00h    `0K@ 30 0 00 00 00 00 Kb- M 0X 0P  0H  0@ 08  0  0 0 K/#EgܺvT2H-M   00 0 0 01 0 0 0R*00 0 0 0> 0 01?0 0 00?S$ 00 00 @ b  : 00  000@00 0? 0R:0 0 00 00 0 0 00c KH-M  00 0S000 0! 0 000123  0K0 000 0S00K0K p00K0K h00~? S0K ^00  00 "    !1"  000 0S\ H0K CKH-BM  ! 1 1@Sd0K d0K!* Kd0K0K1 01 0K@ !0K@ 0K!0K!~00K[ [0K 0060# 0K0 [ [0K 00\0# 0K0 0[00K0[?Sd0Kd K0K@ d0K !d0K8d0Kd K0K@ d0K d0K&K-M  00 000  0R* 000S0K/H-HM@ D $K00 0 0 00 $KR000 $K r0$K0 ?K!i00 0 S 0   0 7K00 0   W 7K00 0 ?Kh 0$K$KR0S  0 7 K000  0R 0&S0S 0 7 K00- D 0R 0@ 07 K 000 00C 0 0S0KH-LM8 < @ D0 00 N(0%S < 0R08 0(   000 =00 00 0 0 00 @000S000  0100 0 @0 @ 000C 0 0 @00/S@009S@00*SD0 D 0 0 @00@0 @00.S&@00@0 @00*SD0 D 00 @00@0   01000 @0 @ 000C 00 @00/S@009S@00I0C1SJxxxxxxxx@0 @ 00 @00hSH00 @00@0 @00lSq00 @00@0 @0 @ 0(0 (0sSMD0 D 0,0 @0S0,000c00 0$0 < 0R08 0 000 $00$0 $ 00R,0S! 0$0 < 0R08 0$ , 000 $00$0 0S$ 0R$0, 00S8(0cSD0 D 0(0 < 0R08 0(   000 "(0dS0S08 0< cD0 D 0 ?  -0 00 (0dS0lS08 0< cD0 D 0 ?  0 00 (0dS0zS08 0< cD0 D 0 ?  0 00 (0dS0qS08 0< cD000 D  0 00 (0xS (0uS 0S08 0< cD0 D 0 0(xQ   0 00 (0xS (0uS 0lS08 0< cD0 D 0 0(xQ   0 00 \(0xS (0uS 0zS08 0< cD0 D 0 0(xQ   ^0 00 5(0pS1D0 D 040 < 0R08 00 000 < 0R08 0x 000 08 0< c40 0)0 00 "@0 @ 0(0 (0S<0S < 0R0<00C8 0 0K -H-M  0 0  0~ 0KHЍ/H-M    00   0 0R0 00 0S 00000  0R:0KH-M  00Sxt  0  0 0 0  0  00S 00   Kt*"<"H-M 00S0 0  00S 00  00S 00    KH-0M  $0 0S 0X0S 0X00d00 D20S8'0d 0R 22 x 0  < $  0%0 00S 0S 0S 0S 0 00, $00  0 00   0 0S. 0x00 000 0 0 $ 3/000 0c0 0d 0R0x 0R 0?&-0x00 0x 0S 0x00Sp00Sd0d 0RL0H0 x 0  <  , 0Kt*"D"L"T"<"H-M !K0% 0b0S 0!Kb0S 0% K0K 30% Kb0S  0%KH-M  0D0S 0x00S 0K KH-M 0\0S 0`0S 0`0 \ 3/0,0080 KH-M T00SH#0x0< 4 0Kt*""H-M   0 0 0 0  _ D00S84$00SKt*"""H-M 00S0S) 00s 00/0 0s 0 0'0 0 0 000 00 0 ~ 00 0S( Kt* ""H-Mx | l0Kp0 p0Kd| 0 0Sp0x tp l0KR p0S p0=0K-H-M 00   0KH Ѝ/MH-M   t00 0S 0  0 d 0   0a 0L  T00 x0 0h 0 (  0S 0 0KHЍ/"MH-M   000  s0S 00 0S 0 0KHЍ/"H-@M( , 0 40 00 0 0 , ,0 00 ( 0S(00(0 00 ( 0S(00(0 K0KKKK K (`b0S 0,08 04 006 ,0 08#80 ,0  K 0K(A0S  K 0K(90S 08#80 ,0 0 0( 000  l0R0S 0,S L0 0000 0S 00K$","4"H"P"#H-(M 0K M0 0d 000K 0 0S0*0  0X 0X 0h 0h 0( 0( 0 0`00ST>00 x  H D   E0Kt*"X"H-M     000 KH-M   Z 0m` 0L 0x00S 0  =0  )0 0S 0 00S 0 00  0|KH-M  0S0x0+0x 0K KH-M   (10S 000 0x0;S 00S0 f* 0` 0L 000S0,0"0 , 0 00 00 04 0, 0   ?0K :Kt*0"l"x"H-M     KH-(M  $0 0x00S$$$"$2 20SS 0  e0x00Se 00 0 0 0 $0 v0S0 0R0 0 0S0S@0K 0 0d 000K  0S& 0 0 0   $00X 0X 0h 0h 0( 0( 0 x 0 0b00 h00S\\0S   0%K""k @"t*T"""0H- M   00Sڴ0S@@0P0000x 00x0 0x 0St&0 00 K0t*h""""H-M  t00Sh 0` 0x0 0x 0S 0x0+0x 0K *Kt*x""H-(M  0K B 0 K0 0KMH-M  000 0K 000K   0S0@0 K0K$ 0S 0S 0 0*0x 00 0x 0x 0S00 0x  0h 0S 0S 0L 0 00 (0KHЍ/""H-(M  0K 0 K0 0KMH-BM  ! 00 0 ,0K K K0K0S0S 0K0  3,00 30S0000 3SZ 00S ?K f02 002 0 02 0,0S 0,03d0K| 0'*00S& 0 00 00S0S d0e00 0 0 0 000 020c 0" l00S  0,0S 0,0 03d0#33S| 00S u0 00 0 0S 0S  0S 0 0 000c30S<k 0S 00S 00  0S _20S0S00 S :00Sڨ3x0+3x 0S 0 00R30S d0e0$0 $ 00:KL"`"h"x"t*""-M  00 000  0R* 000 S 0R 000K/H-M   0,0 0 00Sg 0S_00S[00h T0SRx0KL d0$ 0S 0+x $10SDY<;00S 0x0+0x 1x0K90 0 x0KJ0 0 0 0 0 0 00 0, 0,0S0d 0, 0,0y 00 Kh"x""t*""H-0M( , 0 40 (T 0K 000 0 0 0 00 0 000 400 0, 0K(,  0 KH-M / 0,0 0 0 00{00 P0  0  0KH-M  | 000  0KH-M 0,00  00 000R0/0 0 00  0S 0 0000c0S0 00 0H 0S 0   0  00K"H-M 0,00  00 00  000 0 0 0 00 00c00 j0S#  0S 000 00C0 K0K b0 K0K b00 0 0  00c0 C0S< P 0S5 000c000S | 00 00K0 0 000K0 0 z 00  00 0 00 0 0 0S0  00 0S0  0K""""H-M   0,0 0 00 000R0J 00 00  0S 00S 00 0 010S 00 00000R0  00S   000c0C0 0 0{c  000c 0  0  00KH-M  00S66,7H77d770  *0S%#0St0SH0Sa0S 0, 000KH-DM8 < @ D0 <0{S |S zSD@00   00 0  00, Kb 40KD8,0K S| 0 00c H|  000<S00 ; 000 00 0 0R| 0 00c '| x0KR |0S |0KH Ѝ/0"8"H-0M( , 0 40 00 ,0 0 00 ,;00 (0S (0 (0000 0 00 00S 40S 00 (0S0(000 $(0 0R 00C0 0R 00C0 0R0 00=S0, 0S 000 0S 0  0R:0S{ 00  0Rt*00 00 00"S 00'S0  0 0 00 00 0 S 00\S 000 0R000 0  0  0 00  0R*00 0R 00 0R 4 0R4 0R0 S 00 0R 00 0S 00C 00,S00C0 0S 00C 00;S00C0 00 0 0KH-M   0 00 ^0 x0ST0 00 M0 g0S C0 00 0 650 00v 0 00S 10Sڰ0c00/S00:S0  0 0 0  0 00 000 00S0S000700S0  0 00 00S 000 00S 0  000S 0\ @00S 40 000 0Kt*""@"H"L"P"MH-(M   00 0 0 00 0K K    10S0 0 00  0S  0S 0 00 0KHЍ/MpH-4M( ,  00 0 0 10100 0 0K00K0 000 (, 0S0(0S@@ P`0S F0S  l 0S 0T0` 0@ 000KpHЍ/X"`"l"$"p"t"H-0M  $0 0K 00$000 0000K 0KH-M   = 0 0 0 0 00 0 0  0( 0 0 ( KH-M   0 0  000   0R*00s0S  000c 0 000   0R*00\0S0KH-M 00c0KH-M  00 0S 0  @0  00c0 0S 00C0S 00C 0 0S0KH-M    0KH-M  [ 00 0 0  0Q01  0S 00c0KH-M  : 00 0 0  0Q01 K 0S 00c0KH-M     hKH-M     u0KH-M  KH-$M  $0 0S 0S:0 00 $00S 00  0$00S& 0000 $00S 0 @0 0c C0S <080(   0K"p"""H- M  $0 0K i$0 0K 0K $0KH-8M0 4 8 <0 000 0(0 $0K 0 0 0 00 0 00 a ?#>  0c0 0S!0S 08 <  00c (0K!0 0 0 08  < 00c!00 0 0 08 <  00c 000\!0 0 0 0 00S 0 00~S0 00.0# K 00 #0K 0 000  40R 08  < 00c 0H0 0 0 0  0S 08 <  00c (0K4 20 0 0 0K""""""H-M   0 0 0 00  0 0S$0 00c000 0 0 00S,0 0 00  0 0S 0R00n0 0 00S00 0 0 0 00  0 0KH-M  0 00 010d0 0 0S100 x0Sh100 0SP L0K< 00K< 0O0 0S 0S 0S 0S00000LK00K00 00#0S 000 0S   0X00 R 00 R K"#"#""""""#- 00S000K/"H-M   0S 00S00 V0  00, 0S  000c 0 000 0@00000  000c 0 0S, 0  0 00= 0 00S 00 0 0 000 000c 0 00 000c0C 0 0KH-DMDKLK 00 00 D @0|  0S" D0(0  D00c$0 (0KL0K 0S 000(0 D0 0 c@00C0$0 (0KL0K 0D 000?SH 0R {D 000$SH 0R00xD 000*SW000 D 000*S000 H 00c0 00 000  0 H0R L 000/S@ 0R 00GD 0000 @ 00c,0 L 00080 H 0 c00c40 00K80K c 0s0 C S 0s 0 000D 00,@L 00&0T 0 000 000 @ 0Rn0KH- M  00 00 0K 0K 0K 0KH-M  0 0 00 0S 00 0 KKH-(M  0S 0S 0S0"00 000KH0Kd0 0R00K0K"H-xMp t x 00 0 0 p0S t0S00H0 H0L0 L0@0 @0D0 l0K 0 0 ! 0/00g K p  // b b!" g1K00 00 0 0S0D0 0L0 0 0 ' g0!K 00S L0s 0L0 0H0 H00H0 L0s D0s H @0RD0KL K0L0 00 0 0SL0s D0s H @0RD0KL KD0s @0S0D0 <0K0 0 0 WD0s D  0RD @0 0R D  0R0  : =< 0S 0  : 0S"D0S@0S @0SX <1Rp0 <K00c/0 0S0;0 00  g0!K 00 0 00 00 0 0SD0s D @00S0  : 0   <0K0c x0R0<0Ktvt0K"H-8M0 4 8 "(0K 0"( 00 0 0 00K00 00 00 00S 40S 80S0d00 0 0 ,0K0 ,0K B0[( K 0S# 00 0100 (0K0c00 0S0=0 0 0S  00 0 0S0.00 0[.S0S 0S0 000 0 00 000 0 00K0[S 0S040, K0 0K"H-|Mx | 3LK@00x3`K@0000 040 00 00 00 080 0 0 0$0 0(0 0,0 000 x0S |0S 0S0p0K0  ?0040 00 x00:S0 0 x000:S 0x00 0$0 L0K0 8 ( (0S`0K0 8( (0S $02$0 ( 00c$ 0$0 $0S:0v0 0 x00S ^80:S x00SEx00 0S0S 0^00 J0 40R0T0  $ "$  0  $   0 0 0$0 0080 80:Sx0 0R400C,0 000 ,00C,0 000:0 00S,00 80.S 0 40R 0S 0x0 x 080 80Sq|0p K0 0K"$"H-M   0 0S 0S 0S00S S   g0S 0  0S 00KH-M   0 0S 0S 0S00S S 0  0  0K-M 00K0S 00K00K0[K/H- M   00   0SF000.0k0K8"x"H-M  00 0S000S0  00 S0  00 0KH-M   0S 000 /0)00K8""H-M  00 00 00 0K 0S\\"\200s_ @2#30 ,2#30c/0 0K0 0 0 0  00 0 0S02 K   " 1K00 0 0KK 0  0Sڨ0"0!K 0 00R30S0=0S 0嬁03 0奁0,0S0  0Si000t%.0厁00 0 0K  0SR0008 80w0K8"1"MbF"I""V0"H-M 00 0 0 0K   0KH-M  0K ! 0KH- M   0 0 00 0K  KH- M   0 00 0K   0s 00K   0s 00K   0sT*.`000 0 0s( (0K8"`""""H-M 0S0x m00 00S0p0 00 S00  000Kt*H-M  0 !K00 0S0a0S(0S 0  0 1[K0 0 0 S00 %0 1[70 0 07050S S .S 0 00s$0 1[0 0 00 00  0e0S 0 1[0 0 00 0KH-M 0 >K00 0<0 00 0 0 0T0 00 00 0S#3#00K >[P K#080K 040 000 PK8 K<0K 0S 00  P K 0/ 30<00 <0<0 <0 0  0S0s<00 <00 0S 0s 00 0T0 T0K\ 0S ,@"@2<00 <00 0Sc00sSQ 1#30 1#30c/0 0K0 00 0 000 0S02 K   " 1K00 0 0KK 00S00 0K K  X0S0 0 0 0 0 0 0s u00 <00<0 <0SV<0S00P0K04T T0? 0S0 0 0K8"@"P"T"!TF"Mbg"H-M  00 00 00 00 0S 0S"200K 0s00S0  0  000 0K  0S "2~00S0  0  0sT00sSO0K0 0 0 0  00 0 0S02 K   " 1K00 1#30 0#30c/0 0 0KK 00S0K K  {0S00 00 00 00 0K@ :0S 0 $0l~0K8""!T"MbH-M   0 00S 0      0M0 0      0A0KH- M   0 00 0 0 0S0S 0S0SL/H0~0 0  K  0 0K8""-M 00 0 0 00 '00 0S 00S0"0 0 00  0R00:S 00 0 000 000 00S 0S 0S000K/H- M  $0 00 00 0 0 00 0S0S 0S $0S$$!$1}0A00 9  0 c$0R$00   00c0 0S 0}'   0R 0S t 0}0 0 0 Ld d0z} 0 0 0   000  0R: 0K8""! "(4",d"H-M  00 00 0 0 00 $0K 0Sڬ0S 0S"2?}0|0 0 00 q 0$0 0 0 0K0 00 0 000 0S02 K   " 1K00 0 0K$K 0L 0S 0000 0|050S.0  0 0S00S00 00t00dt t0|00S  00c0 0 0 0 0Sʰ 00cK8"L"["e"H-M  00 0 0 00 0K B0Sڬ0S 0S!1|0s00 00 j 0 0 00 0K0 00 0 000 0S02 K   " 1K00 0 0K K 00S /0000 0Q|0-0 9g 0s00S| 0;|0 0 000Ld d0/|0   00c0 0 00 0Sʰ0K8"""""- M 0S00K/H-Mp t x 00 \0KT l0K p0S t0S x0Sz 1{0Z  0SL L1{0K\0KT n02Kl0K06Kl0K0tXKl0Kl0Kl0K0x06K8Kl0Kp00 \0K p0Sy00;00X `0{0s 00 00s 00 0K"P"p" "H-xM` d h l0 00 0 0 ,0K X0K, `0St p2e{0`00d00h00l0 08 82V{,0K`W ` 0S 1E{0u0X0 X0K0 ,0K 0S 11{Zl0S10F0Kd0dS S S 04Kd04K?4K 8 H1{0s 300 0?h0S0J0Kh0S0J0K  0z0F0K0P0 0X0 X0K0 ,0K 0S00~00X t0z0s 00 00s 00 0K""" "F("L"`"? t"H-$M( , 00 0K Q(0S ,0S!1z0q00 e00( 009S00( 0000C02 0 K0 00( 00 00W0C02 0 K0 000( 009S0  K 0 000(000000C 0 K0 0  K 0@000( 000000W0C 0 K0 000 0S 0K, ?0K""H-M   0 00 0 0 0S 0S 0z0$00   00cS 0   00c 000P 0 0 0 000  0R0K"*""H-M 0T0 0X0 0\0 0 0 0`0 0d0 0h0 0l0 0p0 0t0 0x0 00 00 P0K@ e0S\\!\1y0OPP{ 0S00K0! 0W/ 1y08m0S70.P KT0KXK`KdKhK lK\KpKtKxK O 0 S `00S P0K0S00 0K"V""$"("T"\"H-M00 0 0 00 00 pj hg `d 0S00 0S00 0S00 0Kx"""H-8M8 00 0 0 80S 0'y03,0K 40K 040 000  % 0s0s ,00 0,0K840K0 ,0KD 00 0 0s 00 0K""FH-M  0T0 0X0 0\0 0 0 0`0 0d0 0h0 0l0 0p0 0t0 0x0 00 00 P0K@ b|0K ]0K X0K S0S 0S 0S88"82x0,,c 0Sq0030! 0!1x0oU0S0e|0K 0K 0K P KT0KXK`KdKhK lK\KpKtKxK ,( 0 S -000  0~/0Mx)`00S#P0K0S \0|0 T00 X00 `00S T0S\0S X0S 0 K 00 0K"""$""T"\""H-HM8 < @ 00 0 0 ,0K 00K 80S <0Sdd!d1w0Q@0S<D!D1w0G  0S 00s00 0w01,0K8,0K 0S000 0w0s 00 0,0K0 0 0000 @00 K< 0s 00 0K"-,"2D"7\">p"K-`MH L P Q0K0 0 0$0 D0K H0S L0S"2ww0yH0S0qP0S!1ew0g q 0S -000p!1Rw0TD0KHQD0K ` 0S 0000(!(18w 0s U0 0 03D0K0$0 P $00Q[$Qp[$`QP[$@Q[$Q[$p `P@ $LX  0s  0 0 0K"a""j"o"'v" "H-HM8 < @ 00 0 0 ,0K z00K u80S <0SX/T1v0N@0S04!41v0D  0S 000 0v01,0K8,0K k0St000 0v0s 00 0,0K0 0 0000 @00 K< e0s 00 0K"0"L"h""H-HM8 < @ 00 0 0 ,0K 00K 80S <0SXX!X1Qv0N@0S08!81Gv0D S 0S 000/04v01,0K83,0K 0S000 0v0s :00 0,0K0 0 0000 @00 K< 0s %00 0K"""h""H-M  00 0 0 0K 0K2 }0K x0S 0S!1u0< 0S 0u0.00 00  K0K 0K0S 0  1K000K Kl0S0K 0S *0K"","$" @"d"h"t"H- M 0S0<00S000S 000S0 00S( 0@0@0T 00S000S 000S0 0@y0T 00S000KH-Mp t x |0 0\0 0`0 0d0 0h0 00 00 00 0 0 00 X0K@ t0S |0S x0S 0S p0S0Sp 0S0K44 0S0B0h0 h0d0 d0`0 `0\0 X K\0K`KdKhK 0S '\0 R" 00 0 0SX0Kt ` x0 0SX0K| ` 0 0S T0O0K|"$""H-EM  00 00 00 00 00 \0K@ 90K@ 40K@ /0K *0S 0S0kB 0S&0_00 0K@:\ K0KKKKK KKKK,' 0 S 2\0K 0S*0S'0K0S  K0K 0S 0!0K@f0@b0T 00 0K 0K (0S 00K"$""""H-8M0 4 00 0 0 (0K 0 0 0 000S 40S!1s0w(0K0 0S 0m0K z( K0K0S0^00t|!|1s(0K d(0K0 0S 0H0K U( K0K0S0900 0s0S0-0K :0K4o0S000x 0s 000  00 0   0R4T T0|s0@ @0us0K""4"H"X"l" "H-M  00 \0KT l0K |0K 0K 0S 0S"2=s00S 20S |0K 0K `200 0| K n|0K," q0S"2 s0v0S 00S 0f0K 0K 1   0S0P\0KT |02Kl0K06Kl0K0HKl0Kl0Kl0K006K8Kl0KXKl0K00 08#81K\0K v0S000Xt t0r0s 00 00s 00 0K"$"t*"8" _"H-HM@ D 00 (0K 80K @0S D0S!1jr0> v 0S04(0K@_80K03K80K0D%K80K(0K 0S000Xd d0:r0s W00 00s N00 0K"y ""H-HM@ D 00 01K03K00 0 0 40K @0S D0S$4r0  0S040K@40KH 0S000$4q0s 00 02[1K@ 0S #3q40K 40K@1[2K0 0 00 0D 009S0D 00/S 0D 0000C8#88#83K0D 00FS0D 00@S 0D 0070C8#88#83K0D 00fS0D 00`S 0D 00W0C8#88#83K3[8C828#83K00D 009S00D 00/S00D 0000C8#88#(3[08#83K00D 00FS00D 00@S00D 0070C8#88#(3[08#83K00D 00fS00D 00`S00D 00W0C8#88#(3[08#83K 0 4 K0006 [ 000 0SP40K 0S000 0p0s 00 0@0S 4\ \0p0s 00 0K" "'D"`"$p""H-HM@ D 00 (0K b80K ]@0S D0S$$!$1p0A  0S07(0K@80Kh03K80K0DpK80K(0K W0S`00"00Xd d0p0s 00 00s 00 0K"""H-M  00 P0KH `0K 0K 0S 0S!1Gp0_1`K`0Kb0S  H 0S0JP0KH PK`0K00 01K00 0K 0K 0 0K p0 0 P0K 0 P0K 0S0s 00 000<P P0o00s  00 0K"*""3 J"H-xMp 00 P0KH ll0K gp0S0K   0S0AP0KH Sl0K N0dK 06K0Kd0KP0Kp 000 01K00 P0K \0S0s 00 ^000DD D0o00s 00 0K" "v,"H-TMH L P 0@0 0D0 0K ,0K <0K H0S L0S P0S0<0K 0.0KK@ K,0KDKH0S 00088"823o00K0S0K00S 0K00S0K 00Sn 0K@I0@E0T 0K0SU0K00SP0K00SK0K 0@/0TC,0K0S,0K00S ,0K00S,0K 00S* ,0K@0@0T ,0K0S,0K00S ,0K00S,0K 0@0T ,0KL D P0 0Lh 00KL @ P0 0L( 0K"P""H-HM@ D 00 (0K 280K -@0S D0S!1n0>  0S04(0K@z80K803K80K0D@K80K(0K '0S0s {00 )000<H H0Nn00s i00 0K"""H-8M0 00 00K,0K 00Shh!h1&n0R 2 0S0H,0K000K,0K 0S000 0n0s  00 0(1[ 0[08#81K,0K 0S000Xp p0m0s 00 00s 00 0K""" "H-8M0 00 00K,0K U00S 000!1m0_00Sht!t1m0R  0S0H,0K000K,0K  N0SW000 0|m0s 00 0(1[ 0[08#81K,0K -0S6000X-p0[m0s x00 00s o00 0K"&P""+l"8"H-Mp t x |0 00 \0KT l0K p0S t0S |0S 000ll!l1m0S $ 0S0Ix0S02K02Kl0K06Kl0K0pXKl0Kl0Kl0K0t06K8Kl0K|00 \0K 0S000Xd d0l0s 00 00s 00 0K"[" y"H-HM@ D 00 (0K J80K E@0S w000  ! 1l0@D 1RD0cS0D0   0S0-(0K@80KF03KD00 (0K <0S0s 00 >000<L L0cl00s ~00 0K""""H-H-pM00  S 0S0=\0KT l0Kl0Kl0K006K8Kl0KXKl0K\0K 0S000`` `0l0s +00 00s "00 0K" "4"H-M  0 0K $0K 40K |D0K wt0K0 r0K0 m0S 0S 0S 0S0~0000!1k0000!1k 0S0dt0K0 0S 0Z00t0K0\l!l1k0K0 0S 0G000K0(!(1k40K t K40K0M$0K  KD0K0B0K 0K08$0K $0K0.  0 0@00R4T T0Kk0s.<0Dk0K"\"t""",""H-M  0 00 00 00 00 0S,,",2k00K 0S 0K 00 0K 0S !1j 0  0sE00sS@0K0 0 0 0  00 0 0S02 K   " 1K00 0 0K 00S0K K  0S00 00 00 00 0K` n0S 8L D0j0S 0K 0K"G"!TS"lH-M  / 0S KH-M  00 9 0K5<0K10K-0S0SDD!D1[j0I0K 0K 0S 0=;[S K0K0  ';[ S$  P c0S. 00S( 000S 0e0$ 000S 0e0 000S 000S<T T0e008 80ye0K"} " @" l" " "H- M  0S 0SPP!P1Ze0L V0S< 00S000S 000S0 00S' 00S000S000S0 0@W0Thp p0 e000S<L L0e000 00 e0K" " " L" x"H-M  0S 0S 0d02 0S& 00S 000S  000S 0 00S 00S X` `0d00 4.@0d0, ,0d0K" " "" H"H- M 0Spp!p1d0T00S000S 000S0 00S; 00S000S000S0 0@㪽0T 0sd0$00S 0hd00@命0@t卽0T<\ \0Vd00@ @0Md0K" " " " " <"H-(M 00 00K0 0 00 00 0S"2&d0z 00 00S 000S  000S 0 00S_ c 0S0S00lt!t1c0S0 0 0 000K0[00S  00 0 0S 0S!1c050[0c 0[0000S  0c0$ 000 0 000K0[S 000 0S0S<\ \0c00@ @0c0K"$ h". "< "B "O "U "H-M 0S 0c0%00S000S 000S0 00S 00S <D D0oc00( (0fc0K"d 4"l X"r "H-,M0 4 (0K000S400 R7000 S.(0K0 H(0K00S(0K 00S (0K0@_0T00S 40 40 (0K0 & 4 (0K  0cK" "H-M00 0 0 L0K@ 㚽0K@ 㕽L K0K@ Ż0L K ᛻0S 庻0L K  ᐻ0S 00K""H-M00 T0 1 ٽ 0S 0000 0S0K@"H-M( , 0! 41 0S+ 411 S'011 3 K 3 K >K, (10 ,10 T30 >K0 0 ޼0 M0S00= 0S0>K0 000 00S 2 00000 0S,50, 0S,+0 00:S:ѽ 000 0& 0K  ጼ 08#(01  .㸽0S 0100 01 0K r 0 01  .㟽0S 0100 01 0KX Y 0 01 0 .ㆽ0S 0100 01 0K @ 0 01 ͻ 010 2û 01 0 (|幻 010l  h0 >K 0SO \0K"$"#"""H-)M 0 0 00  0Sx]04 K =K 0S@--<0a00 20[0 00 尻0K"" "H-hMh 00 0S/0,D0KT0 05K04Kd0Kh 㿻 00 h00 00 d0K0 0 㲻0 !0S 0 0 v0 0$0 $pB0[0 0K"H-XMX \ 00 i 0S0; 00 X00 00 P0K0 0 {0 0S0$\0@0 "03K03K 0 0 X0$0 x0(0 P0K,0 ,0$ ^(0 , ͹0S00 00 000 00K"H-M  00 0S 0S44 40`0 w 0K" "O- VMM8 < 0(0 0,0 C.K B; `S.K B< Y000 040 85S <5S(0m, ,0S(0yC>K0C!,0>0(0 ,4(0S 44[S0fC>K0C80 00S0[0  4 00S0R8S000 000 4 000cS.K B0 yK0C@@ DHL $(p,04 < 0်( (0S00 K$"$"4"H-PMP T 00 H K@0 ᶺH0KP@ 0S 0H (0 T0 0KH-0M( , 0 00 0 0 00 20 20 0P0S學 (0S (00S p( 嫺,0S ,00S D, 堺 44"场 h0$*0S凸 (0S (00S ( 兺,0S ,00S , zFk 0SO0TE00 A0 0  3  /0S$I  0!0S0. Ӹ0S.  00S غ0 ѹϺ ͺ噹0S H40KX"h"x"x"|""","""""H-xMp 00  F 0S0E\0KT ƹl0Kl0Kl0K006K8Kl0KXKl0K\0KD0p\0K η0S׶00ᙺ00`` `0^0s 00 00s  00 0K" " "H-M 0S00S 0KH-TM8 < @ 00 00 40K [80S <0S0U8X0S0M@0S0H 㷹 0S0>40K8堺40K \0S 0s 尸00 0)40K00 @ 00@@ <4 傷0s 典00 0K"'"H-M 0T0 0X0 0\0 0 0 0`0 0d0 0h0 0l0 0p0 0t0 0x0 00 00 P0K@ ԸHH 0S00(չ0A0S帷07P KT0KXK`KdKhK lK\KpKtKxK й 0 S `00S T00ST0S 00 冷0SP0K0K"$""T" "H-M   0   00KH-M   0   00KH-(M $ ( ,0 00 80 0 0 00 0S0s$0S (0S (00S0g   0S0_  0S(0 0RX3 0M(0   >  0 c0R  00c0 0$  0 0  0S 00 00 0 ,0S 0d 0 ,0 0S 00 `P 0 C SDH: 0 0R2 0KP" H-0M( , 0 40 00 80 0 0 00 00 00 (0S0,0S 00S 000S0a 0S0~( 0S0v   0S00 0R嘸a  0b00    Q  0 c0R  00c0 (n0  0d $ $0S% 00 $00 0 $0 ,0寴00 彴$ 0R $ Z40S 0d .0 40 $0S 00 p場 0 C ST嘴  0 0R  2a0KP"Ph" H-M 0;+0; 0 (0 (0>0/0> 0/0>0*0s=$0*KH-M   0S 0>0/? 0> 0/50KH-M   00 0 0 0 0 00 M0U?0 1000S 0U?0 1000S·0U?0 100 0R&0U?0 100 0U?01000 Ꮄ0S 0]?0 10 00000 0S0K"- M 0S 0:0K/- M 0S 080K/- M  0 (K/H-MMp t x% |5 00 0$0 00 p5>0(0 :,0 B>K 0C 0Cd*00 000 pU>K 0C0CJ/ x5h5 xA0d5 U.K B BU>K 0C 0C^T5 S0rp5X%T5 ᦵp5KU>K 0C0C0 Qp5>0S.K B B\5S \5S `5H 0S0$0 p5+p5˃B>K 0C 0C  0.p5-$ B>K 0C 0Cy0S 00 p5+㯵0SU 00 0 0 000 J 0S0p% t8 0 000 0p% <8 0 000 00S 000S 0p% 0 0 ޵0 00 0p%0 00ϵ0 00 000 00 0 0Sp5(8S 0(  ,00cp(p$p't5廳0 00 0(  ,00cp&t5婳0 00 |5S |Q 00 0S 0( , 00c 00X&勳0 00 0( , 00c p5;&y0 00 |5S |P 00 0S 0( , 00c 00%[0 00 0(  ,00cd%d5K0 00 |5S |@P 00 0S 0(  ,00c% 0/0 00 tj0S td0S0(  ,00c$ 00 00 |5S |pP 00 0S 0( , 00c 00$$0 00 t00S t*0S0(  ,00c#3ٲ0 00 |5SE |500 >0 0T _0S 0 0( V0S 0 0 M0S 0 0 D0S000 0( , 00c 0 0"喲0 00 000 0S0(  ,00cd"傲0 00 0(  ,00c0"t0 00 0S p% 20S p%1<0p! 3/p%10p! 3/p%1p%10SJ p%1p%1p%|1|p%1K 0C 0C0K""""""" "$"8"@"L"X"l"""""""""""00<@0<?0\@0="H"pH-DM8 < @ D0 00 00 0 0 80s=$000 640 0$0 0(0 0,0 0000 008<@ D0 0S |A0808S 80>0P58 D6P8 <6`80N@80>0Q0 5/ 0S48 1<08% 3/8 508% 3/8 50^0S% 8 |508t%  3/ 0SX 8 1<084% 3/8 (508% 3/8 505400 ʲ0$0 8 48 400  400c 4 00 0$ 0S 80*80( 40R^Y 0SD80<S@80> 0 0{ 0S5 80 (0(0 0,0 ',0 8(0e?0 100 8(0e?0 1000 Ἧ8(0e?0 100 ,00,0 (00(0 80,(0R 0S80:S 0S808S80<S 4 0R]0SPF8 1<08 " 3/8 208" 3/8 10p00 0SL<²0SF 80<sB   00c0 0S 00  0S0 U0$0 $8 T18 810  00c 1H0L 0 @0 @0000C8KB80K+L0 >J@00D     08 0S0 C Sp< 0S0 ^ @0 0 @0 0K4"@"H-M 0S0 01S 01W0K-M  0 0 00 Vx1 0 00000@0S0 00 S 0 00 S 0 000KB/01 >K0Y>K0Tt0 >KBK00C0 0S4: 00:M000S 0Kt*"4"H-M?0 >KB/01 t0 >KB00C0 0S4M 00 M000S 0Kt*"4"H-M?0 >KB/㒧01 >KB`00C0 0S0_ ,0L0 00S 0K"4"t*H-M?0 >KB/g 01 >KB5Ǥ00C0 0S0r ,0L0 00S 0K"4"t*-00K/ػ#-00K/ܻ#-00K/#H-M  00 l00S0X]L0 0 9㕤 ,孧 0R 00K#t*H-FM 10 000C S]GGGGG HKB/㯦 01 |00S l00.K  0 1 >KBo0Kt*t*t*t*ػ#ܻ#t*#"H"t*t*H-!M /K< ၦ00 ?KB/& 0BS*0?Kj?K,k2 200c 200C0BS*0KH-M /K< Q?K 0 0 0 0o>K0C0C+=o>K0C0C2 ;2 x0Kn 20Kn - 㞦 p2 h20S007Kx0K D2 0 ဣx0K02 x0Kn  0S  1cK10ၥ0lx0K0 0S !1OK10m0X0>K0K p1 0 F81 0Kn B 0S  ! 1-K00K061 &?K,㻥0 ?K,9 0S0SG/0 K0 /K?K ?K 400S$0080 0K#\""p""""t*"H-qQ"H-M 0 l0 0 `0 0 T0 002'<0RĢ,00S0Kt*t*t*`Mt*H-MM;K0C0C+B0 0 00 ;K0C0C+70SQ 0S0 0;K0C0C 廤0S ;K0C0CLϥ0S 00  Ǣ0S 0K"""H-PM00 0 0 㹣0S  0S|00P0K@ 00 0 0Sգ0P0Kᰥ ͣ0K""<"H-M 1 1 |100c;Sl10 `1 X10SLGH彥 01 1 1 00 G00 000  0R*^0S --!00 t000  `0R:0S HxG$uGܡKt*t*t*P"""' ""H-R 0 |0 x00R l00 `0 X00TO@0 ,0 (0 $00 S00t*t*t* "H-M00 0$0 d K@0 0 0 00 00 00 K0 A?K 0 0 0 0 0 0 0 000 0 0 O 0 Sڦ0S 0S 0\0 0  00 0 0SE0S0S< 00 A?K ɣA?K <$ $0S+0K 㻣 KA?K !0KF$ $0S 0S000 00 A?K`$ 0嫤0 S00  @000 A0S 0S000 /00 80S!d0K$ $0Sd  0R D 0R000 00 0Sh凤00 d0 0 D00 0S ˠ,00S]K0"D""d"|""t*H-0M00 ,0K٠ ,0Kd H0 0 K,0K0 0y 0S00Kt*RH-M     g0KH-M     0KH-@M8 < @ 00 0 0 ,0K 00K 80S <0S0-@0S0( U 0S0,0K8>,0Kh 0SQ0,0K0 0 0000 @00 K< A0KH-M00 T0 1  0S 0000 0S0K8"H-M KH-@M@ D 00 0 1D 50S000 0S 0S0$0 1ᒣ0,0 00 @00 p00 <0K0 0 0 偠0S (w0 0K"" Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/PQ @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/!1#0@-@P40y JZtPe@ 0!"# 0!6U0Ơ! p6#6 r04W @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rU*\0@D1?o 0 0C S  b 1 b0@T0@@T @@ d010 @d d001046#!@PE 40 010ʰ#0E208Q00 FV100/0@-K2@P0/0@-K2@Q`B a43!/23/0@-MQ /0@-P /0@-QZpK2@!˰\    ! 0bà01@Op@-̌!J#Z 4 5o @`!:VV6 ŽP!`S<@D VL*P` T \^pa!@T Ptp@TX6tp@d @T @ @ Pd50!1p @d Pd40p Pd04511p4a@D 5/a 0PE 0/ 4#Z 5 ``!p`` 4f  5f!p>pp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# & * Z>>*S 51:3`//// *& *Z>>*SJ51:3//// 2RS"|"!R/.&/* b b<055 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3# R:0",S413`//ar$// *R:0",SJ413//ar$//SRQPM`-0Ѝ /SRQPM`-0Ѝ /@-p@-T0 @P\` 40V 0e P@p=AA-@`p4#@P0@VP@A-`p@A#HP0@VP@@-(`Pp@ 6/P@-(`Pp@ g6/P@-(`Pp@ 6/P@-(`Pp@ 6/P@-(`Pp@ $6/P@-,`Pp@ 6/PG-P@PQEDp `6e 0 8/P@G-P@PQEDp `6ej0 8/P@G-P@PQEDp `6e 0 8/P@G-P@PQEDp `6e 0 8/P@G-P@PQEDp `6e &0 8/P@G-T@PQEHp `6e 0 8/P@G-PPQ@Ep `6e 0 8/P @ G-PPQ@Ep `6ej0 8/P @ G-PPQ@Ep `6e 0 8/P @ G-PPQ@Ep `6e 0 8/P @ G-PPQ@Ep `6e &0 8/P @ G-TPQ@Ep `6e 0 8/P @ @-(`Pp @6/P@-(`Pp @g6/P@-(`Pp @6/P@-(`Pp @6/P@-(`Pp @ 6/P@-,`Pp @@6/PG-XP@ATLp `6dd0 `8/PP5D@G-XP@ATLp `6djd0 `8/PP5D@G-XP@ATLp `6dd0 `8/PP5D@G-XP@ATLp `6d d0 `8/PP5D@G-XP@ATLp `6d*d0 `8/PP5D@G-\P@ATPp `6d `d0 `8/PP5D@G-X@APTp `6dd0 `8/PP5D @ G-X@APTp `6djd0 `8/PP5D @ G-X@APTp `6dd0 `8/PP5D @ G-X@APTp `6d d0 `8/PP5D @ G-X@APTp `6d*d0 `8/PP5D @ G-\@APTp `6d `d0 `8/PP5D @ @-4pP@`T 7/PO-dP@ATX`p+034 Sh&h  8/P@O-\@APT`p034 S`  8/P @ @-0 03/p3@-@@T@-@ @ T@-03/@-(`Pp@ 6/PG-LP@AT@p`   8/PP5D@G-L@APTp`   8/PP5D @ @-0@3/ 0 @-0@3/00@-0@3/00@-0@3/00QO-MPp@pPp@S r0@X `\2?oS c5"c&X (p )8 Q!*G* QG20k  )p Q!*`G*VG2 Ȍ\`?oS0fP8 c c7!5&s  +  '8 Q P!*PJ* QPJ200l0r0x'x  Q !* J* Q J200kX&0Y0*{)8Q !* K*Q K20g  A )p d  Q!*`G* VG2ȌZXVoYW UP3P## P!N*L 0i>>>>>>>>>>>>>>>>>>1>>>>>>>>>>>>>>>>>>>%d >>>>>>>>>>>>>>>>>>2>>>>>>>>>>>>>>%d handle_DP_SD_FORMAT_STATUS_ONLY_GET %d null ptr Error!! type invalid :%d,%d TUYA_DP_SOUND_SENSITIVITY:%d json is null calloc failed buffer is not enough escaped json: %s error! not implememt yet. /home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_media.cthread_pb_avframe create formating or upgrading %d ERROR exit thread pb,index:%d,nRet:%d thread_pb_avframe exit: %d pps_tuya_avrecord_seek %d-%d-%d %d:%d:%d pps_tuya_avrecord_seek failed! p->running:%d failed to open avrecord! start playback failed! device p2p online device p2p offline rev p2p event: %d live video start live video stop live audio start live audio stop live recv audio start live recv audio stop live load change live quality %d -> %d pb load change pb idx:%d quality %d -> %d pb query month formating pb query by month %04d%02dquery month is NULL %s pb query day pb query by day %04d%02d%02dquery by day is NULL file_amount = %d isize = %d %02d%02d%02d-%02d%02d%02di*2=%d, %d:%d:%d, i*2+1=%d, %d:%d:%d pb start idx:%d %d-%d-%d %d:%d:%d pb pause idx:%d pb resume idx:%d muted: pb stop idx:%d set clarity:%d clarity:%d ========= pb client release ========= recieved audio frame(device from app) length is %d, can't process recieved audio frame(device from app) codec is %d, can't process errornull pointer tuya ring buffer init done tuya p2p start live nullptr send to main video channel failed: %d send to sub video channel failed: %d send to audio channel failed: %d send to audio stream ring buffer failed: %d pps_tuya_media_enable_speak: %d clear send frame ... %s:%d numregion%d{\"num\":%dxyxlenylen,\"region%d\":{\"x\":%d,\"y\":%d,\"xlen\":%d,\"ylen\":%d}node == NULL }pppps set mirror ret %d %s:%d search by day failed! monthlist.recordlist[%d] Got seek messages! Got switch messages, %d %d switch segment failed! check file invalid! open record file failed! read record frame failed! motion detection off sleep mode on motion detected but in shield time pic size %d == %d picture: %p, size: %d motion detected upload pic /home/cfg/start_soundmd_common_callback... media md init failed move detected event registed media db init failed: %d db event registed media_day_night_switch_wifi_connectedio_call is NULL /home/sound/login.wavmedia start and config encode failed register main stream watchdog heartbeat cb failed: %d media start failed: %d media_video_startmedia init done pps_avdevice_enable_speakpps_tuya_set_media_parambase_initsingal_registerwatchdog_initstartup_logboard_initinit_usersdcard_factorymedia_startmedia_event_initreboot_cb_initgpio_event_initled_ctrlsdcardav_recorder_initeth net statenetwork initptz_service_initrestful_serverprodtest_inittemp_humiditymeari_authsdk startsdk p2p livesdk timeupload statuscloud enablestatus reportcloud initpps_sd_recordcoreuserafter/home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_netmng.ccb is null qrcode deinit error: %d wifi disconnect error: %d PRODUCT_TEST56565099wifi connect error: %d /home/sound/restart.wavap is null cfg is null wlan0Managediwscan failed ssid:%s bssid:%02x%02x%02x%02x%02x%02x channel:%d scanned: %d, assigned: %d, max: %d create socket failed set freq failed iwconfig wlan0rpopen failed Mode:%s MasterMonitorWIFI Set Mode %d socket ioctl WIFI Get MAC %02X-%02X-%02X-%02X-%02X-%02X WIFI Set MAC 192.168.0.1255.255.255.0eth0WIFI[%d] Get IP:%s WIFI Set IP Sniffer Thread Created funcSnifferSniffer Socket Alloc Failed Sniffer Proc Finish Enable Sniffer Disable Sniffer Get quality_level: %d, quality_range: %d 8188 card add 15... Get rssi : %d quality_level: %d, quality_range: %d ipaddr %s gateway %s pd is not invailed pd is not correct wpa start timeout wpa start timeoutgot ip %s %s %d net_connectedinit eth manager ifconfig eth0 upnetwork init done /home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_device_states_report.crecord move detect time: %d cloudStoragemalloc snap pic failed snap pic failed: %d cloud_recordSound event:%d ---1------TUYA_CMD_SOUND_ALARM:%ld %ld---2-----TUYA_CMD_SOUND_ALARM doorbell pressed tuya_event_report/home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_ipc_event.cmd time inteval %ld %H%Mtime_now: %d, start_time: %d, end_time: %d malloc snap pic buffer failed re snap snapshot failed: %d capute image complete, times: %d, image point: %p, image size: %d release a nullptr upload motion event to sdk failed: %d upload motion detect pic upload bell press event to sdk failed: %d upload doorbell press pic call tuya_ipc_notify_motion_detect upload human motion detect event to sdk failed: %d upload human motion detect pic upload baby cry event to sdk failed: %d upload baby cry detect pic snap failed: got null snap failed: len is not vailed: %d motion event alarm notify failed: %d doorbell press event alarm notify failed: %d human motion event alarm notify failed: %d baby cry event alarm notify failed: %d can't process event: %d /home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_ptz.cthis board does not support ptz net connected ..., ptz start /home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_reboot.creset ipc success by %d. please wating rm -rf /home/cfg/*/home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_pid.cCan't find device type 0X%X! gsfw4dvy8fizgzrkxlhkhznwa5w9cjood7x4dw6vwgqgyzovkcfw92tv9nworwl7/home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_led.cclose pir(1) failed: %d pir closed open pir(1) failed: %d pir opened get daynight mode failed: %d ledctrl_awayledctrl_rebootdefaultled closedupgradingwill rebootqrcode mode openingsmartwifi or qrcode mode connectinghome modenet disconnectednet connected/home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_button.cbutton ev: (reset)long press /home/sound/restart.wavrm -rf /home/cfg/*/home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_all_init.crecevie signal %d GarageDoorStopGarageDoorCloseGarageDoorOpenset timezone to %d CST-%02d:%02d:%02dCST+%02d:%02d:%02dset timezone %s failed got qrcode content: %s json parse failed sqr s %s pqr p %s tqr t %s /home/sound/login.wavnetmng init failed factory mode don't start netmng Twlan0%s, %s, %s{"alg":"SHA1","typ":"JWT"}%s %s.%s%s.%s.%sresultCode1063licenseIDmacjwt%s/%sdevice/license/third/authget response: %s ++++++++ %d http://3rd.meari.com.cn---------<%lld:%d>----------- ret %d /home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_factory.cqrcode deinit error: %d hostap stop error: %d wifi disconnect error: %d wifi connect error: %d don't get wifi info _MEARI56565099factory token %s /mnt/mmc01/ppsEncrypt.txt/mnt/mmc01/ppsFactoryTool.txt/mnt/mmc01/ppsDebugTool.txtthis device don't meet encryption conditions! encrypt device failed: %d can't find ircut info from factory tool file: %d /mnt/mmc01/atbm_iw/mnt/mmc01/wifi_test_result.txtkill `lookup_proc netMserver`START TEST cd /mnt/mmc01/;./atbm_iw 1echo `cat /mnt/mmc01/wifi_test_result.txt` >> /mnt/mmc01/wifi_result.txtr%s didn't exist result:0TEST OK TEST FAILED successfailedfactory wifi connect %s detected encrypt file but process error: %d detected encrypt file and process success open 8090 service factory_sdcard_mountedfactory_got_wifi_info/home/rzq/code/4.2.x_2/camera-app/ipc_app/tuya_ipc/tuya_app/pps_tuya_ipc_sdk.cfirmware info: url: %s, total size: %d download package offset: len: %d, offset: %d upgrade buffer length is too small: total: %d, malloced: %d upgrade protect failed: %d download failed, exit func download finished, start upgrade /mnt/mmc01up.binwrite file parts to sd failed: %d /mnt/mmc01/up.binprotect failed: %d ota upgrade failed protect release failed upgrade release OTA firmware info: url: %s md5: %s ver: %s file_size: %u malloc upgrade buffer is to small mqtt cloud connected mqtt is online mqtt is offline mqtt status change to %d tuya_set_timeNULL_uuidNULL_auth_keygot firmware version failed 1.0.0firmware_verson: %s uuid: %s p2p_id: %s /home/cfg/ipc_wifi_tutkfactory mode don't start sdk current not in factory mode TUYA SDK VERSION: %s sdk init failed: %d tuya sdk inited sdk start failed: %d tuya sdk started mqtt connected /sdrec/%s/record%s/%s/record/home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_record_old.cmalloc error! -[oldrec]Group name is malformed! T%s/SDT/%s%s/SD%s/%slink uri dir:%s oldrec dir is not exist, return. dir:%s is not exist, create it. /dev/mmcblk0p1/mnt/mmc01/sdrec123456%.*sconfig.video_track.width = %d, config.video_track.height = %d Failed to create g_dctf! %s/%s8@@av stream recoder null trigger record event failed record start failed set enable %d, duration %d, continuity %d avstream object is null get event_store enable %d get event_store duration %d get event_store continuity %d set storage mode %d, %d get storage mode %s %d seek failed. read frame failed! Read frame size error %d SERACH_BY_DAY: %d-%d-%d The dctf is not exist. Can't search by day! recfile first time: %04d-%02d-%02d recfile is deleting, wait a moment. Search by day failed %d Got result %d! %02d%02d%02d-%02d%02d%02dOK! SERACH_BY_MONTH: %d-%d Search by month failed %d UNKOWNsize.total_bytes %llu, size.avail_bytes %llu %dG%.1fGPPS_EV_SDCARD_MOUNTED PPS_EV_SDCARD_START_REMOVE PPS_EV_SDCARD_DISK_FULL record_mdrecord_bcdrecord_pirrecord_belldownrecord_ctrl%.*s-%.*sgroup name is %s recold_sd_mtrecold_sd_rmrecold_sd_srmrecold_sd_fullrecold_reboot_stoprecold_exit_stoppps_ppsdev_record_open_filepps_ppsdev_record_close_filepps_ppsdev_record_psdata_freepps_ppsdev_record_search_by_day_with_timezonepps_ppsdev_record_search_by_day_with_json_timezonepps_ppsdev_update_interval_timepps_ppsdev_record_check_file_valid_newpps_ppsdev_record_switch_segmemtopc_sd_set_event_mode%04d-%02d-%02d %02d:%02d:%02d tz:%d, dst:%d000102030405060708091011121314151617181920212223242526272829303120172018201920202021/home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_dctf.cList in root dir %s group: %s AMPM Day: %04d-%02d-%02d-%.2s group_name format error! malloc error! -/mp4recrec%s%s%.*s/%s/%04d%02d%02d-%.2s/mnt/mmc01/SD%s/%s/record/%04d/%02d/%02d/mnt/mmc01/SD%s/%s/record/%04d/%02d/mnt/mmc01/SD%s/%s/record/mnt/mmc01/SD%s/%s/record/%04d/%02d/%02d/%02d%s%s%.*s/%s/%04d%02d%02d-%.2s/%02dH%02dM%02dS-%05d%c%c-%.2s%02d.%smp4/mnt/mmc01/SD%s/%s/record/%04d/%02d/%02d/%02d/%02d%02d%02d.dataInvalid filename! Invalid suffix! %04d%02d%02d%02dH%02dM%02dS-%05d%c%c-%2s%02d%.*s/%s/%04d%02d%02d-%.2s/index.binSD%s/%s/record/%04d/%02d/%02d/%s.index%08dTry to repair the file: %s Repair the file %s failed %d, remove it! open %s failed. mp4 size is zero, delete it. open dir error! .mp4index.binremove sub_dir or file failed .dataNo memory record%s/%sstart clear group dir:%s, mp4_dir:%s, mp4_dir1:%s. %s/%s/mp4rec-AM-PMGot %s, %d, %d, %d, %.2s open %s error dir sub file name:%s, count:%d dir:%s is empty, delete it. level:%d delete dir:%s error! /mnt/mmc01/SD%srecord is deleted, clear parent dir:%s. dir parent name:%s, level:%d %s/recordGot %s/%s, %d, %d, %d %04d%02d%02d.indexGot dir %s scan mp4rec dir. first hour:%d, first_day:%llu, delete_time_point:%llu /mnt/mmc01/SD%s/%sRECORDscan record dir. generate recfile name failed %d! %s//index.binFILE_NEW: %s FILE_UPD: %s duration=%ds FILE_DEL: %s start load old record. There are no video files this morning. load failed! start load yestoday afternoon. file not exist. start load this morning. start load this afternoon. There are no video files this afternoon. load one day error, type:%d! success find. %u, %u, %u [dctf]recfile is not empty, but can't find! curr file is last entry. /mnt/mmc01Now playback is running! [dctf]Try to remove the file %s in hour %d. ret:%d delete recfile failed %d sdrecgroup_path:%s, root:%s dctf root:%s, root dir:%s SD%sreserved_path[0]:%s, reserved_path[1]:%s try to delete...%s update first day:%llu, d:%llu FILE_NEWFILE_UPDFILE_DELduration=[dctf]hint is not exist! [dctf]Malloc error! No last recfile! old record file scan_point:%llu [oldrec]Seek data buf malloc error! uri read error! [dctf]index file:%s, type:%d. recfile index parse error! [dctf]Start load one day for mp4. gm_time:%lld load mp4 one day error! :///home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_uri_io.copen %s failed: %s open %s failed %d Not support uri protocol: %s mkdir %s failed %s This is a regular file %s! /invalid pathname get file stat failed: %s, errno %d remove file:%s remove failed: %s open dir %s failed..... ...System Volume Informationremove sub_dir or file failed rmdir dir:%s rmdir failed: %s rename %s---->%s failed! open directory %s failed..... close directory %s failed.....ret = %d /home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_mp4_muxer.cduration: %d, %d, %d, timescale %d @track[%d] stts nr_avframes=%d track[%d] stsc nr_chunks=%d j %d channel %d, bitwidth %d, sample_rate %d %@cV"@JVT/AVC CodingVideoHandlerSoundHandlerwrite more %d write more cost %lld track_id error %d >= %d! track frames exceed max number %d AV frames exceed max number %d! mdat small, mdat_szie %d, frame size %d, need_space %d, mdat_size_fixed %d! Lower Layer IO error! muxer->pb->error:%d track %d frame sequence not continous, %u, %u! Bitrate: trackid %d, %d /home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_mp4_demuxer.cseek failed: %d! This is not valid mp4 format! frame buffer too small! utctime=%u, creation_time=%u SEEK to %llu failed! /home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_oldrecord_demuxer.c[oldrec]Demuxer is error! seek error! ret: %d read error! ret: %d read error ret: %d [oldrec]File format error or seek time not in curr file! start time:%d, utctime:%d seek time is not in curr file. oldrecord seek error! /home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_mp4_repair.cpps_uri_io_file_new fialed! track_count=%d track_id %d, codec_id %d, avtype %d video: %d, %d audio: channel=%d, bitwidth=%d, sample_rate=%d Got mr00=%d, moov=%d, mdat=%d %spps_mp4_muxer_new failed! seek to 0 offset in pb failed. seek to 0 offset in muxer->pb failed. read file pb error, %d write %s failed copy header success. file_siz %d, mdat_offset %d, mdat_size %d atom.type %x offset %d, atom.size %d, file_size %d tracks[%d].duration = %u read track count %d, i %d, offset %d offset %d, nr_avframes_all %d mdat_size %d write tailer failed, ret=%d repair success. Can not be repaired. -rep /home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_record_stream.cwrite tailer failed! 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ%.*s/%04dY%02dM%02dD%s/%02dH%02dM%02dS-%.2s%02d.mp4Video frame not continous: %u, %u new %s pps_uri_io_dir_mkdir failed! pps_mp4_muxer_new failed! write header failed! write packet failed! IO error, need return and process. /home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_record_ctrl.crecord ctrl send msg failed. ret=%d ./sdrecCalculate buffer size %d = %d KB frame size too large %d write avframe size %d failed %d! write avframe size %d, failed %d! record_enable %d, record_type %d, is_recording %d, event_duration: %d, now: %lld, record_end_time %lld, diff %lld record stopped! sdcard get space error, stop record and start fsck. sdcard usage abnormal, stop record and start fsck. record start failed! try to read frame size: ret=%d, frame_size=%d, tail: %d, head: %d record job already start! record job start failed! record job start OK! record job already stopped! record job stop OK! /home/rzq/code/4.2.x_2/camera-app/components/pps_record/pps_record_playback.cfree demuxer. free old record demuxer. playback stop, clear dctf info. SEEK Failed, not in the current file SEEK Failed, seek time not in the current file Locate mp4 and meari old failed! locate %s, locate_type:%d demuxer init failed! recfile :is_dst=%d, is_west=%d, timezone=%d pps_mp4_demuxer_read_header failed %d [oldrec]Get seek data error! [oldrec]oldrecord demuxer new failed! [oldrec]oldrecord seek error! 0:%lld, frame:%lld diff:%lld For this file, read over... locate next... locate next failed! generate filename... local :timezone=%d /var/audio0.wava+/home/rzq/code/4.2.x_2/camera-app/components/prodtest/pps_product_test.caudio file offset is %d, exceed max size %d audio g711 frame size error: %d audio g711 timestamp error: %u, last: %u video h264 main timestamp error: %u, last: %u video h264 sub timestamp error: %u, last: %u HTTP/1.1 400 PRODUCT TEST SENSOR NOT SUPPORT HTTP1.1 200 PRODUCT TEST H264 ENC HTTP/1.1 400 PRODUCT TEST CRYPTO NOT SUPPORT HTTP/1.1 400 PRODUCT TEST BUTTON NOT SUPPORT /home/cfg/sys_timer%s===startup_timeend_timeget blue led and red led status failed HTTP/1.1 500 PRODUCT TEST LED FAILED HTTP/1.1 200 PRODUCT TEST LED OK infrared led ctrl failed HTTP/1.1 500 PRODUCT TEST INFRARED LED FAILED HTTP/1.1 200 PRODUCT TEST INFRARED LED OK HTTP/1.1 200 PRODUCT TEST IRCUT OK HTTP/1.1 500 PRODUCT TEST IRCUT FAILED HTTP/1.1 200 IR TEST SET ON OK HTTP/1.1 500 IR TEST SET ON FAILED ONir_testOFFERRORirtest cnt %d HTTP/1.1 200 IR TEST GET OK Content-Type: application/json Content-Length: %d %s HTTP/1.1 500 IR TEST GET FAILED infrared_ircutwait for next infrared ircut switch! infr set failed! ircut set failed! got day night mode failed HTTP/1.1 500 DAY NIGHT MODE CUT FAILED set day night mode failed HTTP/1.1 200 DAY NIGHT MODE CUT SUCESS /home/sound/login.wavHTTP/1.1 200 PRODUCT TEST AUDIO OUTPUT OK can't process input audio got input audio failed got audio file %s success ls -l /var/remove file %s success HTTP/1.1 200 PRODUCT TEST AUDIO INPUT OK HTTP/1.1 500 PRODUCT TEST AUDIO INPUT FAILED get sdcard info failed HTTP/1.1 500 PRODUCT TEST SDCARD FAILED company: %s, total size: %s, used: %s, is_formated: %d create object failed HTTP/1.1 500 PRODUCT TEST SDCARD INTER ERROR total_sizefree_sizeto str failed HTTP/1.1 200 PRODUCT TEST SDCARD OK maxt speed 3x or 4x %d maxt not speed 3xxx %d profuct_ptz_testError, PPS_HAL_MOTOR_Init ret:%d left rotation ret %d stop rotation ret %d right rotation ret %d down rotation ret %d up rotation ret %d left rotation half ret %d S4C_V13A_H62S4S_V11_F23create ptz test pthread failed HTTP/1.1 500 PRODUCT TEST PTZ FAILED product test ptz ok HTTP/1.1 200 PRODUCT TEST PTZ OK wlan0wifi iwscan... iwconfig wlan0 mode mangediwscan failed HTTP/1.1 500 PRODUCT TEST WIFI FAILED wifi iwscan over, count = %d... create cjson array failed %02hhX:%02hhX:%02hhX:%02hhX:%02hhX:%02hhXssidmacsignalnoisewifi_signal %d, quality: %d, quality_range: %d, actual quantity: %d qualitychannelop_modeunkownop_mode_strbandwidthprotocol_namekey_onkeymgmt_modeprint cjson failed HTTP/1.1 200 PRODUCT TEST WIFI OK autoadhocmanagedmastermalloc jpegbuf failed HTTP/1.1 500 PRODUCT TEST SNAPSHOT NOT SUPPORT pps_venc_snapshot_cap ret = %d snapshot cap success, jpeg_size is %d! HTTP/1.1 200 PRODUCT TEST SNAPSHOT OK Content-Type: image/jpeg audio write failed, ret = %d product_test_handle_sound_playcreate socket failed create socket success binding socket failed bind socket success select error: %s! select timeout recv return %d recv error: %s! recved audio data length: %d audio write ret %d sound play cancled sound playing HTTP/1.1 200 PRODUCT TEST SOUND PLAY OPENED pthread create failed %d HTTP/1.1 500 PRODUCT SOUND PLAY FAILED sound play thread created HTTP/1.1 200 PRODUCT SOUND PLAY OK product test soumd stop ok HTTP/1.1 200 PRODUCT TEST SOUND STOP OK ipaddr err failed to set dev wlan0 queue length failed to get dev wlan0 queue length Dev wlan0 queue length %d we are already in factory playing test HTTP/1.1 200 PRODUCT TEST AV PLAY OPENED body p null %s body len %d HTTP/1.1 500 PARAM WRONG ipwe get ip %s v_portwe get video port %d a_portwe get audio port %d HTTP/1.1 200 OK HTTP/1.1 200 PRODUCT TEST AV STOP OK /home/cfg/test_info_save.conffread %s failed: %d test_info_save=[%s] parse %s to json failed %s convent to cJSON failed madeup_stateconvent cJSON to string failed wfopen %s failed: %s write file failed! HTTP/1.1 200 PRODUCT TEST BUTTON ZERO auth_stateaging_stateprofuct_ptz_spinwait for next ptz turn! left ret %d stop ret %d right ret %d up ret %d down ret %d create ptz cycle thread failed: %s /home/sound/restart.wavHTTP/1.1 200 PRODUCT start_aging ok HTTP/1.1 200 PRODUCT start_aging error, not 56565099 %02hhx:%02hhx:%02hhx:%02hhx:%02hhx:%02hhxread encrypt err!!! HTTP/1.1 200 encrypt_info get error licensesnsemi_stateparam1=[%s]len=[%d] param2=[%s]len=[%d] param1param2outstr=[%s] HTTP/1.1 200 OK HTTP/1.1 500 PRODUCT FAILED statusHTTP/1.1 500 PRODUCT TEST PIR FAILED HTTP/1.1 500 PRODUCT light_ctrl FAILED Content-Type: application/txt light_ctrl successproduct_test_handle_iperf3ipaddr = %s-- ---in iperf3_imple_thread ipbuf = %s /home/cfg/iperf3 -c %s > /home/cfg/iperf3.infochmod +x /home/cfg/iperf3/home/cfg/iperf3 -u -c %s >> /home/cfg/iperf3.info/home/cfg/iperf3in pps_iperf3_implement buf = %s HTTP/1.1 500 PRODUCT TEST iperf3 imple generating json root failed ipaddrHTTP/1.1 500 PRODUCT TEST iperf3 imple parse json ipaddr error HTTP/1.1 500 PRODUCT TEST iperf3 imple json ipaddr too long ----iperf3 ip = %s ---iperf3 create thread error HTTP/1.1 500 PRODUCT TEST iperf3 imple creating thread failed after sleep HTTP/1.1 200 PRODUCT TEST iperf3 imple begin ok Content-Type: text/plain implereplyHTTP/1.1 404 PRODUCT TEST iperf3 api not found ------ev_handler_iperf3 finished ev_handler_iperff not factory_mode hm == NULLGETPOSTroot = NULLaddrip = %s HTTP/1.1 500 Internal Error Content-Type: text/html Connection: close Internal Errorev_handler_pps_iperf3_download not factory_mode ----MG_EV_HTTP_REQUEST HTTP/1.1 200 OK Content-Type: text/html Connection: close Upload example.


%.*s http multipart request malloc x data wrong MG_EV_HTTP_PART_BEGIN HTTP/1.1 500 Failed to open a file Content-Length: 0 -----MG_EV_HTTP_PART_DATA HTTP/1.1 500 Failed to get space Content-Length: 0 get part data len %d bytes_written %d -----MG_EV_HTTP_PART_END HTTP/1.1 200 OK Content-Type: text/plain Connection: close Written %ld of POST data to a file /mnt/mmc01/iperf.tar.gzgot newest xxx, we need to exec fwrite option wtitten ok tar zxf /mnt/mmc01/iperf.tar.gz -C /usr/testHTTP/1.1 200 PRODUCT TEST OK /led/infrared_led/ircut/sensor/audio_output/audio_input/sdcard/button/wifi/h264_enc/snapshot/crypto/ptz/sound_play/sound_stop/ir_test_off/ir_test_on/ir_test_get/av_play/av_stop/day_night_cut/finished_product_testing/start_aging/auth_info/auth_state/device_verify_auth/pir_status/light_ctrl/iperf3sysinfomodeldevTypeprodNoprodDatep2p_factory_typep2p_idmacAddrmacAddr2lens_infolanguagedeviceClassencryptVeroemCodeidentitylicence_typelicence_idlicence_keyoem_uuidoem_authkeyfirmwareversionabnormal_rebootWiFi_MACtpHTTP/1.1 200 OK Content-Type: application/json Content-Length: %d %slens info %s oem_uuid is %s licence_type is %d licence_id is %s encrypt write ok! HTTP/1.1 500 NOT Support HTTP/1.1 400 No encrypt information Content-Type: text/html Connection: close No encrypt information-----MG_EV_HTTP_PART_BEGIN /home/cfg/sounds.tar.gzproduct_test_handle_upgradeupgrade success upgrade failed HTTP/1.1 200 OK Content-Type: application/json Connection: close {"percent": %d}HTTP/1.1 500 Internal Error partial upgrading... upgrade ctrl failed ptest_downptest_downshortreadn: param err.readn: select failed, %s recvrecv, %s writen: param err.writen: select failed, %s EINTRSend() error, 0x%x recv end/home/rzq/code/4.2.x_2/camera-app/components/prodtest/pps_wifitest_client.cinput data error Inerval Transfer Bandwith%d.00-%d.00 sec %f MBytes %f Mbits/sec 0.00-%d.00 Transfer = %fMBytes, average Bandwith = %fMbits/sec {"SendBandwith":"%f", "RecvBandwith":"%f"}input error socketconnectpthread_create recv_message ret: %d pthread_create bandwith_count ret: %d client_end !!!!!!!!!!!!!!!8090/home/rzq/code/4.2.x_2/camera-app/components/restful_server/restful_server.cpps_mg_printf(): connection or buf is NULL pps_mg_printf(): Invaild args unknow type pps_mg_printf(): Invaild args unknow status code OKFAIL0application/jsontext/plaintext/htmlimage/jpegHTTP/1.1 %d %s Content-Type: %s Content-Length: %d Connection: closed %sCore fault, connection is null Invaild Arg, parse json failed basic auth mg_base64_decode() failed :%dbasic_auth(): parse basic_auth failed basic auth pass pps_http_parse_header(): hdr is null Authorizationusernamerealmcnonceresponseuriqopncnoncedigest_auth(): http_message point is null get user info failed: %d set_socket_keeplive: SO_KEEPALIVE, setsockopt ERROR : %d set_socket_keeplive: TCP_KEEPIDLE setsockopt ERROR : %d set_socket_keeplive: TCP_KEEPINTVL, setsockopt ERROR : %d set_socket_keeplive: TCP_KEEPINTVL,setsockopt ERROR : %d parse http failed: %d HTTP REQUEST: %.*s //tvclient/searchTHIS REQUEST DON'T NEED AUTH auth header is null Basicbasic auth failed Digestdigest auth failed invailed auth header WWW-Authenticate: Digest realm="www-user@ppstrong",qop="auth",nonce="%ld",opaque="%ld" /index.htmlSET SD CARD RECORD MODE SUCCESS...SET SD CARD RECORD MODE FAILED.../sd/record/set/mode/0/sd/record/set/mode/1/GETev_handler_get_sd_store_mode(): create cJSON object failed modetimeev_handler_get_sd_store_mode(): change cJSON object to string failed 0.0.0.0discoveryuuidurn:uuid:uuid:%shttp://schemas.xmlsoap.org/ws/2004/08/addressing/role/anonymoushttp://schemas.xmlsoap.org/ws/2005/04/discovery/ProbeMatchesurn:uuid:dn:NetworkVideoTransmitter tds:Deviceonvif://www.onvif.org/type/video_encoder onvif://www.onvif.org/Profile/Streaming onvif://www.onvif.org/Profile/G onvif://www.onvif.org/hardware/vSpeed 2 onvif://www.onvif.org/name/vSpeed 2 onvif://www.onvif.org/location/http:///onvif/device_service http://127.0.0.1/devinfo/:10snfactory_codefactory_code_strmodeltpp2p_uuidipmaskgw%02hhx:%02hhx:%02hhx:%02hhx:%02hhx:%02hhxmacinterfaceversion{"discovery":""}ev_handler_search_info(): parse volume failed /sd/record/set/enable/on/sd/record/set/enable/offenableCore fault, nc is null error, parse json failed cJSON error: create cJSON object failed do_handler_sd_format_disk(): sd card is formating now mountpps_device_sdcard_format failed: %d ev_handler_sd_format_disk_percent(): create cJSON failed formatpercent/set/enable/get/enable/get/mode/set/modeev_handler_record_search_by_month(): prase cJSON object failed videoidrec_typemonth%04d%02dev_handler_record_search_by_month(): create cJSON array object failed ev_handler_record_search_by_month(): change cJSON object to string failed parse string to cJSON object failed day%04d%02d%02dday_list is null, got day_list failed create string array cJSON object failed change cJSON object to string failed parse cJSON object to string failed startend%04d%02d%02d%02d%02d%02dcreate cJSON object failed get_wlan_info_json(): wlan is null wlan0interface_is_used() failed: wlan0 interface is not used! pps_device_get_wlan_cfg() failed: %d ssidgatewaysignalget_eth_info_json(): eth is null eth0interface_is_used() failed: eth0 interface is not used! wlanethcur_network_modenetwork_supportedppsdev_get_network() failed get storage info failed: %d create cJSON object failed: %d indexstatusrwtypetotal_spacefree_spacefstypeset sd event ev_handler_get_sd_event(): create cJSON failed ev_handler_get_sd_event() failed: %d durationcontinuityev_handler_get_sd_event(): change cJSON object to string failed set event mode failed POSTenable=the c_enable is %s parse query string failed get enable value %d ev_handler_led_set(): get enable value failed don't get enable, invaild post request pps_device_set_led_status(%d) over error: write to file failed ev: %d reboot return %d! ev_handler_device_reboot(): pthreadSpawn failed %d /devices/led/allrequest query is NULL strdup failed set mirror query: %s &mirror=request query can't find mirror set mirror type: %s is not http request mirrorpps_device_time_get_timezone() failed: %d ev_handler_get_settings(): create cJSON object failed timezone2timezoneev_handler_get_settings(): change cJSON object to string failed ev_handler_set_timezone(): parse cJSON object failed pps_device_time_set_timezone failed: %d ev_handler_snapshot(): malloc failed pps_media_snapshot() failed: %d handler_run_cmd_return_val_get ev_handler_run_cmd_return_val_get(): create cJSON failed pps_get_web_cmd_buf failed return val is %s valueev_handler_run_cmd_return_val_get(): change cJSON object to string failed post cmd ev_handler_run_cmd_return_val_set(): parse cJSON object failed cmdev_handler_run_cmd_return_val_set(): parse cmd failed pps_run_web_cmd failed current val is %s create json object failed devnameserialnosoftwareversionhardwareversionfirmwareversionidentityauthkeydeviceidaaapidget wlan0 mac failed: %d WiFi MACETH MACparse cJSON object failed passwdpps_device_set_admin_pd() failed do reset /home/cfg/config/home/cfg/display.info/home/cfg/alarm.cfg/home/cfg/wifi.infopps_device_reboot failed :%d upgrading, reject update request urlis upgrading other error HTTP/1.1 502 tuya upgrade error percentupgrade_percentdownload_percentpercent: %d, upgrade_percent %d, download_percent: %d home mode away mode ev handler humidity temperature_ctemperature_errorhumidityhumidity_errorcpu_temperature_ccpu_temperature_errorshould use post method psts/reboot/setptzmove/firmware_upgrade/upgradeprecent/storageformat/formatpercent/deviceinfoDon't find the uri invailed param %s not exsit read %s file to buf start ropen %s with read mode failed: %s read over buffer is not enough total readed cnt: %d, next need read cnt: %d %sclose %s failed: %sinvaild param buf is not enough read content to buf failed: %d /home/cfg/sys_time/home/cfg/patch_wifi/home/cfg/watchdog_soft_reboot/home/cfg/excep_reboot_get_abormal_reboot_info(): open file failed : %s ===startup_timeend_timeread file %s to buf failed: %d ev_handler_sys_info(): create cJSON object failed %dd%dh%dm%dscpumemuptimeabnormal_rebootev_handler_sys_info(): change cJSON object to string failed {"log": "_get_abormal_reboot_info() failed: %d ", "reboot_count": %d}returned reboot device.
Reset to factory setting!ev handler factory reset /sys/iperf/oniperf -s -Diperf -s -u -D/sys/iperf/offiperfservices telnetd startservices telnetd stopstartedstoppedTelnetd service %s okev_handler_sys_ctrl() ev is %d /info/reboot/info/factory_reset/iperf/telnetd/switchdsp debug info: uri: %s, postdata: %s dsp debug out: %s ttt ssys ctrl ev %d ev_handler_get_text_file(): hm is null ev %d filename = [%s] hm->uri.p=[%s] hm->uri.len=[%d] ev_handler_get_text_file() open file failed: %s VOLUME OPERATION SUCCESS...VOLUME OPERATION FAIL.../media/audio/input/volumevolume/media/audio/output/volume/media/audio/output/volume/vol input = %d /media/audio/input/volume/vol output = %d /sys/dsp/proc/media/audio//flash/identity/product_test/flash/iperf3/download/iperf3/flash/encryption/flash/upgrade/all/flash/upgrade/percent/flash/upgrade/ppstrong/flash/upgrade/release_package/devicesPPS_EV_OPEN_8090 init_8090_port_servicerestful_webserver_init(): mg_bind failed Starting multi-threaded server on port %s restful_webserver8090_open_eventpps_mg_printf::tuya_ipc_notify_generictuya_ipc_get_service_time_forcetuya_ipc_get_utc_timetuya_ipc_get_local_timetuya_ipc_notify_motion_detecttuya_ipc_check_in_dlstuya_ipc_init_sdktuya_ipc_notify_with_eventtuya_ipc_start_sdktuya_ipc_dp_reporttuya_ipc_get_service_time/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/tuya_ipc_api.cinput is nullarm-anykav200-linux-uclibc-4.8.5tuya_iot_init err %dtuya sdk wifi mode is err %dtuya_iot_wf_soc_dev_init err %dtuyainvalid percent %d. mqtt report download percent:%d tuya_iot_dev_upgd_progress_rept err:%d/proc/meminforbMemTotal: %lu %79s Mem: %lu %lu %lu %lu %lu %luMemFree: %lu %79s MemShared: %lu %79s Buffers: %lu %79s Cached: %lu %79s total is %lu mfree is %lu cached is %lu ipc get service time %d %dno service time now, force syncgot service time %d %dinput errortype[%d] not supportinvalid inputsnap_nullnotification content len is too big, 150KB maxsnap_largejpegsize:%d type: %dnotify EVENT_ADD_SPACE_TIME hasn't reach,should return too_fastmalloc notification message failedmalloc_errupload_errdoorbell_errsnap_errunsupported notify data type %dtype_errdoorbellac_doorbellsize:%d type %dmq43_errsend mq donemalloc_msg_errsend snap doneup_msg_errsend dp doneparam is nullnotify_nullEVENT_ADD_SPACE_TIME hasn't reachingnotification_message_malloc failedtype is invalid.%dparam error, buffer error param error, type error param error, name error name_errNOTIFYCATION MALLOC FAILED imageresourcesthe size of arr is too small %u < 2Rev:%sSource:%dcJSON_Parse errordata format errorParse ssid:%s token:%sParse passwd:%s---tuya_ipc_log_setting begin--- ---tuya_iot_set_log_attr error--- ---tuya_iot_set_log_file error--- ---tuya_ipc_log_setting end--- echo_chrome_warndevIderror_codereport fail, %d %s %d %sstartup_notifyreport fail, %d %sreport p2p buff %stuya_ipc_dp_report_asynctuya_ipc_upgrade_progress_reporttuya_ipc_get_heartbeat_datatuya_ipc_direct_connecttuya_ipc_report_living_msgtuya_ipc_report_p2p_msgtuya_ipc_dp_report_synctuya_ipc_log_settingtuya_ipc_notify_door_bell_press_generictuya_ipc_cloud_storage_inittuya_ipc_cloud_storage_pausetuya_ipc_cloud_storage_event_deletetuya_ipc_cloud_storage_resumetuya_ipc_cloud_storage_set_event_typetuya_ipc_cloud_storage_event_start__add_event_to_listtuya_ipc_cloud_storage_uninit__update_md5_encrypt_keytuya_ipc_cloud_storage_get_event_status__update_cloud_storage_config__append_to_cloud_storage_buffertuya_ipc_cloud_storage_event_notify__cloud_storage_iot_event_trigger_callback__prepare_working_buffer__update_slice/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/cloud_storage/tuya_ipc_cloud_storage.cerr log is NULLupload buffer data size %d to file %shttpsmedia/av%d_%04d.medianew media file name %sfail to upload media fileorder expire or remote server errorfail to get cloud config ret %dstore mode update to %salltimeazure%s.%supdate cloud storage config failreceive cloud storage message from server[action:%s store_mode:%s]not inited, just returnstorekeep goingnew cloud type -> %dorder change done{"startTime":%d,"payloadInfo":"{\"v\":1,\"vType\":\"%d\",\"vFps\":%d,\"vWide\":%d,\"vHigh\":%d,\"aType\":\"%d\",\"aSampling\":%d,\"aBitwide\":%d,\"aChannels\":%d}","mtu":%d,"enKeyMd5":"%s"}{"startTime":%d,"payloadInfo":"{\"v\":1,\"vType\":\"%d\",\"vFps\":%d,\"vWide\":%d,\"vHigh\":%d}","mtu":%d,"enKeyMd5":"%s"}httpc_ipc_cloud_storage_event_notify fail! needUpdatefail to get value for key needUpdateencryptKeyfail to get value for key encryptKeyinvalid key value for key encryptKey{"startTime":%d,"endTime":%d}upload rest media buffer size %d to %sinput is null or the len is bigger than 48md5_valuemd5_lenencrypt_key_valueencrypt_key_lenwrite buf:%skvs_write fails %s %dmd5_key_value write successmd5_encrypt_keywrite key_key file failed. new encrypt key and md5 saved%d_0000.mediastart: media_file name %scloud storage order invalidencrypt key updatedfail to notify cloud start 2, ret %dfail to notify cloud start, ret %dorder expireupload frame type %d, timestamp %llunew day startupdate groupupdate slicefail to upload slicememory insufficient to buffer data[%d + %d > %d]fail to upload slice %dP frame arrive before I frame, skipupload frame doneiot_wd_common_read fails %s %dread buf:%sread len fails %dread len fails %s %d %d %dmalloc fails %dgw base read success{"v":2,"startTime":%d,"endTime":%d,"eventType":%d}event index %d stopforce event %d stop doneno data for iot event{"v":2,"startTime":%d,"endTime":%d,"eventType":%d,"sourceId":%s}new event index %d, id: %u, added: type %d,notify type %d[%d-%d]null inputduration too big %dcloud storage is disabled nowreceive cloud storage event trigger via mqtt action %s durantion %dpicpic_vunsupported actionfail to malloc bufferfail to get snap or oversize %dcloud storage type error %dfail to add eventfail to malloc buf"ext":%s%d.jpgmedia/jpegcloud_storagecloud storage loop time %u, enable %d, type %dactive require cloud storage configfail to update cloud storage configget pre record av neededevent overlap, skip tp next I frameevent overlap, skip to next audio frameno event exist now, stop uploadingcloud storage loop endfree media_bufferinit cloud storage beginmain video stream bitrate too big: %dcloud storage already initedcreate log seq for cloud storage fail..%dread key_key file failed. len error md5_len %d, encrypt_key_len %dMD5 check failed! encrypt key and md5 check passuse current encrypt keyfail to malloc buffer for cloud storage size %d. [bitrate %d, slice_duration %d]cloud storage seize %d bytes memory for media data, each slice %d secondspthread_attr_init failed ret[%d]cloud task create failed ret[%d]init cloud storage success0000__check_md5_encrypt_key fail, need update from serverpre_record_time error:%dcloud storage not initedringbuf not inited, can't set cloud pre recordpre_record too long, pre record %d seconds, ringbuf max :%d seconds. valid size[0 ~ (ringbuf_max -2)]invalid input snapshot_size %d type %d(%d) duration %d(%d)%u.jpgadd event start done, event_id %d time %d-%ddelete event %ddelete event donestart event type %d, size %dinvalid input snapshot_size %dtuya_ipc_cloud_storage_event_start support only type md and doorbell, use tuya_ipc_cloud_storage_event_add insteadevent type %d on going now, stop it firstnew event added to list, time %dnew event start done, time %d-%dstop event MDstop event donestop event timeout, force returninvalid event typeevent notify for type %d id %devent notify doneevent[%d] type set to %devent type set done, ret:%dpause cloud storagecloud storage is already disabled nowpause cloud storage doneresume cloud storagecloud storage is already enabled nowresume cloud storage doneuninit beginuninit done__upload_media_framecloud_storage_start_notify__start_cloud_storagetuya_ipc_cloud_storage_event_stop__cloud_storage_order_change_callback__check_md5_encrypt_key__stop_cloud_storage__update_group__error_log_seq_cbtuya_ipc_cloud_storage_set_pre_record_time__base_md5_key_write__stop_event_if_needed tuya_ipc_cloud_storage_event_add__thread_cloud_storage__force_all_event_stop__base_md5_key_readGetEncryptorInstanceDecryptCheckAndUpdateEncKeyOpensslAES_CBC128_decryptOpensslAES_CBC128_encrypt/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/encrypt/tuya_ipc_encrypt.cfail to get value for encryptKeyinvalid key value for encryptKeycloud_enc_keyencryptKey [%s]check encrypt key fail, because encryptor not initcloud encrypt key MD5 check failed! CHECK cloud enc key successCHECK cloud enc key fail, update from cloudparameter error Unable to set encryption key in AES... no encrypt key, update0123456789abcdefUnable to set decryption key in AES... have some error read local cloud encrypt key fails ..%duse key :%sUpdateEncryptInfoEncrypttuya_ipc_rtc_msg_parseiot_register_extra_mqt_cbtuya_ipc_3rd_party_streaming_parseprotocolEchoShow/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/tuya_ipc_mqt_proccess.cecho show callback is not registered===============rtsp url:%s ChromeCastchromecast callback is not registered===============rtmp url:%sget cloud storage reqaction:%s abortcloud storage callback is not registeredstoreModestoreMode:%s aiai_detect_storage_cb callback is not registeredmodeaiMode:%s aiAbortaiAbortMode:%s cloud storage event remote triggercloud storage event callback is not registereddata nullaction nulldurationduration nullext nullaction:%s, duration:%d doorbell_status changed triggerdoorbell status callback is not registeredevent:%s, data:%s adddeletefaceIdsroot_json is nulldata failediot_mqc_app_register_cb err err:%d id:%derr: %d, id: %diot_register_extra_mqt_cb donetuya_ipc_cloud_storage_event_request_parsetuya_ipc_cloud_storage_order_request_parsetuya_ipc_local_ai_data_sync_parsetuya_ipc_doorbell_status_parselog_notify_err_log_seq_cbnotify_log_seq_initnotification_message_upload_genericnotification_message_freenotification_content_upload_from_buffernotification_message_upload_with_timenotification_snapshot_message_uploadnotification_message_malloc0123456789ABCDEF/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/tuya_ipc_notification.ccloud config Not Initedcloud_get_detect_storage_config fail, ret %dget_cfg_errrequire ca fail, ret %dget_ca_errcloud config Init SuccessBucket:%sAdd Key %s To Msg[%d]Add Obj %s To Msg[%d]notification malloc size:%dnotification_message_malloc error. size:%dnotification_message_upload hava nothing to report msg_nullnotify DP:%d timeout:%ucount:%d and len:%dnotification_message_upload malloc failed {"v":"3.0","%s":"%s","%s":[bucketfilesfinal:%s["%s","%s"],notification_message_upload failed:%d notification_message_upload success{"v":"3.0","%s":"%s",%s,"%s":"%s","%s":"%s","%s":"%s","%s":[with%04d%02d%02dT%02d%02d%02dZ%04d%02d%02d%s/%s/%s/%s/aws4_requests3X-Amz-Algorithm=AWS4-HMAC-SHA256&X-Amz-Credential=%s&X-Amz-Date=%s&X-Amz-Expires=%d&X-Amz-Security-Token=%s&X-Amz-SignedHeaders=host&bucket=%s&v=%shost:%s.%s%s %s %s %s %s %s %shostUNSIGNED-PAYLOADAWS4-HMAC-SHA256 %s %s/%s/s3/aws4_request %sMalloc Failsmalloc_signMalloc Failmalloc_urlmalloc_tokenGET%s%%2F%04d%02d%02d%%2F%s%%2Fs3%%2Faws4_requesthttps://%s.%s%s?X-Amz-Security-Token=%s&X-Amz-Algorithm=AWS4-HMAC-SHA256&X-Amz-Credential=%s&X-Amz-Date=%s&X-Amz-Expires=60&X-Amz-SignedHeaders=host&bucket=%s&v=1.0&X-Amz-Signature=%s[%s]https://%s%s/%s%s%s&v=1.0&bucket=%s&typath=%s###url:%s %s %d /%s%s?security-token=%shttps://%s.%s%s?Expires=%d&OSSAccessKeyId=%s&Signature=%s&v=1.0&bucket=%s&security-token=%soss uri:%s snapshot_message_upload failed:%d snapshot_message_upload successnotification_content_upload_from_buffer illegal input param_errnotification from buffer. suffix:%s data_len:%d%d.%simage/%snotification_content_upload_from_buffer init failed:%d content_errenpic_errnotification_content_upload_from_buffer put failed:%d put_fail__message_pack error:%dpack_errnotification_content_upload_from_buffer success %s illegal input pngpicture not supportvideo not supportunsupported type %snotification_content_upload_from_buffer_generic success create log seq fail..%dnotification_content_upload_from_buffer_generic__message_pack__content_check_init__p2p_video_send_proc__p2p_session_trans_speaker_stop__p2p_sessions_proc__p2p_session_cmd_parsetuya_ipc_playback_send_audio_frame__p2p_audio_channel_transtuya_ipc_get_client_conn_infotuya_ipc_playback_send_fragment_end__p2p_thread_exittuya_ipc_tranfser_secret_mode__p2p_pack_h264_rtp_and_send__p2p_session_trans_pb_video_starttuya_ipc_tranfser_init__p2p_mqtt_listen_sessions__p2p_session_trans_pb_video_stop__p2p_session_trans_pb_audio_stop__p2p_session_init__p2p_session_trans_audio_start__p2p_session_detech__p2p_session_trans_audio_stop__p2p_speak_overduetuya_ipc_tranfser_quit__p2p_sessions_speaker_task__p2p_v3_login_inittuya_p2p_rtc_moto_signaling_cbtuya_ipc_playback_send_video_frame__p2p_wait_concurr_idle__p2p_pack_h265_rtp_and_sendtuya_ipc_live_send_audio_frame__p2p_audio_databits_transgw_p2p_mqtt_data_cbtuya_ipc_playback_send_finish__p2p_session_pack_resp__p2p_audio_databits_trans2tuya_ipc_live_send_video_frame__p2p_pack_aac_rtp_and_send__p2p_pack_g711_rtp_and_send__p2p_session_trans_speaker_start__p2p_audio_channel_trans2tuya_ipc_4_app_download_data__p2p_session_trans_pb_video_resumetuya_ipc_tranfser_closetuya_p2p_rtc_signaling_cb__p2p_session_trans_video_start__p2p_video_codec_trans__p2p_session_trans_pb_audio_starttuya_p2p_rtc_log_cbtuya_p2p_rtc_auth__p2p_session_trans_video_stoptuya_ipc_4_app_download_status__p2p_audio_codec_trans__p2p_session_all_stop__p2p_send_rtp_data__p2p_avinfo_transfer_savep2p_err_log_seq_cb__p2p_get_userinfo__p2p_audio_codec_trans2__p2p_ext_protocol_pack__p2p_audio_sample_transencrypt/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/p2p/ppcs/tuya_ipc_p2p.cclient num [%d](%s)param errormalloc failed len[%d]p2p Write failed ret = %dinput errorclient[%d]channel[%d]Check_Buffer not enough buffer_size[%d] len[%d] session[%d] channel[%d]Write data failed [%d][%d]session[%d] cmdframe len too big[%d]unlikely errorvideo_frame_data not supportget_annexb_nalu error offset [%d] nalLen[%d] data_len[%d]pack h264 errordata[%p] client num [%d]aac audio len[%d]parse aac frame length = %d len[%d]calc len error parse index[%d]aac_len[%d]len[%d]parse aac i[%d] data_len[%d]aac data too big [%d] [%d]parse aac i[%d]data too big %dtuya_ipc_pack_pcm_rtp failedcur send audio type[%d], into p2p video send, index %dp2p_videovideo send proc alive [%d][%d] stat[%d]cmd[%d]session[%d] I Frame Send ok len[%d] pts[%llu] count[%u]timestamp[%llu]video send failed count = [%d] no video data count = [%d] audio send failed count = [%d]session[%d] audio Frame Send type[%d] count[%u]no audio data count = [%d] Begin to session detechsession[%d] staticCnt[%u]must closesession[%d] detech staticCnt[%d]lstCnt[%d]vIFrameCnt[%d]|%d|%04d|%04dtask exitsession detect runapp send speaker data size error[%d] session closed[%d] exit speaker task pthreadId[%d] read data failed ret[%d] session[%d] wholeData[%d]readsize[%d]tmpsize[%d]curRead[%d]session[%d],data error pthreadId[%d]session[%d] read data errorun likely[%d]not support type[%d]session[%d] speak data overdua time[%u~%u] time[%u~%u]session[%d] recv speaker codec[%d][%d] cnt[%d] len[%d]spk|%d|%dspeaker not startspeaker session not match [%d] [%d]video type error[%d]un likelysession[%d] wait ...session[%d] concurr idle[%d][%d]unlike errorNew Thread To proc New Session:%dsession [%d] alivesession[%d] was close by client ret[%d]session[%d] ###### error ret = [%d]session[%d] read data error mark[0x%x]event call back not initmalloc failed[%d][%d]pb by day [%u~%u] [%u~%u] [%u~%u] [%u~%u] [%u~%u] [%u~%u] [%u~%u] [%u~%u]pb by day [%u~%u]pb by day [%d][%u~%u]pb queryrecv cmd [%d] errorsession [%d] recv chn[%d]param error or video startedsession[%d] event cb not enablesession[%d] [%d] pb pausesession[%d] [%d] pb already start,force pausesession[%d] pVideoData malloc failedsession[%d] rtpBuff malloc failedsession[%d] [%d] send video start to devsession video start[%d]param error or session cmd[%d]CTRL VIDEO STOP failedsession[%d] [%d] send video stop to devsession[%d] video stopparam error or audio startedsession[%d] [%d] send audio start to devparam error or audio not startsession[%d] [%d] send audio stop to devsession[%d] cur cmd[%d]CTRL ERROR chn[%d] op[%d]session[%d]video running force closesession[%d] audio already opensession pb audio stop[%d]cur session cmd[%d]cur session cmd[%d] not in pauseCTRL chn[%d] op[%d] cur not supportspeaker already start cb[%p] session[%d]cmd [%d] errorCTRL AUDIO session[%d]chn[%d] op[%d]session[%d] dl already startedupdate reqId[%d]session[%d] dl already stopsession[%d] dl already pausesession[%d] dl already resumesession[%d] dl already canclenot support op[%d]CTRL CMD ERROR[%d]session[%d]exitclose session[%d]session[%d] cmd[%x] wait for video and audio task exit...init over session[%d]CTRL VIDEO START failedpthread [%d] exit errorlen is too largermqc_p2p_data_rept_v41 error/av/moto/%s/d/%stuya_p2p_rtc_set_signaling errorBegin to Listen mqtt p2p client connects In Threadp2p_mqttmqtt p2p LISTEN session........v3 listenlisten failed session[%d] cur in secret mode exitlisten ok session[%d]get userinfo error session[%d]auth successno value able session please check process resend p2p passwd to servicecreate p2p video send task failed session[%d]idx[%d]force close session[%d]ret[%d]__p2p_video_send_proc create session[%d]idx[%d]session[%d] proc_task start failedcreate p2p sessions. cur online session num = %dget userinfo timeout session[%d]||check userinfo errorClose session[%d] %08xh: %02x P2P API Version: %d.%d.%d.%d no encryptmqtt p2p init failedcreate mqtt p2p listen task failed_mqtt_p2p_listen_sessions createInput Is Null Input Is Illegal The Transfer Module Is Inited gw activedp2p_modp2p log seq fail..%dp2p max_client_num[%d]p2p init media info:user set client count too big ,set to defaultvideo codec[%d] fps[%d] gop[%d]height[%d] width[%d] bitrate[%d]audio codec[%d] sample[%d]databits[%d] channel[%d]need speaker audio codec[%d] sample[%d] databits[%d] channel[%d] defLiveMode[%d]get p2p auth info failedp2p did[%s] apiLicense[%s] initString[%s]support p2p type = %dp2p v3 init failedp2p v3 init okspeaker start failedspeaker task create successcreate p2p session detech task failed__p2p_session_detech createThe Transfer Module not Inited stepp2p_closeuser close session[%d]The Transfer Module Is Not Initedp2p_quitwait for proc task exit...live input video frame invalidvideo_frame_type error[%d]live input audio frame invalidsesion running status[%d]pb input video frame invalidpb video send errorpb video send cnt[%u]client[%d] fragment end [%u-%u][%d-%d]sesion running status[%d] cur cmd[%d]pb finish session[%d] client[%d] pbIndex[%d] reqId[%u]client[%d]finishinput param errorp2p quit or not initcnt[%d]cnt2[%d]malloc failed [%d]unlikely error [%d][%d]input pram errorclient [%d] download not startframe type[%d] size[%d] totol len[%d] spilt[%d]buffer[%d] size too bigsend failed to appCheck_Buffer failed session[%d]send finish to appset secret mode [%d]set secret mode over__p2p_audio_sample_trans2tuya_ipc_upload_skillstuya_ipc_skill_enable/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/skill/tuya_ipc_skill.cskill buf is not enough \"sdk_version\":\"4.7.10\",\"aiDetect\":%d,\"cloudGW\":%d,\"cloudStorage\":%d,\"doorbellStorage\":%d,\"localStorage\":%d,\"lowPower\":%d,\"video_num\":%d,\"webrtc\":%dupload data: %sunknown skill(%d) __fill_skillsPrepareAuthBufferFillCloudGwSkillsGetTStreamerInstancePrepareStreamBufferReceive/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/TStreamer/tuya_ipc_streamer.cdisconnectstop speaker...prepare auth cmdID %d status %d{"devId":"%s","authorization":"random=%s"}%s:%s:%s:%s:%sstring to sign [%s] size %d{"devId":"%s","statuscode":%d,"authorization":"signature=%s"}unsupported cmd ID: %dauth message %sauth message size=%d+%d+%d+%dfail to mallocnull mqtt messageheadermsgNo header or msg in messagesessionIdmoto_idencKeyMd5get encKeyMd5:%susernamepasswordstreamTypeaddress %s:%d, auth %s:%s, sessionID %s, stream type %dset status to E_STREAMING_STARTmqtt message format errorstart streamingalready streaming %dstart streaming done\"videos\":[{\"streamType\":2,\"codecType\":%d,\"sampleRate\":%d,\"profileId\":\"\",\"width\":%d,\"height\":%d},{\"streamType\":4,\"codecType\":%d,\"sampleRate\":%d,\"width\":%d,\"height\":%d}],\"audios\":[{\"codecType\":%d,\"sampleRate\":%d,\"dataBit\":%d,\"channels\":1}]CLOUD GW skill info:%sstreamer has no motoID!%s%s/d/%s/av/moto/Send mqtt to topic:%sstreamerThreadStreaming thread startwait gw init ...local key %sconnect to %s:%dlocal/home/cj/workspace/test/testStreamer.binfail to open /tmp/testStreamer.bin, errno %dfail to connect to server, ret %dconnect success, ready to start authSelect failed,errno:%dselect timeoutservice stopped by server!frame len error!!!!Signature error!receive cmd frame id %djson parse fail. Rev:%sauthorizationno authorization exist for response methodauth string[%s]unexpected format authinfo [%s]%s:%s:%s:%ssign not match [%s][%s]check server sign PASSstatuscodeno statuscode exist for complete methodauth complete, 200 OKauth 401 failset streamType to %dno sessionId existsessionId errorstatusset speaker...audioCodeccodecTypesampledateBitchannelsunknow cmd ID: %dNot auth ready for receive audio datareceive unknown frame type %dunexpect streamType %dnode type wrongencrypt failfail to malloc %d buffer for sign calculationchannel[%d] send data fail ret %dnormal disconnect case [%d]tstream init startfail to malloc buffer for streamingtstream init doneConnectCheckServerAuthInfoMotoSendMqttMessageDisconnectParseCmdFrameSendStartStreamingProcessMqttMessageCheckRecvSignatureThreadStreamingtuya_ipc_webrtc_pack_audiotuya_ipc_webrtc_audio_inittuya_ipc_webrtc_pack_videotuya_ipc_webrtc_inittuya_ipc_webrtc_stop/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/p2p/ppcs/tuya_ipc_webrtc.cget first audio, channel(%d)send audio frame failed, ret = %d get first video, channel(%d)video get sps pps info... data len too short %dnalu header error, %d %d %d %dsend video frame failed, ret = %d begin___, (%d) sess%dend___, no need to start webrtc server! end___ begin___, id: %d end___, index: %d, channel: %d begin___ end___ audiocbk_hdl(%p) mbedtls_md_setup returned -0x%04x ret: %d (%s : %s) tuya_ipc_webrtc_session_proctuya_ipc_webrtc_create_sessiontuya_ipc_ring_buffer_get_max_buf_secstuya_ipc_ring_buffer_find_pre_audio_by_frametuya_ipc_ring_buffer_find_pre_video_by_frametuya_ipc_ring_buffer_get_video_frameIsDelayedTooMuchtuya_ipc_ring_buffer_get_pre_audio_frametuya_ipc_ring_buffer_clean_user_statetuya_ipc_ring_buffer_get_audio_frametuya_ipc_ring_buffer_anchor_user_to_nodetuya_ipc_ring_buffer_inittuya_ipc_ring_buffer_if_delay/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/ring_buffer/tuya_ring_buffer.cdelay too much(seqNo:%d->%d)delay too much(addrDistance %d>%d-%d)Wrong buffer ring index channel:%dbitrate invalid for channel %d [%u]fps 0 invalid for channel %dRingBuffer Channel:%d Already InitedInit Ring Buffer. channel:%d bitrate:%u fps:%umax 10 seconds buffer for real-time considerationFail to alloc mem for buffer ring channel:%d size %dRing buffer malloc %d bytes for channel %dFail to alloc mem for buffer ring channel:%d nodes %dInit Ring Buffer success: channel:%d size:%u nodes:%uRingBuffer Channel:%d Not Initeddata over size:%d>%dappend to channel:%d size:%u type:%d pts:%lldFail to get %u size from pool(%u) channel:%d reach end,restart.channel:%d tailOffset:%u dataSize:%unot reach end.channel:%d tailOffset:%u dataSize:%ucannot get data write posappend done, channel:%d node index:%d timestamp:%llduser index invalid %d user %d get target frame(type %d) in channel %dnode index %d, seqNo %dNo video data inside ring buffer. GET starts before PUT? channel %dchannel:%d user:%d retry:%d userInfo->status %d node index %d, head index %duser %d get latest frame node type %duser %d get latest I frame success, node %d seqNo %d channel %duser %d request I frame from channel %d to speed upuser %d skip to latest I frame, node %d seqNo %d channel %dchannel:%d user:%d node index %d, seqNo %d, timestamp %lldNo audio data inside channel %d for user %d. GET starts before PUT?user %d skip to latest audio frame, node %d seqNo %d channel %dbackward frame num too big %d > %d maxChannel:%d, The timestamp is too old. Breakbackwards to node index %d, current head %d, timestamp %lldcannot find suitable node to backwardanchor pre recode video frame failNo audio data inside channel %d. GET starts before PUT?backwards frame num too big %d > %d maxThis is a quick-start user of channel %dChannel:%d, The timestamp is too old, set to headIndex.anchor pre recode audio frame failOccupySpaceFromPooltuya_ipc_ring_buffer_append_datatuya_ipc_ring_buffer_get_pre_video_frametuya_ipc_ring_buffer_get_next_target_framectx_init_worker_threadrtc_dtls_get_srtp_key_materialrtc_srtp_initrtc_state_dtls_srtp_key_nego_handlerrtc_dtls_inittuya_p2p_rtc_initctx_init_optionsctx_init_msg_queuesrc/tuya_rtc.cdrbg seed failed! mbedtls_ctr_drbg_seed returned %d:%s tuya p2p rtc init: srtp_init sha-256create worker thread failed, errno = %d, errstr = %s ret == 0create async worker thread failed, errno = %d, errstr = %s pipe socket recv eof or error, %d(%s) send frame: srtp failed, stat = %d send frame: srtp result len too big, rtp_len = %d rtc session %d got ice status: %d, time: %llu destroy rtc session %d incoming connection refused: %d/%d, sessionid: %s PCMUaudio0audiovideo0H26442001fAES/KCPtuya0ctx_worker_thread_wakeup: create socket failed ctx_worker_thread_wakeup: create pipe ofd = %ld send to pipe failed, errno (%d), errstr (%s) rtc session %u state change: %s -> %s send signaling: (%s) %.*s no moto signaling callback no signaling callback tuya_p2p_async_task{"tuya_p2p_sdk_version":"%s, %s %s"}tuya_p2p_sdk_v3.1.12Dec 20 201914:22:34ctx process async task: log size >= 8KB, drop... ctx process async task: topic(%d), msg:%.*s toNo enough space for sender report sender_ssrc: %x sender report %u.%u %u %d %d receiver report: %x %u %u %u %u %u %u candidatecallercalleewebrtckcpctx_session_upload_log_connection_handshak error: create json object failed connection_handshakectx_session_upload_log_connection_handshak error: create json item failed connection_typesession_idtrace_idsession_handlerolelocal_idremote_iddtls_handshake_timeconnected_time_msanswer_time_msp2p_time_msrelay_time_msnego_local_addrnego_remote_addrlocal_candidatesremote_candidatesctx_session_upload_log_connection_handshak error: print json failed record signaling failed: create json failed contentoutgoingincomingfromsessionidctx_session_upload_log_connection_close error: create json object failed write_bytesread_bytessend_bytesrecv_bytessocket_send_bytessocket_recv_bytesctx_session_upload_log_connection_close error: create channel bytes object failed connection_closectx_session_upload_log_connection_close error: create json item failed close_time_msclose_reasonipv4_nat_typeipv6_nat_typechannel_infoctx_session_upload_log_connection_close error: print json failed recv packet but rtc state = %d on dtls msg: len = %d recv invalid packet, len = %d recv invalid kcp packet, channel id = %d(%d) recv buffer full, drop packet, session id = %d, channel id = %d invalid md code mbedtls_ssl_handshake: %llu ms dtls handshake failed, ret = 0x%02x *srtp_profile == MBEDTLS_SRTP_AES128_CM_HMAC_SHA1_80key_len == 60srtp_create failed, res = %d res == srtp_err_status_okon local ice candidate: status[%d] %s %s %son dtls verify cert failed: invalid remote fingerprint on dtls verify cert failed: calculate cert fingerprint, md type: %s on dtls verify cert failed: invalid md value dtls_cert_fingerprint: %s sdp_cert_fingerprint: %s on dtls verify cert success on dtls verify cert failed: invalid user data offeranswerctx_session_upload_log_connection_open error: create json object failed connection_openinit_timesdk_versionice_tokenvideo_bitrate_kbpsmax_session_numbermax_channel_numbermax_send_buffer_sizemax_recv_buffer_sizectx_session_upload_log_connection_open error: create json item failed ctx_session_upload_log_connection_open error: create channel buffer bytes object failed ctx_session_upload_log_connection_open error: print json failed rtc session %d auth failed(%s) rtc session %d auth success err msg: %s parse cert failed! mbedtls_x509_crt_parse returned %d parse key failed! mbedtls_pk_parse_key returned %d:%s ssl conf set to default failed! mbedtls_ssl_config_defaults returned %d dtls handshake failed! mbedtls_ssl_conf_own_cert returned %d dtls handshake failed! mbedtls_ssl_conf_dtls_srtp_protection_profiles returned %d dtls handshake failed! mbedtls_ssl_setup returned %d sdprtc session %d retransmit signaling, time: %llu tuya_sdk_webrtctuya_sdk_kcpcbcsend rtp packet failed, ret = %d invalid rtp pkt, len = %d/%d invalid rtp pt = %d srtp unprotect failed, ret = %d rtp decocde failed, ret = %d invalid rtp len ? %d/%d Fail to parse rtcp Receive Sender report RTCP packet Receive Receiver report RTCP packet Receive Source description RTCP packet Receive Goodbye RTCP packet Receive Application-defined RTCP packet Receive Generic NACK rtc session %d handle nack %d failed: pkt not found rtc session %d handle nack %d failed: rtx budget limited rtc session %d handle nack %d failed: rtx time limited rtc session %d handle nack %d : budget = %d Unkown RTCP Transport layer FB message, fmt=%u Receive Picture Loss Indication Receive Slice Loss Indication Receive Reference Picture Selection Indication Receive Application layer FB Receive Full intra request Receive Temporal-Spatial Trade-off Request Receive Temporal-Spatial Trade-off Notificationt Receive Video Back Channel Message Unkown RTCP Payload-specific FB message, fmt=%u Unkown RTCP type %u frame_write_cntframe_write_drop_cntframe_send_drop_cntframe_send_buf_delay_msframe_send_pacing_delay_msframe_write_bytesframe_send_bytesframe_first_msrtp_send_cntrtp_lost_cntrtp_nack_success_cntrtp_nack_failed_not_found_cntrtp_nack_failed_time_limited_cntrtp_nack_failed_budget_limited_cntrtp_nack_rtt_msrtp_nack_rtt_total_msframe_read_cntframe_recv_cntframe_read_bytesframe_recv_bytesconnection_time_msinmiscinvalid report info report failed invalid control msg: invalid json, no cmd field argsinvalid control msg: invalid json, no args field connectinvalid control msg:connect: invalid argsformat ice server tokens failed create rtc session failed connect_breaklisten_breakinvalid control msg:close: invalid argsinvalid webrtc signaling: invalid json, no header field invalid webrtc signaling: invalid header invalid webrtc signaling: invalid local id invalid webrtc signaling: invalid json, no msg field invalid webrtc signaling: invalid json, no token field format signaling offer failed create session failed refusedinvalid signaling: type: candidate invalid signaling: type: sdp invalid signaling msg type can not find rtc session tuya_p2p127.0.0.1pipe addr: %s:%d ctx process incomming msg: topic(%d), msg:%.*s invalid webrtc signaling: not a json ========= %s ========== invalid control msg: not a json ========= %s ========== tuya p2p rtc sdk version: 0x%x, %s %s g_ctx != ((void *)0)opt->cb.aes.on_destroy != ((void *)0)opt->cb.aes.on_encrypt != ((void *)0)opt->cb.aes.on_decrypt != ((void *)0)ctx->msg_queue_incoming != ((void *)0)ctx->msg_queue_async_task != ((void *)0)ctx->msg_queue_cert != ((void *)0)deinit connect break {"cmd":"connect_break","args":{}}break listen p2p sdk not inited {"cmd":"listen_break","args":{}}got a signaling msg:%.*s close session %d {"cmd":"close","args":{"handle":"%d"}}try connect to %s, token len = %d {"cmd":"connect","args":{"remote_id":"%s","session_id":"%s","token":%.*s,"trace_id":"%s"}}control: %s connect to %s timeout connect to %s result %d try listen listen break accept failed session listen result %d user try to push a frame, type = %d, len = %d, pts: %llu allocate audio frame packet failed packetize frame failed send: invalid channel number: %d/%d send ret = %d recv: invalid channel number: %d/%d check buffer: invalid channel number: %d/%d P2P_CONNECTDTLS_SRTP_KEY_NEGOSTREAMFAILEDsrc/tuya_rtcp.cToo little data for RTCP Invalid RTCP header: Version must be %d Buffer too small (%d bytes) to fit an rtcp packet with a header and payload %u bytes. Invalid RTCP header: Padding bit set but 0 payload size specified. Invalid RTCP header: padding bytes (%u), while packet payload size is %u bytes. Payload length %u is too small for a Nack. lost packet seq=%u tuya_p2p_rtp_dump_rtp_hdr%u %u %u %u %u %u ret < (int)sizeof(buf)src/tuya_rtp.c%u %u %urtp: %s tuya_p2p_rtp_session_init: ses=%p, default_pt=%d, ssrc=0x%x rtxsrc/tuya_sdp.cupdate audio codec: pt = %d, codec = %s, %s, %s update video codec: pt = %d, codec = %s, %s recvonlysendrecvnonesendonlyv=0 o=- %lu 1 IN IP4 127.0.0.1 s=- t=0 0 a=group:BUNDLE%s a=msid-semantic: WMS %s m=%s 9 %s%s UDP/TLS/RTP/SAVPFc=IN IP4 0.0.0.0 a=rtcp:9 IN IP4 0.0.0.0 a=ice-ufrag:%s a=ice-pwd:%s a=ice-options:trickle passiveactpassa=fingerprint:%s a=setup:%s a=mid:%s a=%s a=msid:%s %s a=rtcp-mux a=rtpmap:%d %s/%d a=rtcp-fb:%d ccm fir a=rtcp-fb:%d nack a=rtcp-fb:%d nack pli a=fmtp:%d level-asymmetry-allowed=1;packetization-mode=1;profile-level-id=%s a=rtpmap:%d rtx/%d a=fmtp:%d apt=%d a=ssrc-group:FID %u %u a=ssrc:%u cname:%s a=ssrc:%u cname:%s applicationa=aes-key:%s a=rtpmap:%d %s %d a=msid-semantic:WMSa=msid:a=group:BUNDLE%s %s %sm=audiom=videom=applicationa=rtpmap:got invalid rtpmap, m = %c a=fmtp:apt=a=ssrc-group:FIDa=ssrc:cname:a=mid:a=ice-ufrag:a=ice-pwd:a=fingerprint:a=aes-key:a=candidate:226oh2|ԝ?GOShK" ۿEi:~maH^D5iM}jde]i3lPht6FMБ)Y >"cUeU8D<́:xz.?g)f[tsn yl)UU+`1Y & !7(FT /'c_հDcdOQS\:5 SHA-%d test #%d: HMAC-SHA-%d test #%d: # }"4"BwU*你lu8Q'v]]PE\RR%% yFU ػaK?BXHNgxAA@]"#aza$ja8& >`9gH m9,8ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/def_outputusr_outputTUYANull[%02d-%02d %02d:%02d:%02d-- %s %s][%s:%d] [%02d-%02d %02d:%02d:%02d:%d %s %s][%s:%d] ErrWarnNoticeInfoDebugTrace  X\bcdefhijknopq Zclean dns info for %s gethostbyname error %d store dns info to position %d for %s 0x%08x Unable to create socketConnecting .. %s:%d tcp connect failed %s:%d errno=%d Connected .. sockfd: %d Socket creation for %s:%d failed uni_get_system_timeJanFebMarAprMayJunJulAugSepOctNovDecGMT/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_adapter/utilities/uni_time.crecycle!! last_tick:0x%x curr_tick:0x%x%d:%dsscanf err,num:%d__get_time_zone"\ u%04xfalsetrue%.0f%e%f[]post_data_to_ai_servercloud_encrypt_pic_with_random_ivcloud_require_new_ca__http_callback_after_put__http_ai_recv_need_datacloud_decrypt_pic_with_random_iv__http_ai_callback_after_post/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/cloud_operation.cOSS Put Fail.%d gw_idsign_methodsignSessionIddetect_typechunked errMalloc Buffer Size:%dresulthttp rev data fail.%d####post result:%s content-type:%s host:%s x-amz-content-sha256:%s x-amz-date:%s x-amz-security-token:%s content-type;host;x-amz-content-sha256;x-amz-date;x-amz-security-token%s %s %s %s %s %s%s/%s/s3/aws4_requestAWS4-HMAC-SHA256 %s %s %sContent-Typeconfig->provider = %s. oss%s, %02d %s %d %02d:%02d:%02d GMTDatex-oss-security-token:%s /%s%s%s %s %s %s %s%sPUTOSS %s:%sAuthorizationx-oss-security-tokenAWS4-HMAC-SHA256 Credential=%s/%s/%s/s3/aws4_request,SignedHeaders=%s,Signature=%sx-amz-content-sha256x-amz-datex-amz-security-tokensv=TOKEN has no svSV = %sx-ms-blob-typeBlockBlobx-ms-versioninput nullrequire CA for url %sCA exist for url alreadycertificate get failed %d ca_list[%d]get certificate fail 3 times,so we do returncan not get json data from server new CA stored for i:%d url %sfail to malloc %d for cawe find the same ca in list:%d,url:%s ca_type:%d i:%dcan not store more CAinvalid size >= %d-16-head sizeen with key[%s] iv[%s], size %d to %den with size %d to %dfail to malloc %duse local key de with key[%s] iv[%s], size %d to %dfail to get value for key tokeninvalid key value for key tokenfail to get value for key %sinvalid key value %s for key %spathConfigak: %s sk: %s expiration: %s bucket: %s endpoint: %s token: %s provider: %s media_path: %s log_path: %s detect_path: %s msgType ak %s sk %s expiration %s bucket %s endpoint %s token %s provider %s log_path %s detect_path %s config->msg_type %d presetfail to get value for key pathinvalid key value %s for key path ak %s sk %s expiration %s bucket %s endpoint %s token %s provider %s preset_path %s input is invalidcreate http handle fails%s://%s%s/%s%s/%s%s%s://%s.%s%s/%s%s/%sHTTPS PUT fail:%s,size %d,ret %dHTTPS PUT %s done,size %d cost %llu ms%s%d%s://%s.%s%s/%s?append&position=%durl = %s. Final PUT:%s HTTP Put Content Fails: %dInput Is InvalidFile Not Exist:%sFile:%sFile Size:%dcontent_type:%sFile Open Fails:%soss_put_object_from_file failed:%d httppos:%d total size:%d actual_read:%doss_put_object_from_file put object failed=[%d] sque:%d.%s,%spic_stopPost Data Return Fail.%dSunMonTueWedThuFriSatakexpirationendpointregionproviderlogPathdetectPathmediaPathcloud_get_storage_config__http_callback_add_put_custom_request_headcloud_set_preset_storage_configpost_file_to_osscloud_get_detect_storage_configcloud_put_data_to_file__http_callback_ai_detect_put_headcloud_append_post_data_to_filecmmodgw_get_rssi__tmm_gw_if_sync_cb__tmm_short_cb__gw_lc_unbind_device_unlock__get_dev_cntl_unlock__gw_flash_reset_fac__gw_cntl_desc_init__gw_rst_log__cb__tmm_dev_delete/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/gw_intf.ccmmod_post_msg error:%dlong timer timeout,set wifi mode as a lowpower modelong timer timeout,set wifi mode as a normal modeshort timer timeout,set wifi mode as a lowpower mode after the device power on nextshort timer timeout,set wifi mode as a normal mode after the device power on nextwd_gw_wsm_write error:%dwf_wk_mode_set err:%dSmartLife%s-%02X%02Xwf_nw_cfg_start err:%ddefdev delete -->>dev delete <<--Invalid Paramunbind dev:%shashmap remove fail dev_id:%sunbind ok.curr dev num:%ddevice is already unbindednot find. curr dev num:%dcJSON_PrintUnformatted errordata format error:%swf_ap_stop error:%dstop smt cfg mthd:%dlowpower or special mode stop tmm_short and tmm_long timercmmod_stop_tm_msg tmm_short error:%dcmmod_stop_tm_msg tmm_long error:%dwf_wk_mode_set error:%d__wf_ap_config error:%dlan_ap_nw_cfg_start error:%dERR dev is deleted.should not in hashmap. %sdev %s already bind and attach.Skipdev %s bind schema %sdp num parse invalid %dmalloc fail dpnum %dmalloc failcjson is NULL %sget id nullget mode nullrwropulsetotalobjrawpropertyget property nullget type nullboolmaxlenget maxlen nullmalloc errorenumrangeget range nullget array size errorget array nullbitmaphashmap put fail dev_id:%sBind Dev Attach Success %s %d__wf_reset error:%ddev %s read schema failsdev %s Already In List. ReturnBind Dev No Attach Success %s %dInvalid Param. gw init failsattr_num[%d] out of limit,limit is %dinvalid version format[%d]:%sCreateMutexAndInit fail %dmalloc hashmap errorwd_gw_base_if_read fail %duuid authkey invalidserial_no:%sCNUSJPEUwd_gw_wsm_read err:%dgw_cntl.gw_wsm.stat:%dgw_cntl.gw_wsm.nc_tp:%dgw_cntl.gw_wsm.md:%dtoken invalid,go to reset facwifi config method do't fitgw_cntl.gw_if.abi:%d input:%dgw_cntl.gw_if.product_key:%s, input:%sgw_cntl.gw_if.tp:%d, input:%dabi/pid/tp invalidattr_num change,gw_if.attr_num:%d attr_num:%dattribute type check fail. idx:%d tp:%d input:%dwd_gw_actv_if_write err:%ddevice do't find err:%dkey/url invalid2.230.011.0.11.0.0malloc failsBegin Load DevicesIndex:%d ret:%d devId:%swd_dev_if_read err:%dgw_lc_bind_device_pk err:%dLoad Devices Finish. Cnt:%denter success_procenter reset factory wd_gw_desc_if_write errorMalloc errERR_EXIT is Jumped!!!!region:%s token:%s regkey:%swxwf_ap_stop err:%d__gw_nw_cfg_fin_proc err:%dSniffer Finish %d ssid:%s passwd:%s__gw_nw_cfg_fin_proc error:%ddo't config wifi networkwf_station_connect has not found router(%s)wf_station_connect error:%dlan_pro_cntl_init error:%dgw_wsm stat:%dcmmod_start_tm_msg error:%dhttp_psk_url is NULL. get new url from cloud...Param is null./tmp/tuya.logno log file existfail to open file:%sfail to malloc %d for logcloud_get_storage_config error: %d.%s_%d%02d%02d%02d%02d%02d.logapplication/txtfail to upload log file ret: %d.routercreate_log_seq err %dgw reset called. tp:%d stat:%dgw_reset_by_gwid error:%dipc db info reset__gw_reset error:%dtm_msg start timerID[%d] errhttp_put_rst_log err:%dhttp_put_rst_log finishgateway versions update -->>http_gw_update_version_v41 error:%dwd_gw_desc_if_write error:%dgateway versions update <<--get_wf_gw_nw_status error:%dgw is long time(60s) disconnected to router/failed to connect mqtt,now go to reconnect!!netstat:%dset gw ext_stat:%dgw_active error:%dactived failed,wifi module start to registercmmod_start_tm_msg err:%dhttp_gw_active service verify fail, unactive and restartgw_unactive errorsecKey__ty_httpc_err_proc error:%dlocalKeyschemaIdschemawxDevIdwxAppId__gw_single_dev_bind error:%dwd_dev_schema_write error:%d__gw_lc_bind_device error:%dskillResultwd_gw_actv_if_write error:%dnet work unavailable cnt %d get url cfg cb calledget gw ext_stat:%dgw_upgrade_funcgw upgrade module version. type:%d ver:%sinvalid version format:%sgw_cntl.gw_if.tp:%dgw_cntl.gw_if.abi:%dsoc solution. upgrade soc sw_ver:%s %smcu-dev solution. upgrade soc sw_ver:%s %smcu-dev solution. upgrade mcu sw_ver:%s %sNULL inputdev not on online:%dget ip fails:%d wf:%dwf_station_get_conn_ap_rssi error:%dGet Rssi:%dssid:%spasswd:%stoken:%ssmart cfg stopap cfg stopdownload begin, set upgrade status %dupdate upgrade-status fails %d %s, continue to download fileset download buf size:%udownlaod file fails %d %starget file md5:%ssdk calc file md5:file md5 check fail.file md5 check success.mqtt report download percent:%dmqc_upgd_progress_rept_v41 err:%dpercent %d offset:%u total:%u report:%dhttp_device_check_upgrade_info_by_devid %s error:%dhttp_gw_check_upgrade_info error:%dmd5httpsUrlTLS MODE:%d set to https urlfw_md5: %ssw_ver: %sfw_url: %sfile_size: %uug_mag->dev_id:%scloud ug_mag->tp:%d local:%dpre gw ug is set. and pre handled:%dpost msg error:%dsilent get gw firmware,no firmware availablehttp_get_self_fm_ug_info failedsilent get gw firmwareug_mag->ug.fw_md5 = %s.ug_mag->ug.sw_ver = %s.ug_mag->ug.fw_url = %s.ug_mag->ug.file_size = %d.silent get gw firmware finishcJSON_Parse err:%scount:%dtimer_task_init fails %dmqc_app_init error:%d %duni_set_time_zone error:%d zone:%stm_msg start TIMEID[%d] errnext_min:%d__gw_ug_cfg_cb get nothingconfigstdTimeZonetimezone:%shas no stdTimeZonedstIntervalshas no dstIntervalsackIdackid:%s httpc_dynamic_cfg_ack op_ret:%dhas no ackIdminscale__gw_connect_monitor__cb__gw_unregister_cb__gw_upgrade_mqc_upgd_progress_timer_cbset_gw_ext_stat__gw_upload_log_cbgw_lc_bind_device_pk__ty_httpc_err_procgw_get_ipset_gw_active__gw_nw_smt_cfg_stop_cb__nw_cfg_fin_cbgw_update_version__gw_nw_ap_cfg_cb__tmm_gw_actv_cbgw_user_token_bind__gw_lc_bind_dev_not_attach_dp__tmm_long_cb__gw_upgrade_thread_funcgw_wifi_user_cfg __gw_ap_nw_cfg_proc__gw_net_conn_cb__gw_lc_bind_device__gw_fw_ug__cbget_wf_gw_nw_status__gw_reset__gw_actived_cbgw_cntl_initgw_load_sum_time_zone_tblget_gw_ext_stat__get_upgrd_if_cb__gw_nw_lowpower_cb__gw_unactive_cb__wf_reset_cb__tmm_get_url_cfg_cb__gw_get_file_data_cb__tmm_gw_register_cb__gw_nw_smt_cfg_cb__gw_nw_ap_cfg_stop_cb__gw_ug_cfg_cb0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-http_get_response_hdrhttp_open_sessionhttp_get_response_hdr_allhttp_read_standardget_version_stringsanitize_resource_name_http_send_request__select_wait_socketfdget_method_string_http_prepare_reqhttp_prepare_reqhttp_read_chunkedprefetch_headerhttp_send_requesthttp_add_headerparse_keep_alive_header/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_middleware/httpc/httpc.cError in parsing header: %dselect fail %d err:%dhttp socket recv select time out. err:%dtls http recv no memory.len:%d ret:%d err:%d. try recv again %dtls http recv again.len:%d ret:%d err:%d. try recv again %dtls http recv fail.len:%d ret:%d err:%dtls http recv fail.len:%d err:%dThe recv data may larger than recv buff,you may need to set wait_for_to to trueUsing actual read: %d %dUsing prefetch: %d %d %d %dError while reading chunk len: %dInvalid paramsCannot write data. session state: %d, session chunk state: %d%x Cannot parse URLNULL pointer(s) received as argument.Temporary buffer size is less than required://Scheme: %sNo scheme in given URLParse: Hostname: %sPort number parsing failed: %sParse: Port No: %dNo port number givenResource: %sNo resource specified in given URLCannot create session.Could not allocate session objectCould not allocate prefetch bufferHost name corruptForce enable TLS flagNo entry for host %s foundConnecting .. %s:%dtcp connect failed %s:%d errno=%dConnected .. sockfd: %dConnect: %s Port: %d cost %llu(tcp)%llu(tls)Socket creation for %s:%d failedEnter: %sCannot add headerHEADPOSTCannot prepare request, invalid parameters. State: %dCannot prepare request, invalid session state. State: %dMethod not yet supported.Unknown method given.Unknown version givenHTTPC: version invalidHave to extract Resource extraction error: %dHTTPC: resource invalidHostUser-AgentTUYA_IOT_SDKConnectionkeep-aliveapplication/jsonapplication/x-www-form-urlencoded; charset=UTF-8Transfer-EncodingchunkedContent-Length: %d bytes=%u-%uRangeHTTPC: Method invalid%s %s %s/%s HTTPEnter: http_send_requestCannot send requestCannot send request. Buffer empty.send header:%s Failed to send headerFailed to send data.Unable to get resp header, invalid params.Unable to get resp header, invalid session state. State: %dStart header read Parsing HTTP headerheader:%sHeader not found.The stream may be in inconsistent state orin a rare case, the header may be bigger that %d bytesProtocol mismatch in header.Protocol version not found.Defaulting to keep aliveProtocol version mismatch.Status code not found.Header parsing error in pair %sHdr parsing over bound:len: %d pair_len: %d#### %sHeader parsing error in name %sAccept-RangesServerLast-ModifiedKeep-AliveServer allows keep aliveKeep-Alive present but connection: Close ?Server does not allow keep alivetimeoutNo timeout specified in response header.NAK'ing keep alive by forcetimeout=%dtimeout value not found !Server timeout value: %dmax value not found !max=%dmax value invalid !Alive Max value:%dContent-LengthContent-EncodingHeader has used up %d bytes from the %d bytes headerStatus code string not found.No content present. Closing this x'actionUnable to get resp header.Invalid state: %d. Cannot read hdr valueCannot read content.Cannot read content, no outstanding requests. Session state %dNot reading any content.HTTP status code: %dCannot read content. Unknown state %dReadng %d bytes of chunked data (b/w)... remn'g %dFailed to read partial chunk: %dRead %d bytes of partial chunked data.Cumulative: %d Total: %dZap chunk boundary failedUnable to read len. No newlineChunk size: %dAt end of transaction, could not zap chunk boundaryFailed to read chunk data: %dCould not zap chunk boundaryRead %d bytes of start chunked data.Unknown state %dStandard read completecontentlen:%d size_remain:%d size_to_read:%dError in reading content: %dUnable to read length. Header corrupted.Chunk size str (value in hex): %sCannot read lowlevelUnable to do lowlevel readCannot write lowlevelUnable to do lowlevel write_http_raw_recvzap_chunk_boundaryhttp_read_contenthttp_lowlevel_writeget_content_lennew_session_object_http_parse_URLload_header_fieldsrecv_bufhttp_parse_URL_parse_http_header_http_get_response_hdr_valuetcp_connecthttp_lowlevel_read__tuya_tls_http_recv_cbhttp_get_response_hdr_valuehttpc_write_chunkedhttp_inf_client_get_filehttp_log_seq_init/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_middleware/httpc/http_inf.cOpen session failed: %s (%d)Prepare request failed: %dSend request failed: %dGet resp header failed: %dServer Maybe Not support download in range. %u %d %sGet File In Range Mode [%d %d]Get File In Full Mode?%s=%s__http_inf_com_hanleikcp_outputikcp_releaseikcp_peeksizeikcp_recvikcp_sendikcp_ack_pushXdx TSRQ`dsrc/ikcp.ckcp->output[RO] %ld byteslen == peeksizerecv sn=%lukcp->mss > 0segacklist != ((void *)0)[RI] %d bytesinput ack: sn=%lu rtt=%ld rto=%ldinput psh: sn=%lu ts=%luinput probeinput wins: %luhttpc_dev_upgrd_stat_update_v41httpc_dynamic_cfg_get_v10httpc_get_pichttp_upload_timer_loghttpc_dynamic_cfg_ack_v10http_put_cloud_confighttpc_get_self_fw_ug_info_v42httpc_gw_timer_cnt_v40httpc_gw_upload_timer_log_v10httpc_get_self_oss_info_v10http_gw_property_savehttp_gw_update_version_v41httpc_gw_put_cloud_config_v10httpc_gw_reset_v40http_gw_active_v41__httpc_getfile_cbhttpc_gw_upgrd_stat_update_v41http_active_url__httpc_unchunk_recv_need_datahttp_url__decode_rev_bufferhttpc_gw_region_cfg_get_v10httpc_iot_cloud_storage_encrypt_key_gethttpc_dev_update_if_v41__httpc_gw_common_cbhttpc_put_rst_log_v10http_gw_get_delete_status__iot_common_posthttpc_gw_timer_v40http_gw_get_cloud_urlhttpc_dev_update_skill_v10httpc_gw_property_save_v10httpc_gw_update_if_v41httpc_secure_verify_v20httpc_gw_get_urlcfg_v41httpc_iot_certificate_get_v10httpc_get_dev_upgrd_if_v42httpc_gw_active_v41httpc_gw_delete_status_get_v10__httpc_chunk_recv_need_datahttpc_get_gw_upgrd_if_v42httpc_common_posthttpc_get_file_v10__httpc_getpic_cb/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/iot_httpc.csocket rev error %dsocket rev empty this timeThis Time Download %u Byte. Offset:%udownload finish this time.But Content Is Not Enough %u %udownload success this timecreate_http_url_h errorset url fail.ret:%d %sotheruuidMake Full URL Fail.left size too small.%d %d,"t":%u}{"t":%u}Post Data: %sdata=Post URL: %sAES Post Data Fail.data handle error %ddownload %u bytes and handle remain %u bytesdownload error this time %dmalloc fail.%dchunk_num.%dresponse has e:false,by pass decodedecode key NOT null %s||t=%d||json get t fail.json get sign fail.json get result fail.result=sign is not right sign1:%s,sign2:%sDecode Rev:%scall time-set %derrorCodeerrorCode:%sDEV_ID_ILLEGALDEVICE_HAS_RESET_FACTORYEXPIREerrorMsgerrorMsg:%sGATEWAY_NOT_EXISTSDEVICE_ALREADY_BINDORDER_EXPIREDREMOTE_API_RUN_UNKNOW_FAILEDDEVICE_REMOVEDCAMERA_STORAGE_ORDER_UNNORMALCAMERA_STORAGE_ORDER_NOT_EXISTEDAPI_OR_API_VERSION_WRONGsignature errorORDER_NOT_EXISTEDDEVICE_IS_NOT_WRONGWORK_NO_ALREADY_EXISTtotal_len:%ddecode content fail. %d%s is nullactive_keyMalloc Fail.{"devId":"%s","offset":"%d","limit":"%d"}tuya.device.timer.get4.0{"devId":"%s","lastFetchTime":"%d"}tuya.device.timer.countauth_key{"token":"%s","region":"%s"}tuya.device.config.get4.1{"region":"%s", "env":"prod"}tuya.device.region.config.getInput InvalidMalloc Fail. len:%d{"token":"%s","softVer":"%s","productKey":"%s","protocolVer":"%s","baselineVer":"%s","devId":"%s","hid":"%s","modules":"%s","feature":"%s","skillParam":"%s","cadVer":"%s","cdVer":"%s","options":"%s"}tuya.device.activetuya.device.reset{"type":%d}tuya.device.upgrade.get4.2{"type":%d,"upgradeStatus":%d}tuya.device.upgrade.status.updatevers{"versions":"%s"}tuya.device.versions.updatesub_id{"subId":"%s","type":%d}{"subId":"%s","upgradeStatus":%d,"type":%d}sw_ver{"subId":"%s", "versions":[{"type":%d,"softVer":"%s"},begin to download file. total_len:%d url:%stry:%d offset:%u total_size:%udownload file finishServer Not Support Range Mode. Try Download in Full Mode Oncebegin to download file. url:%stry:%dtuya.device.dynamic.config.getackid{"ackId":"%s"}tuya.device.dynamic.config.ackrs_data{"data":"%s"}atop.online.debug.log{"subId":null}{"subId":"%s"}tuya.device.upgrade.silent.getskill{"skill":"%s"}{"subId":"%s","skill":"%s"}tuya.device.skill.update{"withVideoDataStorage":"true"}{"withVideoDataStorage":"false"}tuya.device.storage.config.gettimer_infotuya.device.timer.log.uploadchipIdsecureCode1randomA{"region":"%s"}{"token":"%s","chipId":"%s","secureCode":"%s","randomStr":"%s"}tuya.device.dbauth2.0C14iixkNmv1CGNkJtuya.device.construction.config.uploadtuya.device.delete.status.gethttp url and https url are all NULLhttps://a2.tuyacn.com/d.jsonhttps://a2.tuyaus.com/d.jsonhttps://a2.tuyaeu.com/d.jsonAYAZAPI NOT ONLINE. USE Default.. Region:%sm2.tuyacn.comm2.tuyaus.comm2.tuyaeu.comhttpc_gw_get_urlcfg_v41/httpc_gw_region_cfg_get_v10 error:%dhttpUrlget url config fail. elements not enoughhttpsPSKUrlmqttsUrlmqttUrlmediaMqttUrlhttpUrl:%shttpsUrl:%shttpsPSKUrl:%smqttsUrl:%smqttUrl:%smediaMqttUrl:%sskill_param:%s[{\"type\":%d,\"softVer\":\"%s\",\"online\":%s},modules:%s{\"isFK\":%s}options:%s{\"type\":%d,\"protocolVer\":\"%s\",\"baselineVer\":\"%s\",\"softVer\":\"%s\",\"cadVer\":\"%s\",\"cdVer\":\"%s\"},{\"type\":%d,\"softVer\":\"%s\"},httpc_gw_update_if_v41 err:%dmq.gw.tuyacn.com+08:00httpc_gw_delete_status_get_v10 error:%ddelete status:%dtuya.device.property.save{"domain":"%s"}tuya.device.domain.certificate.gettuya.device.ipc.storage.secret.gethttpc_ipc_preset_sethttpc_ipc_ai_face_all_get_v2httpc_ipc_ai_face_storage_config_get_v2iot_http_active_parse_skill_cbhttpc_ipc_storage_config_get_v2httpc_ipc_ai_face_signed_report_v2httpc_ipc_cloud_storage_event_notify_v10http_gw_ipc_custom_msghttpc_ipc_ai_new_face_report_v2httpc_ipc_ai_config_get_v1httpc_ipc_ai_storage_config_get_v2[%02d-%02d %02d:%02d:%02d %s][%s:%d] ipc_logtuya_p2p_logtuya.device.log.report/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/https/ipc_httpc.cno skill_result returnp2pIdskillResult p2pId:[%s]{\"localStorage\":1,\"cloudStorage\":1,\"echoshow\":2,\"chromecast\":2,\"webrtc\":3,\"sdk_version\":\"4.7.10\"}{\"type\":%d,\"skill\":tuya.device.ipc.storage.config.gettuya.device.ipc.p2p.config.getp2p_passwd{"password":"%s"}tuya.device.ipc.password.updatetuya.device.ipc.media.storage.notify.upload.starttuya.device.ipc.media.storage.notify.upload.stoptuya.device.ipc.media.storage.report.eventcloud_msg{"withVideoDataStorage":"%s"}{"type":"%s"}HumanDetectPresettuya.device.ai.config.getAituya.device.ai.detect.result.reporttuya.device.ipc.memory.point.addtuya.device.ipc.memory.point.deletetuya.device.ipc.memory.point.listinterface %s, message %spreset_msgMalloc failFaceDetect{"v":2,"devId":"%s"}tuya.device.ai.face.aquaintance.sample.gettuya.device.ai.face.reporttuya.device.ai.face.new.stranger.reporthttpc_ipc_ai_detect_msg_report_v1httpc_ipc_oss_storage_cfg_get_v10httpc_ipc_get_self_oss_info_v10httpc_ipc_p2p_cfg_get_v20httpc_ipc_p2p_passwd_update_v10!(((handle)->flags & (UV_HANDLE_CLOSING | UV_HANDLE_CLOSED)) != 0)src/unix/core.c0handle->flags & UV_HANDLE_CLOSING!(handle->flags & UV_HANDLE_CLOSED)rsockfd >= 0fd > -1fd > 2cb != ((void *)0)fd >= -10 == (events & ~(0x001 | 0x004 | 0x2000 | 0x002))0 != eventsw->fd >= 0w->fd < 2147483647loop->watchers[w->fd] == wloop->nfds > 0HOMETMPDIRTMPTEMPTEMPDIR/tmpuv_closeuv__make_close_pendinguv__finish_closeuv__acceptuv__close_nocheckstdiouv__closeuv__io_inituv__io_startuv__io_stopuv__io_activectx != ((void *)0)src/fs-poll.cctx->parent_handle != ((void *)0)ctx->parent_handle->poll_ctx == ctxuv_fs_poll_stopuv_fs_poll_getpathtimer_cbloop->watchers != ((void *)0)src/unix/linux-core.c((const QUEUE *) (&loop->watcher_queue) == (const QUEUE *) (*(QUEUE **) &((*(&loop->watcher_queue))[0])))w->pevents != 0w->fd >= 0w->fd < (int) loop->nwatchersop == 1timeout >= -1timeout != -1fd >= 0(unsigned) fd < loop->nwatcherstimeout > 0/proc/self/statcpu/proc/stat/proc/cpuinfounknownclock_ticks != (unsigned long) -1clock_ticks != 0cpu%u r == 1%lu %lu %lu %lu %lu %lunum == numcpus/sys/devices/system/cpu/cpu%u/cpufreq/scaling_cur_freq%luuv__platform_invalidate_fduv__io_pollNmodel name : Processor : cpu MHz : read_timestmp_path != ((void *)0)src/unix/linux-inotify.c(*__errno_location ()) == 11 || (*__errno_location ()) == 11size > 0w != ((void *)0)uv__inotify_forkuv__inotify_readuv_fs_event_stop((const QUEUE *) (&loop->wq) == (const QUEUE *) (*(QUEUE **) &((*(&loop->wq))[0]))) && "thread pool work queue not empty!"src/unix/loop.c!((loop)->active_reqs.count > 0)uv__loop_close!(((handle)->flags & (UV_HANDLE_CLOSING | UV_HANDLE_CLOSED)) != 0)src/unix/poll.c(pevents & ~(UV_READABLE | UV_WRITABLE | UV_DISCONNECT | UV_PRIORITIZED)) == 0uv_poll_stopuv_poll_startsignum == 17src/unix/process.c((const QUEUE *) (&pending) == (const QUEUE *) (*(QUEUE **) &((*(&pending))[0])))container->data.stream != ((void *)0)0 && "Unexpected flags"n == sizeof(val)/dev/nulloptions->file != ((void *)0)!(options->flags & ~(UV_PROCESS_DETACHED | UV_PROCESS_SETGID | UV_PROCESS_SETUID | UV_PROCESS_WINDOWS_HIDE | UV_PROCESS_WINDOWS_VERBATIM_ARGUMENTS))err == piduv__chlduv__process_init_stdiouv__write_intuv_spawnr == sizeof msg || (r == -1 && ((*__errno_location ()) == 11 || (*__errno_location ()) == 11))src/unix/signal.c!(((handle)->flags & (UV_HANDLE_CLOSING | UV_HANDLE_CLOSED)) != 0)!(handle->flags & UV_HANDLE_CLOSING)removed_handle == handleret == 0uv__signal_handleruv__signal_startuv__signal_eventuv_signal_stopuv__signal_stop/dev/null/fd >= 0src/unix/stream.c!uv__io_active(&stream->io_watcher, 0x001 | 0x004)stream->flags & UV_HANDLE_CLOSED((stream->loop)->active_reqs.count > 0)stream->write_queue_size == 0events & 0x001stream->accepted_fd == -1!(stream->flags & UV_HANDLE_CLOSING)server->loop == client->loopqueued_fds->offset > 0((const QUEUE *) (&stream->write_queue) == (const QUEUE *) (*(QUEUE **) &((*(&stream->write_queue))[0])))stream->shutdown_reqreq->bufs != ((void *)0)req->handle->write_queue_size >= size((stream)->io_watcher.fd) >= 0req->handle == streamfd_to_send >= 0req->write_index < req->nbufs(size_t)n >= lenstream->write_queue_size >= lenn == 0n == 0 || n == -1!(stream->flags & UV_HANDLE_BLOCKING_WRITES)ignoring non-SCM_RIGHTS ancillary data: %d start + ((((sizeof (struct cmsghdr)) + sizeof (size_t) - 1) & (size_t) ~(sizeof (size_t) - 1)) + (count * sizeof(*pi))) == endstream->alloc_cb != ((void *)0)buf.base != ((void *)0)stream->type == UV_TCP || stream->type == UV_TTY || stream->type == UV_NAMED_PIPEstream->type == UV_TCP || stream->type == UV_NAMED_PIPE || stream->type == UV_TTYstream->type == UV_TCP || stream->type == UV_NAMED_PIPEreqnbufs > 0(stream->type == UV_TCP || stream->type == UV_NAMED_PIPE || stream->type == UV_TTY) && "uv_write (unix) does not yet support other types of streams"alloc_cb!uv__io_active(&handle->io_watcher, 0x001 | 0x004)uv__stream_openuv__stream_destroyuv__server_iouv_acceptuv__drainuv__write_req_sizeuv__writeuv__write_callbacksuv__stream_recv_cmsguv__readuv_shutdownuv__stream_iouv__stream_connectuv_write2uv_try_writeuv_read_startuv__stream_closehandle->type == UV_TCPsrc/unix/tcp.cUV_TCP_SINGLE_ACCEPTuv__tcp_connectUV_THREADPOOL_SIZE((req->loop)->active_reqs.count > 0)src/threadpool.cuv__queue_done!uv__io_active(&handle->io_watcher, 0x001 | 0x004)src/unix/udp.chandle->io_watcher.fd == -1handle->send_queue_size == 0handle->send_queue_count == 0!(handle->flags & UV_HANDLE_UDP_PROCESSING)((handle->loop)->active_reqs.count > 0)handle->type == UV_UDPhandle->recv_cb != ((void *)0)handle->alloc_cb != ((void *)0)buf.base != ((void *)0)q != ((void *)0)req != ((void *)0)0 && "unsupported address family"nbufs > 0addrlen <= sizeof(req->addr)0 && "unexpected address family"uv__udp_finish_closeuv__udp_run_completeduv__udp_iouv__udp_recvmsguv__udp_sendmsguv__udp_maybe_deferred_binduv__udp_senduv__udp_try_senduv_udp_set_multicast_interfaceUnknown system error %dUnknown system error%sE2BIGEACCESEADDRINUSEEADDRNOTAVAILEAFNOSUPPORTEAGAINEAI_ADDRFAMILYEAI_AGAINEAI_BADFLAGSEAI_BADHINTSEAI_CANCELEDEAI_FAILEAI_FAMILYEAI_MEMORYEAI_NODATAEAI_NONAMEEAI_OVERFLOWEAI_PROTOCOLEAI_SERVICEEAI_SOCKTYPEEALREADYEBADFEBUSYECANCELEDECHARSETECONNABORTEDECONNREFUSEDECONNRESETEDESTADDRREQEEXISTEFAULTEFBIGEHOSTUNREACHEINTREINVALEIOEISCONNEISDIRELOOPEMFILEEMSGSIZEENAMETOOLONGENETDOWNENETUNREACHENFILEENOBUFSENODEVENOENTENOMEMENONETENOPROTOOPTENOSPCENOSYSENOTCONNENOTDIRENOTEMPTYENOTSOCKENOTSUPEPERMEPIPEEPROTOEPROTONOSUPPORTEPROTOTYPEERANGEEROFSESHUTDOWNESPIPEESRCHETIMEDOUTETXTBSYEXDEVUNKNOWNEOFENXIOEMLINKEHOSTDOWNEREMOTEIOENOTTYEFTYPEargument list too longpermission deniedaddress already in useaddress not availableaddress family not supportedresource temporarily unavailabletemporary failurebad ai_flags valueinvalid value for hintsrequest canceledpermanent failureai_family not supportedout of memoryno addressunknown node or serviceargument buffer overflowresolved protocol is unknownservice not available for socket typesocket type not supportedconnection already in progressbad file descriptorresource busy or lockedoperation canceledinvalid Unicode charactersoftware caused connection abortconnection refusedconnection reset by peerdestination address requiredfile already existsbad address in system call argumentfile too largehost is unreachableinterrupted system callinvalid argumenti/o errorsocket is already connectedillegal operation on a directorytoo many symbolic links encounteredtoo many open filesmessage too longname too longnetwork is downnetwork is unreachablefile table overflowno buffer space availableno such deviceno such file or directorynot enough memorymachine is not on the networkprotocol not availableno space left on devicefunction not implementedsocket is not connectednot a directorydirectory not emptysocket operation on non-socketoperation not supported on socketoperation not permittedbroken pipeprotocol errorprotocol not supportedprotocol wrong type for socketresult too largeread-only file systemcannot send after transport endpoint shutdowninvalid seekno such processconnection timed outtext file is busycross-device link not permittedunknown errorend of fileno such device or addresstoo many linkshost is downremote I/O errorinappropriate ioctl for deviceinappropriate file type or formatasynccheckfs_eventfs_pollhandleidlepipepollprepareprocessstreamtcptimerttyudpsignal[%c%c%c] %-8s %p R-A-I-nbufssrc/uv-common.cerr == 0uv_fs_scandir_nextuv_loop_deleteasynccheckfs_eventfs_pollhandleidlepipepollprepareprocessstreamtcptimerttyudpsignalfilereqconnectwriteshutdownudp_sendfsworkgetaddrinfogetnameinfomake_log_seq_stringcreate_log_seq/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/online_log/log_seq.cseq: %dstrlen(ls_name):%d is too long,the max len is %d%s is too long | make log "seq name" errorap_cfgsmt_cfg%02d-%02d %02d:%02d:%02d%smake log "seq time" errorerc:%d%smake log seq "error repeat count" error%d:0x%x%d:%02d-%02d %02d:%02d:%02d%d:%scall sprintf errorchange_log_seq_name__insert_log_seqMallocmem partition index:%d begin:%p end:%p pMemFreeList:%p memBlkSize:%d memNBlks:%d memNFree:%d *********************************** /var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_adapter/utilities/mem_pool.cSysMalloc failed size:0x%xmqc_upgd_progress_rept_v41mqc_p2p_data_rept_v41__mqc_proto_cb_QUERY_31__mqc_proto_cb_SUMMER_TABLE_41__mqc_obj_handle_da_req__mqc_proto_cb_cloud_stream_gatewaymqc_door_bell_press__mqc_calc_user_namemqc_get_wakeup_datalowpower_err_log_seq_cb__mqc_proto_cb_CMD_5mqc_app_initmqc_get_heartbeat_data__mqc_app_recvmqc_custom_pub_sync__mqc_custom_async_cbmqc_book_wakeup_topic/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/mqc_app.cTLS Mode is NOT TLS_DISABLE:%d .set username = gwidRev Set Summer Table Cmdnot found dstIntervalsRev DP QueryciddpIdRev Upgrade Cmd. Begin To UpgradefirmwareTypeget firmwareType failgw_get_upgrd_if error:%dRev Timer Update Cmd. Update TimerRev Remote Reset Cmdreset_factorycmd is reset factory, ungisterunactivegw reset error:%dRev DP Cmddpsdps value not in jsonsend_gw_dev_cmd error:%dmqtt is disconnectedmqtt connected successSend MQTT Msg.P:%d N:%d Q:%dpack_data_with_cmd err:%dmqc_pub_async err:%dcustom async cb op_ret: %dreport upgrade status through mqtt timeout..%dno data jsonreceive cloud stream gateway MQ messageiot_permit_mqtt_connect_cb called ret:%dget_gw_nw_status:%dbegin to get pr mcd...http_dynamic_cfg_get error:%dthe gateway is not existgateway is unregisteredgw_unregister error:%dgateway is unactivedgw_unactive error:%dgateway get delete status fail. ret:%d status:%dvalidTimevalidTime is Not In Responseget pr mcd success. limit:%umqtt connect deny times:%dgateway get delete status ret:%d status:%dcannot register cbs. reach max %dmq_pro:%d mqc_handler_cnt:%dRev DP Reqcan not get reqTypesigQry{"reqType":"sigQry","data":{"signal":%d}}logQryrev log query.uuid = %sgw_upload_log error:%d.tmpjson->valuestring invalid %sgateway at upgrade statusparse_data_with_cmd error:%dparse error data is %sparam is no correctcmd_time:0x%x cur_time:0x%x set_lmt:0x%xget json errMQ Not Find %d Or Handler Err cnt:%d op_ret:%dinput invalid:%d{"protocol":%d,"data":{"progress":"%d","firmwareType":%d,"cid":"%s"}}the size of arr is too small %u < 9d/w/lowpowermqtt start fail, dev not actived. %dmqc app is already initedmqtt url is nullMQTT Protocol URL:%s Port:%dMalloc Fail %dsmart/device/in/TLS in not disable. disable mqtt time checkcreate_mqtt_hand error:%d/av/d/smart/device/out/mqtt send topic:%smq_cntl_taskinput failed{"success":%s,"devId":"%s","logUrl":"%s","logSuf":"%s","uuid":"%s","bucket":"%s"}resp:%smqc_prot_data_rept fails %dwakeup_data == %x edata1 == %s edata2 == %s edata3 == %s {"etype":"doorbell","edata":"%s","devId":"%s","filename":"%u.%s"}{"etype":"%s","edata":"%s","devId":"%s","filename":"%u.%s","time":"%u"}mqc is offlinecreate seme fails %dmqc_custom_pub_async err:%dmqc_log_notify__mqc_proto_cb_RESET_11__mqc_conn_cb__mqc_disconn_cb__mqc_conn_deny_cbmqc_door_bell_answer__mqtt_upgrade_publish_cb__mqc_prot_data_reptmqc_app_register_cb__mqc_get_pr_mcdmqc_custom_pub_asyncmqc_door_bell_press_genericmqc_send_mqtt_msg_with_topic__mqc_permit_cb__mq_upgrade_req__mqc_proto_cb_TIMER_UG_13__mqc_proto_cb_UPGRADE_15__mqc_very_prcmd_pr__mqc_proto_cb_DATA_REQ_22create_mqtt_hand__pub_ack_timeout_proc__mq_send__mq_ctrl_taskmqtt_get_socket_fd__mq_client_sock_connmqtt_publish_async__mq_recv_raw__mq_reset_use_table__mq_logic_conning_proc/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_middleware/mqtt/mqtt_client.cclose mqttshutdown fd is enabledqos1 package timeout. cnt:%drespond timeout -->>respond timeout <<--mqtt_ping -->>mqtt_ping error,errno:%dmqtt_ping <<--unw_recv err:%d errno:%d%s startmqtt task is not permit to execute. random sleep..mqtt task is not permit to execute. short sleep..select mqtt host:%sresolve mqtt host Fail:%s erro:%dmqtt get serve ip successreset use table:%dunw_socket_create failed, errno:%dunw_set_reuse failed, errno:%dunw_disable_nagle failed, errno:%dfail to setsockopt keepalive, errno:%dserverIP %d port:%dmqtt over TLS is enabled. Host:%s Port:%dtuya_tls_connect error:%dmqtt socket create success. begin to connectmqtt socket connect success. begin to subscriberet:%d.__mq_recv read fail %d__mq_recv err op_ret:%d recv_len:%dmsg_ack_type:%d.recv:%dmqtt connect respond err data:%dmodule_start_tm_msg err op_ret:%dmqtt subscribe successmqtt subcribe respond err msg_id:%d parse msg_id:%ddo't support qos == 2 publish messagesend mqtt publish ack errorping respond. update fail_cnt:%d time %d__mq_conn_recv err:%dmqtt fail_cnt:%u and sleeptime:%d msmqtt socket connect fail. retry_cnt:%d op_ret:%d errno:%d__mq_logic_conn_proc err:%dInput in invalidsubcribe_topic:%sclient_id:%suser_name:%sdisconnect mqttmqtt_disconnect errormqtt_pub_msg_with_qos ret:%dmqtt_pub_msg_with_qos ret:%d errno:%dcan't find free mqmdeunscribe:%sunsubscribe %s err %d subscribe %s return %d subscribe new topic %s return %d add new topic %s __mq_recvmqtt_book_wakeup_topic__alive_tm_msg_cb__resp_tm_cb__mq_ctrl_task__mq_send_raw__mq_conn_recv__mq_closemqtt_add_topic_without_subcribemq_disconnectmqtt_book_additional_topic__write_log_seq_stats_to_uf__open_udp_log_fd__write_log_seq_content_to_uflog_serv_init__mid_handle_log_seq_cb__udp_log_outputlog_serv_handle_mqtt_req__get_log_seq_file_datalog_serv_handle_err_log_seq_cb__tmm_sync_log_seq_cblog_serv_upload_custom_realtime_loglog_serv_upload_custom_runstat_log/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/online_log/online_log_serv.chas no %s filefile %s length is not right %dmalloc errread file %s not right %d %dfile %s end char is not right %sa+fopen errorfile %s is out of range %d %dwrite log buf : %sufwrite err %d %d{"max":%u,"last":%u,"first":%u}****************write ufstat. %smqttRLogtimeout. close mqtt loglanLogtimeout. close udp logudp log fd is closed. %dclose udp log fdtimeout. restore log level:%dlog/realtime/%slog/log_seq/%slog/runstat/%smqtt log topic init %srunstat log invalidlogseq_topic topic is NULLupload log_seq success.%supload log seq fail. %d save to uf%slogseq%dlocal max log_seq reach max.%ufile %s is full,open another one__write_log_file rewrite failed %dwrite log_seq. name:%s max:%u last:%uwrite file %s failed %dudp log fd is not openedem_sys_envload env success %senv %s same. need not to updateload env fail. maybe not exist.{"value":"{\"embed_sys_env\":\"%s\"}"}update property:%shttp_gw_property_save error:%d next:%d %dnet_cfg_logupload loq seq %s fail %d. try next timeupolad net_cfg log: %s%d %dall log seq uploaded%d upolad net_cfg log: %s %d %d read log file failed. %s %d fir:%u max:%ucreate tm msg fail. %dcmmod_get_free_msgid fail. %dcmmod_reg_msgcb fail. %dlog_seq_statr+wrlog stats open fail,creat it log stats ufread fail.parse log seq fail.%slastparse log seq fail.read from uf. max:%u first:%u last:%ulog serv init success{"reqType":"localLog","data":{"ret":false}}{"reqType":"localLog","data":{"ret":true}}{"reqType":"lanLog","data":{"ret":false}}{"reqType":"lanLog","data":{"ret":true}}{"reqType":"mqttRLog","data":{"ret":false}}{"reqType":"mqttRLog","data":{"ret":true}}input invalidreqType not in jsonlocalLogdata not in jsonlevel ts not in jsoneff:%u <= curr:%u . time invalidget default log level:%dset log level:%d eff:%u curr:%uport ts not in jsonudp log port:%d eff:%u curr:%uudp log fd is opened. %dopen udp log fd:%dts not in jsonmqtt log open eff:%u curr:%urunstat_topic topic is NULLsum-tmemrssirunstat:%srealtime_topic topic is NULLwrite %s log %s write succ%s write failed %dseq log is null__write_log_file__tmm_lan_log_timeout_cb__close_udp_log_fd__tmm_runstat_log_cb__tmm_local_log_timeout_cb__init_log_seq_stats_from_uf__init_mqtt_log_topicslog_serv_handle_mqtt_err_log_seq_cblog_serv_handle_netcfg_err_log_seq_cb__upload_log_seq_loglog_serv_upload_custom_seq_log__tmm_upload_property_cb__tmm_mqtt_rlog_timeout_cb @6ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:parameter error[%s][%d]! PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:AES_encrypt__check_dp_flow_ctl__sf_handle_recv_dpsf_raw_dp_report_sync__sf_set_obj_dp_pv_stat_by_dc__sf_dp_report_aysncsf_raw_dp_report_sync_with_timesf_respone_obj_dp_querysf_stat_dp_report_sync__append_send_jsonsf_get_serial_no__sf_add_devid_time_to_dpstr__sf_obj_dp_report_async_cb__sf_response_query_obj_dp__check_dp_type/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/smart_frame.cDP ID %d SkipDP ID %d Set To %dnew flow check timezone.curr_t:%u dpID:%dupdate flow check send cnt %d dpID:%ddp_cntl is nulljson parse fail %sjson fail %sMalloc Fails %d{"dps":%s{"dps":%s,"cid":"%s"sprintf %d,"t":%sadded buf:%ssmart frame has been initedsystem_timer_init fails %dcmmod_init fails %dCreateMutexAndInit fails %dcmmod_get_free_msgid fails %d %dcmmod_reg_msgcb fails %d %dcmmod_cr_tm_msg_hand fails %d %dfirst serial number: %dmalloc fails :%dcr_rfc_data fails :%dcreate json failsdp id %d Skipjson print fails__sf_add_devid_time_to_dpstr fails %d__sf_mk_rfc_msg_data fails %dlan_dp_sata_report error:%dmqc_obj_dp_query error:%ddp id Invalid %dRev Cmd %dctypedp transfer type error type is :%dcan't find devicemalloc fail %dmalloc error obj_dp_cnt:%dsf_obj_dp_qry_dpid error:%d %d %d__smt_frm_cmd_prep error:%dDP ID %d Invaliddp enum value[%s] invalidmqtt async dp cb %ddevID:%s Not FinddevID:%s Not Bindbefor Verify: %d %d %sJson FailsDP ID:%d Verify Fails %d %d %d %dobj filter type invalid %dbool check fail %dvalue check fail %d %d %d %dstr check fail %d %s %denum check fail %dbitmap check fail %d %d %ddp_cntl->dp_desc.prop_tp %draw filter invalid %dfile not supportdp_cntl->dp_desc.type %dNot Flow Ctrl. DP ID:%d flow check:%d curr_t:%u first_t:%u send:%d lmt:%d dp passive is true.dp<%d> check. need_update:%d pv_stat:%d trig_t:%d filter_type:%d force_send:%dcJson print failsNeed Send %sNeed NOT Sendnothing to senddp verify fails %dNet Invalid %dadd time && devid fails %dmd rfc fail %dEnable Lan Sendmqtt async send fail %dUpdate Local DP StatusDP ID:%d Not Findenum check fail %ssync to report dp fail. %dreport finish %dcr json errPack local dp values reset_flow_ctl:%dNothing To PackSkip DP ID %dunsupported dp typereach MaxLen %d %dJson Print failaddDevId:%dfinal pack:%sNetWork Unavailable. schedule again, %dSync FinishStart To Sync Dev:%sDP Msg Too Long, schedule againOUT IS NULL__sf_dp_report_aysnc fail %d, schedule againsync result:%dpDpIdArr is NULLdpid cnt< %d >:get_gw_dev_cntl errquery cid:%s{"%d":"%s"}Send DP: %dSend Raw: %s retrans:%dSend Stat:%s Time:%s retrans:%d__dev_obj_dp_set_pv_stat__tmm_dp_sync_cb__sf_pack_local_obj_data__sf_mk_rfc_msg_datasmart_frame_init__dp_verify_flowctl_update__sf_dp_report_sync__sf_set_obj_dp_pv_stat__set_dp_flow_ctl__sf_gw_dev_cmd_cb %s: Pre-salted RTCP IV = %s %s: RTCP SALT = %s srtp: in stream 0x%x: SSRC collision key usage soft limit reached key usage hard limit reached packet index limit reached unknown event reported to handler %s: Pre-salted RTP IV = %s %s: RTP SALT = %s libsrtp2 2.2.02.2.0%u.%u.%u%s: cloning stream (SSRC: 0x%08x) %s: srtp key len: %d %s: srtcp key len: %d %s: base key len: %d %s: kdf key len: %d %s: rtp salt len: %d %s: cipher key: %s %s: found rtp_salt_len > 0, generating salt %s: cipher salt: %s %s: extensions cipher key: %s %s: found rtp_xtn_hdr_salt_len > 0, generating salt %s: extensions cipher salt: %s %s: auth key: %s %s: rtcp salt len: %d %s: found rtcp_salt_len > 0, generating rtcp salt %s: rtcp cipher key: %s %s: rtcp cipher salt: %s %s: rtcp auth key: %s %s: initializing stream (SSRC: 0x%08x) %s: function srtp_protect %s: function srtp_protect_aead %s: estimated packet index: %016llx %s: estimated u_packet index: %016llx %s: keystream prefix: %s %s: srtp auth tag: %s %s: function srtp_unprotect %s: using provisional stream (SSRC: 0x%08x) %s: function srtp_unprotect_aead %s: computed auth tag: %s %s: packet auth tag: %s %s: srtcp index: %x %s: srtcp auth tag: %s %s: srtcp using provisional stream (SSRC: 0x%08x) %s: srtcp computed tag: %s %s: srtcp tag from packet: %s srtpsys_start_timerIsThisSysTimerRunsys_trigger_timersystem_timer_releasesys_stop_timer/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_base/sys_serv/sys_timer.csys timer handle init fail. system timer process run. system timer process exit. system timer has been initedcreate timer queue failssys_timercreate timer thread failssystem timer has not been initedadd timer fails, invild inputGet Idle Timer Id Fails %dadd timer to queue fails %dStart Timer Fails %d %d %d ret:%dTrigger Timer Fails %d ret:%dDelete Timer Fails %d ret:%dStop Timer Fails %d ret:%dDelete System Timer Thread Fails. %dDelete System Timer Thread SuccessReleaseTimerQue Fails. %dReleaseTimerQue Successsys_timer_thrdsys_delete_timersystem_timer_initsys_add_timer@ __update_time_task_from_cloud__increase_arr_size__load_timer_task_from_disk__reset_timer_task__add_task_to_arr__timer_task_query_func/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/timer_task.cmalloc fail %d %dIncrease Timer Arr %d %dadd timer to idx:%dsome error occur %d %d create cjson faillastFetchTimearrhourloopTIMER:%stimer_arrwd_common_write err:%dexecute timer task: %sgateway at upgrade status. skip upload timer logexecute timer fails %dpTimer->dps_info is NULLupload timer log:%stimer task query, update cnt:%dnot registered. skip:%dget timer cnt failtimer query time equal. skip:%dtimer query time NOT equal %d %d begin updatecountget timer cnt NO lastFetchTime get timer cnt:%dget timer cnt NO count timer cnt %d > MAX %dreset local timer task. write_disk:%dupdate timer content: %d - %dtimersGet Timer Item Fails %d %d loopsget timer errsingle timer trigger %d-%d-%d %d:%d. %sDelete Timer Task. cnt:%dloop timer trigger %d %d:%d. %screate log seq fail..%dcmmod_cr_tm_msg_hand fail.%dtm_msg start TIMEID[%d] err %dno timer task in local dbjson parse fail.%sread timer:%sget cnt info errorMalloc %d Failstimer_task_init__execute_timer_task__upload_timer_log__save_time_task_to_disk__delete_task_from_arrtuya_p2p_rtc_packetized_frame_destroytuya_p2p_rtc_frame_list_check_limitsrc/tuya_frame.cpkt: %p: %d, %d, %d = %d + %d + %d packet != ((void *)0)packetize frame failed: h264 packetize failed packetized frame: pts %llu, len %d, type %d, total_packet_number %d packetized frame %d, %d, %d, %llu, %d, %d frame list set close flag frame %d: %d ms, %d bytes, %d packets frame list: create list failed (malloc) frame list closed packetized_frame != ((void *)0)try find packet %d in frame %d [%d:%d] dump frame list: @@@@@@@@˨(8hxHX(8hxHX ` ` ` `Pp0Pp0 @ @ @ @ @@ @ @ VR^ZFBNJvr~zfbnj+)/-#!'%;9?=3175XHxh8(XHxh8(` ` ` ` 0pP0pPꕕ%s %d error tuya_g711_encodetuya_g711_encode_16KÄńDŽɄ˄̈́τфӄՄׄلۄ݄DDDDDDDD$d$d$d$d4Tt4Tt ,|<|:|8|6|4|2|0|.|,|*|(|&|$|"| << < < < < < <\\\\lL, lL, tdTD4$xph`XPH@80( src/tuya_h264_packetizer.cpacketize nal fua failed: allocate memory packetize nal stapa failed: allocate memory stapa rtp payload: %02hhx %02hhx %02hhx %02hhx...[%d] h264 packetize nal: %p:%d find next nal unit failed: can find nal start find next nal unit failed: can find nal header h264 packetize failed: find next nal unit failed h264 packetize failed: packetize nal failed src/tuya_ice.cice %u check %u: update status %u on nat type detector: ip_type %d, nat_type %d ice %u check %u: [%s(%s) -> %s] status %d priority %llu nominated %d ice %u check %u: create [%s->%s] ice %u check %u: perform connectivity check, time = %llu ice %u nominated check %d %s -> %s ice %d keepalive failed ice %d update check: %d, priority %llu ice %d has first nominate check ice %d nominated check updated, old check %d ice %u state change: %s -> %s recv from stun sock while stun_sess == NULL srflxrelaycand: type %d, status %d, priority %lu, %s[%s] ice %u check %u: complete with status %d, time = %llu ice %u check %u: role conflict, try again baklog: ice %u process incoming check: tp type %u, nominate flag %u, role %u, src_addr %s remote cand count: %d try add new remote cand, %s : %s ice %u check %u: try nominate ice %u on stun session rx request from %s a=candidate:%d 1 UDP %u %s %d typ %s ice %d on stun sock status: %d ice %d on turn sock status: %d credentialurls?transport=tcpTCPturn:stun:nat:%.*s0.0.0.0::create ice session: %d, time: %llu ice %d add remote cand: %s ice %d has all remote candidate a=candidate:%s %d %s %d %s %d typ %sUDPudpCHECKCONNECTED__dp_data_compositionL5yNB6mbAem9J75ebEOxoXz4ygTH9bj8GiexUIf4xPOzEJFPImqatuya_iot_fresh_dev_hbtuya_iot_init_paramstuya_iot_gw_bind_dev_attrtuya_iot_dev_online_stat_updatedev_report_dp_json_asynctuya_iot_gw_subdevice_update_versions/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/com_sdk/tuya_iot_com_api.cdevid:%s dparr[%d]:%d not finddparr[%d] type not match.%d %ddparr[%d] enum value not match.%d %ddparr[%d] type invalid %d"%d":true,"%d":false,"%d":%d,"%d":"%s","%d":%u,dp compo:%sdp time:%s < TUYA IOT SDK V:4.1.1 BS:30.01_PT:2.2_LAN:3.3_CAD:1.0.1_CD:1.0.0 > IPC DEFS < ENABLE_ECHO_SHOW:1 ENABLE_CHROMECAST:1 ENABLE_CLOUD_STORAGE:1 >' < BUILD AT:2020_06_05_20_53_27 BY chenjing FOR linux_wifi AT arm-anykav200-linux-uclibc-4.8.5 > adapter_platform_init err %dNULL fs_storge_pathrts3903init fs. Path: %s db init fails %dsmart frame init fails %dlog_serv_init err %dty_work_queue init fails %dtuya tls init fails %dENABLE_SUBDEVICE is not enabled when builddp composition fail.ret:%ddp report async fail.ret:%dtuya_iot_sys_mag_hb_inittuya_iot_gw_unbind_devtuya_iot_upgrade_dev_notifytuya_iot_dev_traversaltuya_iot_get_dev_iftuya_iot_set_dev_hb_timeout_cfg__tuya_init_db_encryptediot_wf_gw_unactive_custom_mode/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/com_sdk/tuya_iot_internal_api.cgw unactive with specific mode:%dwifi mode invalid:%d only support ap first/smart first__get_wf_nw_stat/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/wifi_sdk/tuya_iot_wifi_api.cwifi netstat changed to:%d -->>wifi netstat changed to:%d <<--register wifi network monitor. interval:%dtuya_iot_reg_get_wf_nw_stat_cb_paramstuya_iot_wf_gw_unactivetuya_ipc_unpack_aac_rtptuya_ipc_show_adts_info/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/p2p/ppcs/tuya_ipc_aac_rtp.cADTS INFO: id = %d layer = %d protection_absent = %d profile = %d sf_index = %d private_bit = %d channel_configuration = %d original = %d home = %d aac_frame_length = %d input param error[%p][%p]not aac datainput param error[%d][%p]input param error %p %p %drtp_len [%d] input param error[%p][%p][%p]data error [%d][%d][%d]tuya_ipc_comb_adts_headertuya_ipc_parse_adts_headertuya_ipc_pack_aac_rtp/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/p2p/ppcs/tuya_ipc_g711_rtp.ctuya_ipc_pack_pcm_rtptuya_ipc_unpack_pcm_rtptuya_ipc_pack_h265_rtp_packtuya_ipc_get_nal_offsettuya_ipc_get_annexb_nalu/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/p2p/ppcs/tuya_ipc_h264_rtp.cinput param error [%p] [%p] [%d]error param [%p] [%p] [%d] nalu head not 00 00 00 01 or 00 00 01input param error[%p][%p][%p] param error[%d][%d]nalu len error [%d]inout param errorrtp data error marker[%d] tuya_ipc_pack_h264_rtp_packMotoMqttBookTopicForce/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/moto_mqtt/tuya_ipc_moto_mqtt.cbook topic startbook topic %s fail, ret %dbook topic doneiot_gw_reset_cbtuya_ipc_get_p2p_auth_proctuya_ipc_p2p_reboottuya_ipc_p2p_get_idtuya_ipc_get_p2p_authtuya_ipc_p2p_get_auth_param/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/p2p/common/tuya_ipc_p2p_common.cp2p_auth_inforead p2p_auth_info fails ..%dload str:%sparse json failsinitStrcrcKeyp2pKeywakeupServerKeywakeupServerListad%06xp2p passwd change to %spasswd update failed [%d]p2p_pwdp2p passwd update failedget p2p passwd = %sadminget p2p auth failedSY P2P AUTH:%scheck p2p auth update or notp2p_typetutkppcsmqtt_p2pppcs+mqtt_p2pupdate p2p_auth_info from service, type %dget p2p auth info from serviceget p2p auth retry cnt[%d]no need update p2p_auth_info from service__beginreset p2p_auth_info failedreset p2p_pwd failedreset p2p_type failedp2p unlike error ,reboot systempasswd update failed %d tuya_ipc_check_p2p_auth_updatetuya_ipc_p2p_update_pwiot_permit_mqtt_connect_cbtuya_ipc_p2p_get_pwGetPackagerInstance/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_ipc_sdk/TStreamer/tuya_ipc_packager.cget packager instanceget packager instance done%H:%M:%S%s %s%-5s %s:%d: %Y-%m-%d %H:%M:%S%s %-5s %s:%d: TRACEDEBUGINFOWARNERRORFATALcircle_buffer_pop_frontyesnosrc/tuya_misc.ctry check system support of ipv4/ipv6 system has ipv4(%s), has ipv6(%s) get nonblock failed set nonblock failed %02hhxdestroy msg, remain size = %d failed ! mbedtls_ctr_drbg_seed returned -0x%04x failed ! mbedtls_pk_setup returned -0x%04x failed ! mbedtls_ecp_gen_key returned -0x%04x failed ! mbedtls_pk_write_key_pem returned -0x%04xpkey: %s failed ! mbedtls_ctr_drbg_seed returned %d - %s failed ! mbedtls_mpi_read_string returned -0x%04x - %s failed ! mbedtls_pk_parse_keyfile returned -x%02x - %s CN=Cert,O=WebRTC,C=US failed ! mbedtls_x509write_crt_set_subject_name returned -0x%04x - %s failed ! mbedtls_x509write_crt_set_issuer_name returned -0x%04x - %s failed ! mbedtls_x509write_crt_set_serial returned -0x%04x - %s 2018010100000020351231235959 failed ! mbedtls_x509write_crt_set_validity returned -0x%04x - %s cert: %s sha-1sha-224sha-384sha-512calculate cert fingerprint: invalid md type calculate cert fingerprint: parse crt calculate cert fingerprint: hex to string src/tuya_nat_detector.cuv_udp_init failed, ret = %d uv_udp_bind failed, ret = %d, %s uv_udp_recv_start failed, ret = %d create udp socket failed create stun session failed create filtering test failed create mapping test failed mapping test 1 timeout mapping test 2 timeout mapping test 3 timeout mapping test result: %d %d %d nat detector uv_getaddrinfo failed nat detector on dns resolved: status = %d nat detector on dns resolved: server: %s nat detector state change: %s -> %s nat detector: mapping type = %d, filtering type = %d nat detector on_data_recvfrom nread:%ld, addr:%p create nat detector, server1:%s:%d, server2:%s:%d nat detector destroy CHECK_DNSCHECK_MAPPINGCHECK_FILTERINGCHECK_FAILEDtuya_p2p_memory_pool_destroytuya_p2p_memory_pool_allocatetuya_p2p_memory_pool_free((const QUEUE *) (&pool->used_list) == (const QUEUE *) (*(QUEUE **) &((*(&pool->used_list))[0])))src/tuya_pool.cnode != ((void *)0)node->prefix == 0x12345678node->suffix == 0x87654321find_attr_desctuya_p2p_encode_sockaddr_attrtuya_p2p_stun_msg_encodetuya_p2p_stun_msg_add_attr2, data=mandatory_attr_desc[TUYA_P2P_STUN_ATTR_END_MANDATORY_ATTR].decode_attr == ((void *)0)src/tuya_stun_message.cmandatory_attr_desc[TUYA_P2P_STUN_ATTR_USE_CANDIDATE].decode_attr == &tuya_p2p_decode_empty_attrbuf - start_buf == ATTR_LEN???success responseerror responseindicationTUYA_P2P_FALSEfingerprint err msg->attr[msg->attr_count-1] != ((void *)0)Unknown error %dAttribute %s has invalid lengthError decoding message: %.*s Error parsing unknown TUYA_P2P_STUN attribute type %d %s in %sError parsing TUYA_P2P_STUN attribute %s: %s Error decoding TUYA_P2P_STUN message: unparsed trailing %d bytes %s%s%s%sIPv4IPv6STUN %s %s Hdr: length=%d, magic=%08x, tsx_id=%08x%08x%08x Attributes: Attr 0x%x %s: length=%d, %s addr=%s , INVALID ADDRESS FAMILY! , chnum=%u (0x%x) , value=%u (0x%x) , value="%.*s" , err_code=%d, reason="%.*s" , unknown list:uv_inet_ntop failed SOFTWAREALTERNATE-SERVERREFRESH-INTERVALFINGERPRINTICE-CONTROLLEDICE-CONTROLLINGRESPONSE-ADDRESSCHANGE-REQUESTSOURCE-ADDRESSCHANGED-ADDRESSUSERNAMEPASSWORDMESSAGE-INTEGRITYERROR-CODEUNKNOWN-ATTRIBUTESCHANNEL-NUMBERLIFETIMEMAGIC-COOKIEBANDWIDTHXOR-PEER-ADDRESSDATAREALMNONCEXOR-RELAYED-ADDRESSREQUESTED-ADDRESS-FAMILYEVEN-PORTREQUESTED-TRANSPORTDONT-FRAGMENTXOR-MAPPED-ADDRESSTIMER-VALRESERVATION-TOKENXOR-REFLECTED-FROMPRIORITYUSE-CANDIDATEICMPTry AlternateBad RequestUnauthorizedForbiddenUnknown AttributeAllocation MismatchStale NonceActive Destination Already SetWrong CredentialsUnsupported Transport ProtocolOperation for TCP OnlyConnection FailureConnection TimeoutAllocation Quota ReachedRole ConflictServer ErrorInsufficient CapacityGlobal FailureUnknownBindingSharedSecretAllocateRefreshSendDataCreatePermissionChannelBindsrc/tuya_stun_session.cauthenticate_req failed, no username authenticate_req failed, invalid username authenticate_req failed, get_cred = %d stun session send msg failed, ret = %d tuya_p2p_stun_tsx_on_complete: handle challenge tuya_p2p_stun_tsx_on_complete tuya_p2p_stun_tsx_on_complete: handle challenge failed on_incoming_response cant find tdata! on_incoming_response tuya_p2p_stun_authenticate_response status:%d! authenticate_req ret = %d src/tuya_stun_socket.csess_on_request_complete: status = %d not get TUYA_P2P_STUN_ATTR_XOR_MAPPED_ADDR sess_on_request_complete: status = %d, no mapped attr stun sock on nat64 discovery: status = %d query ip, type = %d(%d) stun server: %s stun socket close create stun sock, server:%s:%d uv_getaddrinfo failed stun sock get bound address failed has bound address src/tuya_stun_transaction.ctuya_p2p_tsx_transmit_msg start to send msg! retransmit count = %d on_timer_timeout! 00 ~_v AB0  *H  01 0 UUS10U California10U San Jose10U Tuya Global Inc.10U *.tuyacn.com10U *.tuyaeu.com10U *.tuyarf.com10U *.tuyajp.com10U *.tuyain.com10U *.tuyaas.com10U *.tuyaaf.com10U *.tuyasa.com10U *.wgine.com10U *.tuya-inc.cn10U *.tuyaus.com10U *.tuya.com1 0 U Tuya1!0 *H  iot_world@tuya.com10U *.tuyaus.com10U *.tuyacn.com10U *.tuyaeu.com10U *.wgine.com10U *.tuya-inc.cn10U *.tuyajp.com10U *.tuyain.com10U *.tuyaas.com10U *.tuyaaf.com10U *.tuyasa.com10U *.tuyarf.com10U *.tuya.com0  181031053048Z21181007053048Z01 0 UUS10U California10U San Jose10U Tuya Global Inc.10U *.tuyacn.com10U *.tuyaeu.com10U *.tuyarf.com10U *.tuyajp.com10U *.tuyain.com10U *.tuyaas.com10U *.tuyaaf.com10U *.tuyasa.com10U *.wgine.com10U *.tuya-inc.cn10U *.tuyaus.com10U *.tuya.com1 0 U Tuya1!0 *H  iot_world@tuya.com10U *.tuyaus.com10U *.tuyacn.com10U *.tuyaeu.com10U *.wgine.com10U *.tuya-inc.cn10U *.tuyajp.com10U *.tuyain.com10U *.tuyaas.com10U *.tuyaaf.com10U *.tuyasa.com10U *.tuyarf.com10U *.tuya.com0"0  *H 0 ka!St b↍ْ'TCkIsXBοCΘNn'uuV6ҞXcn,^q V9 4PTKIDZfz&57[/ ?"dp*8'{_aUt *sRTvl~u]~AuԒ&~㙔 jep76Yõsw_ver:%sdi->dev_sw_ver:%sgw_di read successlckeyh_urlhs_urlhs_pskmqm_urlmqs_urlmq_urltime_zs_time_zwx_app_idwx_uuidgw_aigw_ai write fails %dgw_ai write successdls_timegw_ai read fails %dgw_ai read successtpbindudddddi-%sddi write fails %dddi write successddiddi fuzzy read fails %dddi read fails %dddi read successddi fuzzy delete fails %dddi fuzzy delete successkvs_delete fails %s %dddi delete successschema write fails %s %dschema write successschema read fails %s %dschema %s read successschema %s delete successuser_param_keykvs_write err:%dkvs_read err:%d__ty_serializewd_gw_base_if_readws_db_user_param_readwd_gw_actv_if_readwd_dev_if_writewd_gw_wsm_writewd_dev_if_read__ty_db_serialize_savety_work_queue_initty_work_queue_add/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_base/sys_serv/ty_work_queue.cty work queue is alreayd initedinit work queue. stack size:%d pro:%d num:%dty work queue create fails. ret:%dty work queue create successty work queue is NOT initedty work queue add fails. ret:%dty work queue add successCreateMsgQueAndInit/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_base/sys_serv/uni_msg_queue.ccreate msg queue fails, invalid paramcreate mutex failscreate semaphore fails/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_adapter/system/uni_semaphore.csemaphore init fails %d %dCreateAndInitSemaphoreCreateAndStart__WrapRunFuncGetThrdSta__cr_and_init_del_thrd_magDeleteThrdHandle__inner_del_thread__add_del_thrd_node/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_adapter/system/uni_thread.cdel list not empty...deletingThread:%s is still running..Final Free Thread:%sreal delete thread:0x%xenter Thread:%s func callThread:%s Exec Start. Set to Running Statusexit Thread:%s func callThread:%s Exec Finish. Set to Delete StatusInit Thread Del MgrMalloc Del Mgr FailsCreate Mutex FailsMalloc Thread Mgr FailsCreate Thread Fails %dDelete Thread:%sAdd Thread:%s To Delete List__free_all_del_thrd_node%s-%dwk_thwf_wk_mode_setwf_all_ap_scan/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_adapter/wifi_intf/wf_basic_intf.ccreate mutex failwf_assign_ap_scan__bc_sniffer_cb__wf_nw_cfg_init__mimo_sniffer_cb__lock_chan_cb/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/wifi_cfg_serv/wf_nw_cfg.cbssid is NULL... channel is error... %dmalloc failed! wf_get_cur_channel err:%dChannel is not match %d %d!!!wf_set_cur_channel[%d] err:%dSet New Channel %dchannel errorlock channel cb %d channel:%dlock BSSID %02X-%02X-%02X-%02X-%02X-%02XBSSID In Param Reset channel:%dcurrent channel:%dwf_set_cur_channel errorsta search all ap and num: %dindex:%d invaild param, channel:%d, bssid:%02x-%02x-%02x-%02x-%02x-%02xchannel:%02d bssid:%02x-%02x-%02x-%02x-%02x-%02x ssid:%swifi network config timeout,then init and config again -->>__wf_nw_cfg_init error:%dwifi network config timeout,then init and config again <<--__chan_change_time_cb__beacon_info_cb__wifi_nw_cfg_timeout_cb^/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/wifi_cfg_serv/wf_sniffer_intf.cbeacon ssid id error:%dbeacon rate id error:%dbeacon channel id error:%d__sniffer_cb__ak_bc_mgk_parse__ak_bc_data_parse__ak_bc_mgk_prefix/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/wifi_cfg_serv/airkiss_bc.cmgk_parse Temp Buf :%02x %02x %02x %02xRev mgk Success,totalLen %02x, finish_flag:%x need_seq:%dmgk_prefix Temp Buf :%02x %02x %02x %02xRev mgk_prefix Success,p_len %02x, finish_flag:%xindex:%d data:%02x %02x %02x %02xRev Data Success,ssid:%s pwd:%s random:%02xfrom:%d Captrue hd %d %d %d %d BasicVal[%d]:%dCapture Success. Curr best channel:%d Lock channel:%dfrom:%d Capture Not Equal i:%d %d-%d[mimo lock] type:%d rssi:%d chan:%d__mimo_ak_bc_hd_parse__ak_bc_hd_parse%s: (location: %p) allocated %s: allocation failed (asked for %d bytes) %s: (location: %p) freed alloc__setup_tcp_serv_socketlan_dp_sata_report__lpc_set_socket_fault__check_socket_tmlan_ap_nw_cfg_startencrpt_lan_msg__up_socket_timelan_ap_nw_cfg_stoplan_data_report_cb__lan_dp_report_cblan_pro_cntl_exit__udp_ap_v3_task__get_lpc_socket_num__mlp_gw_tcp_send__udp_dev_discovery__get_lpc_valid_socket_num__airkiss_lan_discovery__lan_dev_tm_cb__lpc_add_socket__lpc_task_cb__lan_protocol_process__lan_parse_data__mlp_gw_send_dalan_pro_cntl_init__get_lpc_sockets_fault__lpc_close_all_socket__lan_encryption_pre_handle__lpc_close_socket/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/app_agent.cCurr Socket Num:%dsocket all falult:%d socketNum:%d aes128_ecb_encode error:%dclose all socketset socket fault err %d %dset socket fault %dfind error socket %dthe socket %d is faulttcp sendbuf socket:%d fr_num:%d fr_type:%d ret:%d len:%dsend length:%dCreate Send Buf Failsret:%d send_len:%d errno:%dTCP Send buf Successno fd find %d, set falutfd %d status:%dno socket connect. returnpack_data_with_cmd error:%dPrepare To Send Lan:%s__mlp_gw_tcp_send op_ret:%dlan is inited beforeMalloc lan_pro_cntl failsWechat Mode, start WeChat thread to listen LanTUYA Mode, start TUYA thread to listen Lanstart thread fails %dcmmod register finish %dlan_pro_cntl is nullfinish_cb is NULLap cfg is inited beforeMalloc lan_ap_nw_cfg Failsunw_socket_create udp errno:%dunw_bind %d errno:%dstart thread to listen udpap cfg is NULLDeleteThrdHandle error:%dDelete threadGw Not Register, Cannot Send UDP discoverySend airkiss discoverthe station do't connect ap,status:%dSend Random %dak_lan_nwc_fin_inform error:%dak_lan_disc_pack_send error:%dsocket Num Too Many,Cannot Send Udp Broadcastcreate socket errCreate UDP Socket To Broadcast{"ip":"%s","gwId":"%s","active":%d,"ablilty":0,"encrypt":true,"productKey":"%s","version":"%s","token":truemlp_gw_send_da errorsendto Failed,len:%d ret:%d,errno:%d port:%daes128_ecb_decode error:%dfind last } fails %dlan parse decode buf:%sstart udp ap threadudp_ap_v3 recvfrom error:%dRev Data Too short %d %dFrame is Too Big To Recvcheck tail fails:0x%xRev Data:%scJSON_Parse error:%sSend Parsed result error:%dSend Parsed Result SuccessFrame Type Cannot Parse:%dEnd While. Finish AP IN UDP Listenbegint to execute __lpc_taskSetup TCP Server On Port:%dSocket creation failed: Port:%d errno:%dFailed to set reuse socket on port:%d errno:%dFailed to bind socket on port:%d errno:%dFailed to set cloexec port:%d errno:%dFailed to listen on port:%d,errno:%d.create server socket errno socket to closetime out close socket:%dclose socket err %d %dSelect failed: %d,errno:%dlan listen select timeoutactive socket num:%dsocket fault:%d errno:%dnet_accept client socket failed %d (errno: %d).errno:%dout of client limit:0x%xadd socket err %d %dadd socket %dnew client connect. nums:%d cfd:%d ip:0x%xclose socket,errno:%d errno:%dnot enough datalan data len is out of limitunw_recv_nd_size error ret:%drecv tail:0x%xup_socket_time err %d %dup_socket_time %dmlp_gw_tcp_send op_ret:%dProcess Data. Num:%d Type:%d Len:%dWhen using LAN encryption, LAN communication version number must be greater than or equal to 3.3lan version over 3.3Cmd Parse Fails %d.Cannot handleparse data errorRev TP CMD %dgw is upgrade %d.Cannot handledevice is upgrading...Not Json Cmd Parse Fails %sJson Cmd Lack devId or dps %sRev TP CMD. Send to Userrecv cmd and process errorRev Query Cmd %sJson Parse FailsdevId Not Finddevid not foundnothing to report app queryjson obj data unvalidSend Query To App:%spermit join set errorop_ret:%d frame_type:%d cjson format data errorinner process failedRev Query Dp Data:%ssf_respone_obj_dp_query error:%dquery dp failedrecv query dp errorunsupport frame type:%dthread __lpc_task quitclose socket %dlan socket num is 0. skip sendPost Msg To Send Data BY Lanenter [%s]lan no clientleave [%s]udp_ap_v3wechat_task%s: running self-test for auth function %s %s: key: %s %s: data: %s %s: tag computed: %s %s: tag expected: %s %s: test case %d failed %s: (mismatch at octet %d) auth func%s: running self-test for cipher %s %s: testing encryption %s: plaintext: %s %s: IV: %s %s: AAD: %s %s: ciphertext: %s %s: (failure at byte %u) %s: c computed: %s %s: c expected: %s %s: testing decryption %s: ciphertext: %s %s: plaintext: %s %s: p computed: %s %s: p expected: %s %s: random plaintext length %d %s: plaintext[2]: %s %s: random test case %d failed cipher__parse_data_with_pv22_lpv32__pack_data_with_cmd_pv22_lpv32/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/com_protocol.c2.1_3.1 From:%d Data:%slpv=md5 check not match %s-%spcmcd check fails. %d %dpcmcd check success! from %d %dcrc check fails %x %xFind last } fails %d"t":%d{"protocol":%d,"t":%d,"data":%sdata is NULL OR Len Invalid %dData From LAN AND V=3.1Data From LAN AND V=3.2Data From LAN AND V=3.3Data From LAN But No Match Parse %s2.1Data From MQTT AND V=2.1Data From MQTT AND V=2.2Data From MQTT But No Match Parse %sInvlaid Cmd:%d"t":%d,"s":%d{"protocol":%d,"t":%d,"data":%s,Data To LAN AND V=3.1Data To LAN AND V=3.2Data To LAN AND V=3.3Data To LAN But No Match Parse %sData To MQTT AND V=2.1Data To MQTT AND V=2.2Data To MQTT But No Match Parse %sparse_data_with_cmdpack_data_with_cmd__parse_data_with_pv21_lpv31__pack_data_with_cmd_pv21_lpv310w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-^a?݃œ~ A!@_>`#}B]async_io_watchersrc/unix/async.c/proc/self/fd/%duv__async_io...((req->loop)->active_reqs.count > 0)src/unix/fs.creq->result == 0path != ((void *)0)uv__fs_doneuv_fs_accessuv_fs_chmoduv_fs_chownuv_fs_lchownuv_fs_lstatuv_fs_mkdiruv_fs_openuv_fs_scandiruv_fs_readlinkuv_fs_realpathuv_fs_rmdiruv_fs_statuv_fs_unlinkuv_fs_utime!"unknown EAI_* error code"src/unix/getaddrinfo.c((req->loop)->active_reqs.count > 0)0req->retcode == 0uv__getaddrinfo_translate_erroruv__getaddrinfo_done%x%u.%u.%u.%u01234567890123456789abcdef0123456789ABCDEFmqc_media_pub_async__mqc_disconn_cb__mqc_conn_cbmqc_media_pub_sync__mqc_conn_deny_cb__mqc_permit_cb__mqc_calc_user_name__pack_flow_datamqc_media_register_cb/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/tuya_cloud/mqc_media_app.cmqtt-media connect is denyed. %dmqtt-media is disconnectedmqtt-media connected successgateway at upgrade status. %dMQ Not Find %d Or Handler Errcannot connect mqtt-media. get_gw_nw_status:%dcannot connect mqtt-media. get_gw_nw_status:%d.cannot connect mqtt-media. gw_wsm.stat:%dmqtt media start fail, dev not actived. %dmedia mqtt url is empty, init fail.Malloc errorMQTT Media URL:%s Port:%dmalloc fails. %dd/m/i/mq_medial_taskstart mqtt-media client fails %dd/m/o/mqtt-media send topic:%smqc media is offlinemqtt-media publish msg. topic:%sdt_body->id:%ddt_body->posix:%ddt_body->step:%ddt_body->offset:%ddt_body->len:%dgw_cntl is NULLpack data fails. %dmqc_media_pub_async err:%dmqc_media_init__mqc_app_recvnull authentication functionnull cipher%s: allocating cipher with key length %d %s: initializing null cipher %s: (update) running srtp_sha1_core() %s: (update) not running srtp_sha1_core() %s: (final) running srtp_sha1_core() %s: (final) running srtp_sha1_core() again __update_enc_key__user_data_backupsimplekv_initsimplekv_factorysimplekv_deinit__create_data_hd__write_kv_raw__user_data_restoresimplekv_write__backup_timer_cb__check_hd_valid__read_kv_raw__write_kv_with_encode/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_base/kv_storge/file/simplekv.ccurr:%u last:%u <= delay. start backup timercurr:%u last:%u >= delay.start backup && stop backup timerwb+open back file fails %sfwrite failed [%d]backup normal file to bak successbackup timer called. backup file -->>backup timer called. backup file <<--rb+write failed[%d]restore bak to normal file successfile open failed [%s]write data fail, ret = %d, size = %u update crc %uwrite head fails %d len[%u]write head to normal file successdelete key:%s isFuzzy:%dcnt:%d delete bit arr len:%dkey:%s not findfuzzy del find %d %s And set Arr[%d]=0x%Xdelete key find %dDelete key:%d %sDelete key:%s %d successwrite header failsDelete FAILDelete successfread error %d %dmagic check fail 0x%X 0x%Xmax cnt invalid %d mag_rec_size:%dcrc %u %u not equalcrc32 check failshead check successread and check head success__check_hd_valid errorread key:%s isFuzzy:%d skipCnt:%dno key findFuzzy Find %s %s %d and skipIdx:%dfind key:%d %smalloc failed %dread data fails %d %dkey:%s find value.Len:%d__read_kv_raw fail. %daes128_ecb_decode fail. %dnot inited__read_kv_with_decode fail. %dformatformat fail %dformat successbak file path:%scrc32:%dversion:%dwr_count:%ddata_hd_size:%dmagic:0x%Xmag_rec_max:%dmag_rec_cnt:%dindex valid key size start datalen crc32%d %d %s %u 0x%X %d %daes128_ecb_encode fail:%dwrite key:%s And Value Len:%d%d key same BUT size old %d < new %d need find new hd%d key same AND size old %d >= new %d%d valid is false AND size old %d >= new %dNo Available Space %d %d!!new space %d startpos:%u size:%ureuse available space %unew space. seek to end and write zerowrite data fails %dwrite header fails %dfwrite fails %d retore from bak filefind %d available spacewrite kv %s fail!!has initedencrypt_key_len:%d or key is invalid.path:%spath %s invalidtuya_user.dbtuya_user.db_baktuya_enckey.dbread db enc key failsget enc key failedget encrypt_key[%s]both file not exist %sfile name:%sError: normal file exist. bak file not existbak file eixst BUT normal file not existboth file existopen file failssize in: %d and final: %d And mag_rec_max: %d__create_data_hd error:%dcreate data hd successinit NEW normal filerestore from bak file__user_data_restore error:%drestore file successread from normal filefread error %dundefined version %xcurr db is V0 %d %d. Upgrade to V1malloc error %dfread errorSIZEOF(DATA_HD_S) is %u,SIZEOF(UINT_T) is %u,size is %umag_rec:%d start_pos modify, new data_hd_size:%u, old data_hd_size:%u__write_data_hd errorfwrite error.curr db is V1 %d %d. Upgrade to V2curr element cnt is 0. write header.malloc fail.Erase Invalid Area: %d %sfwrite failed ret[%u] len[%u]Upgrade key:%d %sUpgrade key:%d check is vaildUpgrade key:%d check is invaildread kv %s fail!!__upgrade_from_V1_to_V2 error %dcurr db is V2. No need to upgradekey [%s] is invalid, dont crc checkkey[%s] data crc32 check fails %u %u__write_data_hd error:%dsys_add_timer error:%dCreateMutexAndInit error:%dinit from normal file success. check db data crc failed need restore bak_db__rd_hd_and_check error:%dread from normal file successremove %s fail %d__check_hd_crc32__upgrade_from_V1_to_V2__update_hd_crc32__read_kv_with_decode__check_data_crc32simplekv_readsimplekv_delete__delete_kv__read_and_check_hdsimplekv_fuzz_read__rd_hd_and_check__keyfile_data_restoresimplekv_fuzz_deletesimplekv_format__write_data_hdsimplekv_show_status Zgg} j%s: bit count: %d %s: poker test: %f %s: >25 runs: %d %s: >25 gaps: %d %s: >25 runs (2): %d %s: >25 gaps (2): %d %s: runs test %s: runs[]: %d %s: gaps[]: %d stat test__tlk_bc_data_check__tlk_bc_data_parse/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_iot_sdk/wifi_cfg_serv/tlink_bc.cdata crc is success, crc_cnt:%ddata crc is failed %02X %02Xtotal_len: %02X crc_da:%02x %02x %02x %02x %02x %02xtlk_bc->crc:%02xtlk_bc->crc error: %02x %02x %02xmgk data:%04x %04x %04x %04xt_len check ok.Need Seq:%d Flag:%xsort_rev_data: 0x%04x 0x%04x 0x%04x 0x%04x 0x%04x 0x%04x from:%d index:%d crc ok. finish_flag:0x%x recv_da_flag:0x%x ALL Rev FinishParse Passwd Len:%dParse Passwd :%sParse Token Len:%dParse Token:%sParse SSID Len:%dParse SSID:%s__mimo_tlk_bc_hd_parse__tlk_bc_hd_parse__tlk_bc_crc_parse__tlk_bc_mgk_parseUnknown tuya p2p error %dInvalid STUN message (TUYA_P2P_EINSTUNMSG)Invalid STUN message length (TUYA_P2P_EINSTUNMSGLEN)Invalid or unexpected STUN message type (TUYA_P2P_EINSTUNMSGTYPE)STUN transaction has timed out (TUYA_P2P_ESTUNTIMEDOUT)Too many STUN attributes (TUYA_P2P_ESTUNTOOMANYATTR)Invalid STUN attribute length (TUYA_P2P_ESTUNINATTRLEN)Found duplicate STUN attribute (TUYA_P2P_ESTUNDUPATTR)STUN FINGERPRINT verification failed (TUYA_P2P_ESTUNFINGERPRINT)Invalid STUN attribute after MESSAGE-INTEGRITY (TUYA_P2P_ESTUNMSGINTPOS)Invalid STUN attribute after FINGERPRINT (TUYA_P2P_ESTUNFINGERPOS)STUN (XOR-)MAPPED-ADDRESS attribute not found (TUYA_P2P_ESTUNNOMAPPEDADDR)STUN IPv6 attribute not supported (TUYA_P2P_ESTUNIPV6NOTSUPP)Invalid address family value in STUN message (TUYA_P2P_EINVAF)Invalid STUN server or server not configured (TUYA_P2P_ESTUNINSERVER)STUN object has been destoyed (TUYA_P2P_ESTUNDESTROYED)ICE session not available (TUYA_P2P_ENOICE)ICE check is in progress (TUYA_P2P_EICEINPROGRESS)ICE connectivity check has failed (TUYA_P2P_EICEFAILED)Default destination does not match any ICE candidates (TUYA_P2P_EICEMISMATCH)Invalid ICE component ID (TUYA_P2P_EICEINCOMPID)Invalid ICE candidate ID (TUYA_P2P_EICEINCANDID)Source address mismatch (TUYA_P2P_EICEINSRCADDR)Missing ICE SDP attribute (TUYA_P2P_EICEMISSINGSDP)Invalid SDP candidate attribute (TUYA_P2P_EICEINCANDSDP)No host candidate associated with srflx (TUYA_P2P_EICENOHOSTCAND)Controlled timed-out waiting for Controlling to send nominated check (TUYA_P2P_EICENOMTIMEOUT)Invalid or unsupported TURN transport (TUYA_P2P_ETURNINTP)src/tuya_stun_auth.cno msg integrity no username STUN error code attribute not present in error response Ҋ%wЋU#xTpPum[W/a?p^<@. %r|8J> 5^fm+N5+*CJ_+~(Ҧ O<AES-256 integer counter modeAES-128 integer counter mode%s: setting iv: %s %s: set_counter: %s %s: key: %s %s: offset: %s %s: block index: %d %s: counter: %s %s: ciphertext: %s aes icmc|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-TQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% (>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQAeS~'^:k;EXK0U vmvL%O*5D&bZI޺g%E]/uLFk_mzRYڕ-t!Xi)ID‰juyxX>kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<?456789:;<=@  !"#$%&'()*+,-./0123 %)+/5;=CGIOSYaegkmq %379=KQ[]agou{  #-39;AKQWY_eikw)+57;=GUY[_mqswwb%p: %svalue of '%s' (%d bits) is: 00%s() returned %d (-0x%04x) dumping '%s' (%u bytes) %04x: %s(X)%s(Y)#%d: invalid PK context crt->should not happen secp521r1brainpoolP512r1secp384r1brainpoolP384r1secp256r1secp256k1brainpoolP256r1secp224r1secp224k1secp192r1secp192k1CIPHER - The selected feature is not availableCIPHER - Bad input parametersCIPHER - Failed to allocate memoryCIPHER - Input data contains invalid padding and is rejectedCIPHER - Decryption of block requires a full blockCIPHER - Authentication failed (for AEAD modes)CIPHER - The context is invalid. For example, because it was freedCIPHER - Cipher hardware accelerator failedDHM - Bad input parametersDHM - Reading of the DHM parameters failedDHM - Making of the DHM parameters failedDHM - Reading of the public values failedDHM - Making of the public value failedDHM - Calculation of the DHM secret failedDHM - The ASN.1 data is not formatted correctlyDHM - Allocation of memory failedDHM - Read or write of file failedDHM - DHM hardware accelerator failedDHM - Setting the modulus and generator failedECP - Bad input parameters to functionECP - The buffer is too small to write toECP - The requested feature is not available, for example, the requested curve is not supportedECP - The signature is not validECP - Memory allocation failedECP - Generation of random value, such as ephemeral key, failedECP - Invalid private or public keyECP - The buffer contains a valid signature followed by more dataECP - The ECP hardware accelerator failedMD - The selected feature is not availableMD - Bad input parameters to functionMD - Failed to allocate memoryMD - Opening or reading of file failedMD - MD hardware accelerator failedPEM - No PEM header or footer foundPEM - PEM string is not as expectedPEM - Failed to allocate memoryPEM - RSA IV is not in hex-formatPEM - Unsupported key encryption algorithmPEM - Private key password can't be emptyPEM - Given private key password does not allow for correct decryptionPEM - Unavailable feature, e.g. hashing/encryption combinationPEM - Bad input parameters to functionPK - Memory allocation failedPK - Type mismatch, eg attempt to encrypt with an ECDSA keyPK - Bad input parameters to functionPK - Read/write of file failedPK - Unsupported key versionPK - Invalid key tag or valuePK - Key algorithm is unsupported (only RSA and EC are supported)PK - Private key password can't be emptyPK - Given private key password does not allow for correct decryptionPK - The pubkey tag or value is invalid (only RSA and EC are supported)PK - The algorithm tag or value is invalidPK - Elliptic curve is unsupported (only NIST curves are supported)PK - Unavailable feature, e.g. RSA disabled for RSA keyPK - The buffer contains a valid signature followed by more dataPK - PK hardware accelerator failedPKCS12 - Bad input parameters to functionPKCS12 - Feature not available, e.g. unsupported encryption schemePKCS12 - PBE ASN.1 data not as expectedPKCS12 - Given private key password does not allow for correct decryptionPKCS5 - Bad input parameters to functionPKCS5 - Unexpected ASN.1 dataPKCS5 - Requested encryption or digest alg not availablePKCS5 - Given private key password does not allow for correct decryptionRSA - Bad input parameters to functionRSA - Input data contains invalid padding and is rejectedRSA - Something failed during generation of a keyRSA - Key failed to pass the validity check of the libraryRSA - The public key operation failedRSA - The private key operation failedRSA - The PKCS#1 verification failedRSA - The output buffer for decryption is not large enoughRSA - The random generator failed to generate non-zerosRSA - The implementation does not offer the requested operation, for example, because of security violations or lack of functionalityRSA - RSA hardware accelerator failedSSL - The requested feature is not availableSSL - Bad input parameters to functionSSL - Verification of the message MAC failedSSL - An invalid SSL record was receivedSSL - The connection indicated an EOFSSL - An unknown cipher was receivedSSL - The server has no ciphersuites in common with the clientSSL - No RNG was provided to the SSL moduleSSL - No client certification received from the client, but required by the authentication modeSSL - Our own certificate(s) is/are too large to send in an SSL messageSSL - The own certificate is not set, but needed by the serverSSL - The own private key or pre-shared key is not set, but neededSSL - No CA Chain is set, but required to operateSSL - An unexpected message was received from our peerSSL - A fatal alert message was received from our peerSSL - Verification of our peer failedSSL - The peer notified us that the connection is going to be closedSSL - Processing of the ClientHello handshake message failedSSL - Processing of the ServerHello handshake message failedSSL - Processing of the Certificate handshake message failedSSL - Processing of the CertificateRequest handshake message failedSSL - Processing of the ServerKeyExchange handshake message failedSSL - Processing of the ServerHelloDone handshake message failedSSL - Processing of the ClientKeyExchange handshake message failedSSL - Processing of the ClientKeyExchange handshake message failed in DHM / ECDH Read PublicSSL - Processing of the ClientKeyExchange handshake message failed in DHM / ECDH Calculate SecretSSL - Processing of the CertificateVerify handshake message failedSSL - Processing of the ChangeCipherSpec handshake message failedSSL - Processing of the Finished handshake message failedSSL - Memory allocation failedSSL - Hardware acceleration function returned with errorSSL - Hardware acceleration function skipped / left alone dataSSL - Processing of the compression / decompression failedSSL - Handshake protocol not within min/max boundariesSSL - Processing of the NewSessionTicket handshake message failedSSL - Session ticket has expiredSSL - Public key type mismatch (eg, asked for RSA key exchange and presented EC key)SSL - Unknown identity received (eg, PSK identity)SSL - Internal error (eg, unexpected failure in lower-level module)SSL - A counter would wrap (eg, too many messages exchanged)SSL - Unexpected message at ServerHello in renegotiationSSL - DTLS client must retry for hello verificationSSL - A buffer is too small to receive or write a messageSSL - None of the common ciphersuites is usable (eg, no suitable certificate, see debug messages)SSL - No data of requested type currently available on underlying transportSSL - Connection requires a write callSSL - The operation timed outSSL - The client initiated a reconnect from the same portSSL - Record header looks valid but is not expectedSSL - The alert message received indicates a non-fatal errorSSL - Couldn't set the hash for verifying CertificateVerifySSL - Internal-only message signaling that further message-processing should be doneX509 - Unavailable feature, e.g. RSA hashing/encryption combinationX509 - Requested OID is unknownX509 - The CRT/CRL/CSR format is invalid, e.g. different type expectedX509 - The CRT/CRL/CSR version element is invalidX509 - The serial tag or value is invalidX509 - The algorithm tag or value is invalidX509 - The name tag or value is invalidX509 - The date tag or value is invalidX509 - The signature tag or value invalidX509 - The extension tag or value is invalidX509 - CRT/CRL/CSR has an unsupported version numberX509 - Signature algorithm (oid) is unsupportedX509 - Signature algorithms do not match. (see \c ::mbedtls_x509_crt sig_oid)X509 - Certificate verification failed, e.g. CRL, CA or signature check failedX509 - Format not recognized as DER or PEMX509 - Input invalidX509 - Allocation of memory failedX509 - Read/write of file failedX509 - Destination buffer is too smallX509 - A fatal error occured, eg the chain is too long or the vrfy callback failedUNKNOWN ERROR CODE (%04X)AES - Invalid key lengthAES - Invalid data input lengthAES - Feature not available. For example, an unsupported AES key sizeAES - AES hardware accelerator failedARC4 - ARC4 hardware accelerator failedASN1 - Out of data when parsing an ASN1 data structureASN1 - ASN1 tag was of an unexpected valueASN1 - Error when trying to determine the length or invalid lengthASN1 - Actual length differs from expected lengthASN1 - Data is invalid. (not used)ASN1 - Memory allocation failedASN1 - Buffer too small when writing ASN.1 data structureBASE64 - Output buffer too smallBASE64 - Invalid character in inputBIGNUM - An error occurred while reading from or writing to a fileBIGNUM - Bad input parameters to functionBIGNUM - There is an invalid character in the digit stringBIGNUM - The buffer is too small to write toBIGNUM - The input arguments are negative or result in illegal outputBIGNUM - The input argument for division is zero, which is not allowedBIGNUM - The input arguments are not acceptableBIGNUM - Memory allocation failedCTR_DRBG - The entropy source failedCTR_DRBG - The requested random buffer length is too bigCTR_DRBG - The input (entropy + additional data) is too largeCTR_DRBG - Read or write error in fileENTROPY - Critical entropy source failureENTROPY - No more sources can be addedENTROPY - No sources have been added to pollENTROPY - No strong sources have been added to pollENTROPY - Read/write error in fileMD5 - MD5 hardware accelerator failedNET - Failed to open a socketNET - The connection to the given server / port failedNET - Binding of the socket failedNET - Could not listen on the socketNET - Could not accept the incoming connectionNET - Reading information from the socket failedNET - Sending information through the socket failedNET - Connection was reset by peerNET - Failed to get an IP address for the given hostnameNET - Buffer is too small to hold the dataNET - The context is invalid, eg because it was free()edNET - Polling the net context failedNET - Input invalidOID - OID is not foundOID - output buffer is too smallSHA1 - SHA-1 hardware accelerator failedSHA256 - SHA-256 hardware accelerator failedTHREADING - The selected feature is not availableTHREADING - Bad input parameters to functionTHREADING - Locking / unlocking / free failed with error codeMD5invalid PK*H=*H  *H  -----BEGIN -----BEGIN RSA PRIVATE KEY----------END RSA PRIVATE KEY----------BEGIN EC PRIVATE KEY----------END EC PRIVATE KEY----------BEGIN PRIVATE KEY----------END PRIVATE KEY----------BEGIN ENCRYPTED PRIVATE KEY----------END ENCRYPTED PRIVATE KEY----------BEGIN RSA PUBLIC KEY----------END RSA PUBLIC KEY----------BEGIN PUBLIC KEY----------END PUBLIC KEY-----rsa.Nrsa.Eeckey.QRSA-altECDSAEC_DHECRSA-----BEGIN PUBLIC KEY----- -----END PUBLIC KEY----- -----END RSA PRIVATE KEY----- -----BEGIN RSA PRIVATE KEY----- -----END EC PRIVATE KEY----- -----BEGIN EC PRIVATE KEY----- /BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_middleware/tls/mbedtls/ssl_srv.c=> parse client hellombedtls_ssl_fetch_inputrecord headerclient hello v3, message type: %dbad client hello messageclient hello v3, message len.: %dclient hello v3, protocol version: [%d:%d]record contentsclient hello v3, handshake type: %dclient hello v3, handshake len.: %dClientHello fragmentation not supportedclient hello, versionclient only supports ssl smaller than minimum [%d:%d] < [%d:%d]client hello, random bytesclient hello, session idclient hello, cookiecookie verification failedcookie verification passedcookie verification skippedclient hello, ciphersuitelistclient hello, compressionclient hello extensionsfound ServerName extensionparse ServerName extensionssl_sni_wrapperfound renegotiation extensionnon-zero length renegotiation infofound signature_algorithms extensionclient hello v3, signature_algorithm ext unknown sig alg encoding %dclient hello v3, signature_algorithm ext: unknown hash alg encoding %dclient hello v3, signature_algorithm ext: match sig %d and hash %dclient hello v3, signature_algorithm ext: hash alg %d not supportedfound supported elliptic curves extensionfound supported point formats extensionpoint format selected: %dfound max fragment length extensionfound encrypt then mac extensionfound extended master secret extensionfound use_srtp extensionfound srtp profile: %sselected srtp profile: %susing mkiunknown extension found: %d (ignoring)received FALLBACK_SCSVinapropriate fallbackreceived TLS_EMPTY_RENEGOTIATION_INFO legacy renegotiation, breaking off handshakeshould never happentrying ciphersuite: %sciphersuite mismatch: versionciphersuite mismatch: rc4ciphersuite mismatch: no common elliptic curveciphersuite mismatch: no suitable hash algorithm for signature algorithm %dciphersuite requires certificateserver has no certificatecandidate certificate chain, certificatecertificate mismatch: key typecertificate mismatch: (extended) key usage extensioncertificate not preferred: sha-2 with pre-TLS 1.2 clientselected certificate chain, certificategot ciphersuites in common, but none of them usablegot no ciphersuites in commonclient hello v3, signature_algorithm ext: %dno hash algorithm for signature algorithm %d - should not happen<= parse client hellocertificate mismatch: elliptic curveciphersuite mismatch: no suitable certificateselected ciphersuite: %sserver state: %d=> write server helloclient hello was not authenticated<= write server hello=> write hello verify requestinconsistent cookie callbacksf_cookie_writecookie sentmbedtls_ssl_write_record<= write hello verify requestno RNG providedserver hello, chosen version: [%d:%d]server hello, random bytessession successfully restored from cachembedtls_ssl_derive_keysserver hello, session id len.: %dserver hello, session id%s session has been resumedserver hello, chosen ciphersuite: %sserver hello, compress alg.: 0x%02Xserver hello, secure renegotiation extensionserver hello, max_fragment_length extensionserver hello, adding encrypt then mac extensionserver hello, adding extended master secret extensionserver hello, supported_point_formats extensionserver hello, adding use_srtp extensionserver hello, total extension length: %d=> write server key exchangeserver key not ECDH capablembedtls_ecdh_get_paramsno matching curve for ECDHEECDHE curve: %smbedtls_ecp_group_loadmbedtls_ecdh_make_paramsECDH: Q parameters hashgot no private keymbedtls_pk_signmy signature<= write server key exchange=> write certificate requestshould not happen<= skip write certificate requestskipping CAs: buffer too shortrequested DN<= write certificate request=> write server hello done<= write server hello done=> parse client key exchangembedtls_ssl_read_recordbad client key exchange messagembedtls_ecdh_read_publicECDH: Qp mbedtls_ecdh_calc_secretECDH: z <= parse client key exchange=> parse certificate verify<= skip parse certificate verifymbedtls_ssl_read_record_layermbedtls_ssl_handle_message_typebad certificate verify messagepeer not adhering to requested sig_alg for verify messagesig_alg doesn't match cert keymbedtls_pk_verify<= parse certificate verifyhandshake: doneinvalid state %d<= skip write server key exchangepick hash algorithm %d for signingڢ!h4b)Ngt ;"QJy4:C0+ m_7O5mmQE䅵vb^~LB7k \8kZ$|KI(fQ[=|cH6UӚi?$_e]#ܣbV R)pmg 5NJtl!|2^F.6;w,']oLR+X9I|j&rZh/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_middleware/tls/mbedtls/ssl_tls.cset_timer to %d msskip swap epochsswap epochsclient finishedserver finished=> calc finished tls sha256finished sha2 statecalc finished result<= calc finished=> calc verify sha256calculated verify result<= calc verify=> calc finished tlsfinished md5 statefinished sha1 state=> calc verify tlstimer expired=> derive keyscipher info for %d not foundmbedtls_md info for %d not foundpremaster secretusing extended master secretsession hashextended master secretprfmaster secretno premaster (session resumed)EXTRACTOR-dtls_srtpdtls srtp prfkey expansionciphersuite = %srandom byteskey blockmbedtls_md_setupkeylen: %d, minlen: %d, ivlen: %d, maclen: %dmbedtls_cipher_setupmbedtls_cipher_setkeymbedtls_cipher_set_padding_mode<= derive keys=> flush outputBad usage of mbedtls_ssl_set_bio() or mbedtls_ssl_set_bio()<= flush outputmessage length: %d, out_left: %dssl->f_sendf_send returned %d bytes but only %lu bytes were sentoutgoing message counter would wrapupdate timeout value to %d millisecs in buf modify to %ucurr in buf len > new buf %u > %umalloc fail %u out buf modify to %ucurr out buf len > new buf %u > %ussl_check_pending: record held back for processingssl_check_pending: more records within current datagramssl_check_pending: more handshake messages within current recordssl_check_pending: application data record is being processedssl_check_pending: nothing pendingssl->session != NULLssl->session_negotiate != NULLDTLSv1.0DTLSv1.2unknown (DTLS)SSLv3.0TLSv1.0TLSv1.1TLSv1.2=> handshake<= handshake=> handshake wrapup: final free<= handshake wrapup: final free=> handshake wrapupcache did not store sessionskip freeing handshake and transform<= handshake wrapup=> free<= freealloc() of ssl sub-contexts failedalloc(%d bytes) failed++=> write recordDTLS handshake message too large: size %u, maximum %ualloc %d bytes failed=> encrypt bufbefore encrypt: output payloadRecord content %u too large, maximum %dcomputed macbefore encrypt: msglen = %d, including %d bytes of paddingmbedtls_cipher_cryptbefore encrypt: msglen = %d, including %d bytes of IV and %d bytes of paddingusing encrypt then macMAC'd meta-data<= encrypt bufoutput record: msgtype = %d, version = [%d:%d], msglen = %doutput record sent to networkmbedtls_ssl_flush_output<= write recordssl_flight_appendssl_encrypt_buf=> mbedtls_ssl_resendinitialise resendingresent handshake message header<= mbedtls_ssl_resend=> fetch inputrequesting more data than fitsYou must use mbedtls_ssl_set_timer_cb() for DTLSnext record in same datagram, offset: %din_left: %d, nb_want: %d<= fetch inputtimer has expiredf_recv_timeout: %u msssl->f_recv(_timeout)mbedtls_ssl_resendf_recv returned %d bytes but only %lu were requestedfinal in_left: %d, nb_want: %dhandshake timeouthandshake message too short: %dreceived message from last flight, message_seq = %d, start_of_flight = %ddropping out-of-sequence message: message_seq = %d, expected = %dfound fragmented DTLS handshake messagenot supported outside handshake (for now)initialize reassembly, total length = %dhandshake message too largealloc failed (%d bytes)fragment header mismatchinvalid fragment offset/len: %d + %d > %dinvalid fragment length: %d + 12 > %dadding fragment, offset = %d, length = %dlast fragment not alone in its recordreassembled message too large for bufferreassembled handshake messageTLS handshake fragmentation not supportedmessage is not complete yethandshake message completedssl_reassemble_dtls_handshakegot an alert message, type: [%d:%d]is a fatal alert message (msg %d)is a close notify messageis a SSLv3 no renegotiation alert=> send alert messagesend alert level=%u message=%u<= send alert message=> write close notifymbedtls_ssl_send_alert_message<= write close notify=> write certificate<= skip write certificategot no certificate to sendown certificatecertificate too large, %d > %d<= write certificate=> write change cipher spec<= write change cipher spec=> write finishedswitching to new transform spec for outbound data<= write finishedDTLS epoch would wrap=> writembedtls_ssl_handshakefragment larger than the (negotiated) maximum fragment length: %d > %d<= writeremaining content in recordinput record headerinput record: msgtype = %d, version = [%d:%d], msglen = %dunknown record typemajor version mismatchminor version mismatchbad message lengthrecord from another epoch: expected %d, received %ddropping unexpected ChangeCipherSpecdropping unexpected ApplicationDatadiscarding unexpected record (header)discarding invalid record (header)more than one record within datagraminput record from network=> decrypt bufin_msglen (%d) < minlen (%d)raw buffer after decryptionmsglen (%d) < max( ivlen(%d), maclen (%d) + 1 ) ( + expl IV )message macexpected macmessage mac does not matchmsglen (%d) %% ivlen (%d) != 0received four consecutive empty messages, possible DoS attackincoming message counter would wrap<= decrypt bufinput payload after decryptdiscarding invalid record (mac)ssl_decrypt_buf=> read record<= reuse previously read message<= read record=> parse certificate<= skip parse certificateTLSv1 client has no certificatebad certificate message mbedtls_x509_crt_parse_derpeer certificatex509_verify_certbad certificate (EC key curve)bad certificate (usage extensions)got no CA chain! Certificate verification flags %xCertificate verification flags clear<= parse certificate=> parse change cipher specbad change cipher spec messageswitching to new transform spec for inbound data<= parse change cipher spec=> parse finishedbad finished message<= parse finished=> readreceived handshake messagehandshake received (not HelloRequest)handshake received (not ClientHello)refusing renegotiation, sending alertignoring non-fatal non-closure alertbad application data message<= readmbedtls_md5_starts_retmbedtls_md5_update_retmbedtls_md5_finish_retmbedtls_sha1_starts_retmbedtls_sha1_update_retmbedtls_sha1_finish_retmbedtls_md_startsmbedtls_md_updatembedtls_md_finishMBEDTLS_SRTP_AES128_CM_HMAC_SHA1_80MBEDTLS_SRTP_AES128_CM_HMAC_SHA1_32MBEDTLS_SRTP_NULL_HMAC_SHA1_80MBEDTLS_SRTP_NULL_HMAC_SHA1_32@U%` , Certificate is uninitialised! %scert. version : %d %sserial number : %sissuer name : %ssubject name : %sissued on : %04d-%02d-%02d %02d:%02d:%02d %sexpires on : %04d-%02d-%02d %02d:%02d:%02d %ssigned using : %s%-18s: %d bits %sbasic constraints : CA=%s, max_pathlen=%d %ssubject alt name : %scert. type : %sSSL Client%sSSL Server%sEmail%sObject Signing%sReserved%sSSL CA%sEmail CA%sObject Signing CA %skey usage : %sDigital Signature%sNon Repudiation%sKey Encipherment%sData Encipherment%sKey Agreement%sKey Cert Sign%sCRL Sign%sEncipher Only%sDecipher Only %sext key usage : The certificate validity has expired%s%s %sUnknown reason (this should not happen) U-----BEGIN CERTIFICATE----------END CERTIFICATE-----The certificate has been revoked (is on a CRL)The certificate Common Name (CN) does not match with the expected CNThe certificate is not correctly signed by the trusted CAThe CRL is not correctly signed by the trusted CAThe CRL is expiredCertificate was missingCertificate verification was skippedOther reason (can be used by verify callback)The certificate validity starts in the futureThe CRL is from the futureUsage does not match the keyUsage extensionUsage does not match the extendedKeyUsage extensionUsage does not match the nsCertType extensionThe certificate is signed with an unacceptable hash.The certificate is signed with an unacceptable PK alg (eg RSA vs ECDSA).The certificate is signed with an unacceptable key (eg bad curve, RSA too short).The CRL is signed with an unacceptable hash.The CRL is signed with an unacceptable PK alg (eg RSA vs ECDSA).The CRL is signed with an unacceptable key (eg bad curve, RSA too short).*H  + %s=??=%02X%s.... (%s, MGF1-%s, 0x%02X)%s key sizeUUU#U`HB-----BEGIN CERTIFICATE----- -----END CERTIFICATE----- ARC4-128AES-256-CBCAES-192-CBCAES-128-CBCAES-256-ECBAES-192-ECBAES-128-ECB-----BEGIN DH PARAMETERS----------END DH PARAMETERS-----1(Ҵk6ޙi/T\T-EwaF5~T˜E93-}w@cGB,kQ7h@^1kW3+|J玛BOGTH]eģ&w:H!\ր24"VJ2k 4~DdGZuC"L#c701DB4214DEF9DEA2F79CD65812631A5CF5D3ED98AA8335DC163BB124B65129C96FDE933D8D723A70AADC873D6D54A7BB0D*ȅ*.9VZPAn-k>/1" "5h^j@GPm|_}{hPx; b;ٵp텓jL.2!Zd.ؽ䮁U#C9 'ؿ׷DPV2A :xT/+Ѯc'K[^H_JIܲ[{$ "xϩ2cV]8}S1Gq)Ӭ#ڱVT q/AP~o](m8 C |0AA6Ќ^ҿ;HܮLP:ە9|b>.}/|DT9&("Ǩ/[Y(- ΕbU~fys)jzH X-7Mc/^و@4cA(Vm//f1~~BjH3ި'(Yw^K=Mk`(!?9dB#f>=*\\E)> vr8^T:l)U]U8*TAYb;nt DZ7"ʇ\e~upgi(0ߙM3[EamUKYʂB4~b2ΚSD:#'޹/HK,W~˹ҋ_|Cz~α` 1|()ܒ]o,&J6H:XV`(Ƃ-/(怣*ͮBhƛM}q3pʜcɳ03?۸ݪtjFi&7F޸I0$r瀜!d#c (^P@g>ʔwM+Ț. :%Z]-cA4=}lѥ4}&WOPfџv@rp<5a?P@&^r,f>'hDWID},_\;xj)9ٵ0DKJl\&UzA0uW0,u Z}k\)|׻ٵ0DKJl\&ee2;k:ϧ%lnVT q/AP~o](m8K`'><;S̰evU:5Z&("Ǩ:PJe'O  r< =Ƃ{VHaz9q f>WwSnH ( &#;nr f>WʔwM+Ț. :%Z]-cA4=˔L#Eq2;`10xQ%cʹ?PkE4,=s5;R{~Q9V 񎑉[rڢ@!a>Qi]ӱGaA&LA\>Up3pʜcɳ03?۸ݪvqʄaS<&ABw!FF()OdX) bRϕ\ umGⲇF64& O~Gk?:Ehd d8oGɵ;Х Hk/QHyws$kcx++!+"+#++ + *H *H *H=+*H *H *H  %d.%dpbeWithSHAAnd3-KeyTripleDES-CBCPBE with SHA1 and 3-Key 3DES*H  pbeWithSHAAnd2-KeyTripleDES-CBCPBE with SHA1 and 2-Key 3DEShmacSHA1HMAC-SHA-1*H hmacSHA224HMAC-SHA-224*H  hmacSHA256HMAC-SHA-256id-md5+id-sha1SHA-1`Heid-sha224SHA-224`Heid-sha256SHA-256desCBC*H des-ede3-cbcDES-EDE3-CBC*H=+$brainpool256r1+$ brainpool384r1+$ brainpool512r1rsaEncryption*H=id-ecPublicKeyGeneric EC key+ id-ecDHEC key for ECDHmd5WithRSAEncryptionRSA with MD5*H sha-1WithRSAEncryptionRSA with SHA1*H sha224WithRSAEncryptionRSA with SHA-224*H  sha256WithRSAEncryptionRSA with SHA-256+*H=ecdsa-with-SHA1ECDSA with SHA1*H=ecdsa-with-SHA224ECDSA with SHA224*H=ecdsa-with-SHA256ECDSA with SHA256*H  RSASSA-PSSid-kp-serverAuthTLS Web Server Authenticationid-kp-clientAuthTLS Web Client Authentication+id-kp-codeSigningCode Signing+id-kp-emailProtectionE-mail Protection+id-kp-timeStampingTime Stamping+ id-kp-OCSPSigningOCSP Signingid-ce-basicConstraintsBasic Constraintsid-ce-keyUsageKey UsageU%id-ce-extKeyUsageExtended Key UsageUid-ce-subjectAltNameSubject Alt Nameid-netscape-certtypeNetscape Certificate Typeid-at-commonNameCommon NameUid-at-countryNameCountryCUid-at-localityLocalityUid-at-stateStateU id-at-organizationNameOrganizationOU id-at-organizationalUnitNameOrg UnitOU*H  emailAddressE-mail addressUid-at-serialNumberSerial numberserialNumberUid-at-postalAddressPostal addresspostalAddressUid-at-postalCodePostal codepostalCodeUid-at-surNameSurnameSNU*id-at-givenNameGiven nameGNU+id-at-initialsInitialsinitialsU,id-at-generationQualifierGeneration qualifiergenerationQualifierU id-at-titleTitletitleU.id-at-dnQualifierDistinguished Name qualifierdnQualifierUAid-at-pseudonymPseudonympseudonym &,did-domainComponentDomain componentDCU-id-at-uniqueIdentifierUnique IdentifieruniqueIdentifierProc-Type: 4,ENCRYPTEDDEK-Info: AES-DEK-Info: AES-128-CBC,DEK-Info: AES-192-CBC,DEK-Info: AES-256-CBC,*H   %)+/5;=CGIOSYaegkmqTLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHATLS-ECDHE-ECDSA-WITH-AES-256-CBC-SHATLS-ECDHE-ECDSA-WITH-AES-128-CBC-SHA256TLS-ECDHE-ECDSA-WITH-RC4-128-SHATLS-ECDHE-RSA-WITH-AES-128-CBC-SHATLS-ECDHE-RSA-WITH-AES-256-CBC-SHATLS-ECDHE-RSA-WITH-AES-128-CBC-SHA256TLS-ECDHE-RSA-WITH-RC4-128-SHATLS-ECDH-RSA-WITH-AES-128-CBC-SHATLS-ECDH-RSA-WITH-AES-256-CBC-SHATLS-ECDH-RSA-WITH-AES-128-CBC-SHA256TLS-ECDH-RSA-WITH-RC4-128-SHATLS-ECDH-ECDSA-WITH-AES-128-CBC-SHATLS-ECDH-ECDSA-WITH-AES-256-CBC-SHATLS-ECDH-ECDSA-WITH-AES-128-CBC-SHA256TLS-ECDH-ECDSA-WITH-RC4-128-SHA,0$(k 9}sw+/#'g 3|rvE86754=52*.&{yu</1)-%zAxt 3  ;:9-; .,/var/lib/jenkins/workspace/Release_IPC_SDK/src/tuya_middleware/tls/mbedtls/ssl_cli.c=> write client helloconfigured max major version is invalid, consider using mbedtls_ssl_config_defaults()client hello, max version: [%d:%d]client hello, session id len.: %dno verify cookie to sendclient hello, add ciphersuite: %04xclient hello, got %d ciphersuites (excluding SCSVs)adding EMPTY_RENEGOTIATION_INFO_SCSVadding FALLBACK_SCSVclient hello, compress len.: %dclient hello, compress alg.: %dclient hello, adding server name extension: %sclient hello, adding signature_algorithms extensionclient hello, adding supported_elliptic_curves extensioninvalid curve in ssl configurationclient hello, adding supported_point_formats extensionclient hello, adding max_fragment_length extensionclient hello, adding encrypt_then_mac extensionclient hello, adding extended_master_secret extensionclient hello, adding use_srtp extensionssl_write_use_srtp_ext, add profile: %04xclient hello, ignore illegal DTLS-SRTP protection profile %dsending mkiclient hello, total extension length: %d<= write client hellossl_generate_randomECDH curve: %sECDH: Qpclient state: %d=> parse server hellobad server hello messagereceived hello verify request<= parse server hello=> parse hello verify requestbad server versioncookiecookie length does not match incoming message size<= parse hello verify requestserver hello, versionserver version out of bounds - min: [%d:%d], server: [%d:%d], max: [%d:%d]server hello, current time: %luserver hello, bad compression: %dciphersuite info for %04x not foundserver hello, chosen ciphersuite: %04xserver hello, compress alg.: %dfound max_fragment_length extensionnon-matching max fragment length extensionfound encrypt_then_mac extensionnon-matching encrypt-then-MAC extensionfound extended_master_secret extensionnon-matching extended master secret extensionfound supported_point_formats extensionno point format in commonreceived mki=> parse server key exchangecertificate requiredbad server certificate (ECDH curve)bad server key exchange messageserver key exchange message must not be skippedserver key exchangembedtls_ecdh_read_paramsbad server key exchange message (ECDHE curve)Server used unsupported HashAlgorithm %dserver used unsupported SignatureAlgorithm %dserver used HashAlgorithm %d that was not offeredServer used SignatureAlgorithm %dServer used HashAlgorithm %dsignature<= parse server key exchange=> parse certificate requestbad certificate request messagegot %s certificate requestSupported Signature Algorithm found: %d,%d<= parse certificate request=> parse server hello donebad server hello done message<= parse server hello done=> write client key exchangembedtls_ecdh_make_publicECDH: QECDH: z<= write client key exchange=> write certificate verify<= skip write certificate verifygot no private key for certificate<= write certificate verifyssl_get_ecdh_params_from_cert<= skip parse server key exchange<= skip parse certificate requestcommonNamecountryNameorganizationNamelocalityorganizationalUnitNamestateOrProvinceNamesurNamegivenNamedomainComponentInit %5s module: [%-32s] failed to create thread: %s! FAILOKInit %5s module: ............................[%s] /home/cfg/wifi.infostart START_ETH0 .........sh /home/init.d/START_ETH0/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_base_init.cVERSION: %d.%d.%d PLATFORM_ID: %d APPLICATION_ID: %d FACTORY_ID: %d Build Date:%s Version:%s %s 2020-09-11 15:49:12 CST4.0.0a3-tuya2_merkuryneed more buffer to store version info /tmp/versionwrite file: %s failed startlogecho startup_time--`date '+%Y/%m/%d %T'` >> /home/cfg/sys_timeecho ===time updated--`date '+%Y/%m/%d %T'` >> /home/cfg/sys_timehal io init failed: %d hal notify app failed: %d hardware inited /tmp/ntploga+fopen %s failed: %s *****init_sys_time start****** 2016-1-1-0-0-0 *****init_sys_time end****** device time initialized /home/cfg/TZ/etc/TZcopy TZ file failed: %d device timezone initialized device hardware init done /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_encryption.ccan't access %s: %s ropen %s failed! got line: %s close file %s failed! %s.tmpa+create tmp file %s failed! #%d^##%d$#/mnt/mmc01/ppsEncrypt.txtget encrypt file head error: %d %s%d%s%d%s%dForceUseInfoEncryptTypeillegal encrypt file header! get encrypt info error: %d %s%s%s%s%sencrypt info some para is empty! /mnt/mmc01/ppsEncrypted.txtopen encrypt log file failed! len %d,info %s write encrypt log file failed! wlan0%02hhx:%02hhx:%02hhx:%02hhx:%02hhx:%02hhx%s;; %s;; %s;; %s;; %s;; %s;; %s 00:00:00:00:00:00mtd init failed! mtd read failed! ##2wTmtd erase failed! mtd write failed! encrypt all info read init info failed! sysinfo [%.*s] device type %d device model [%.*s] production time [%.*s] serial number [%.*s] %02hhX:%02hhX:%02hhX:%02hhX:%02hhX:%02hhXeth_mac 1 %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx eth_mac 2 %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx p2p factory type %d p2p id [%.*s] license switch %d license type %d license [%.*s] secret [%.*s] language type %u lens_info %s device class %u OEM Code %d encrypt version %u Identity card %.*s encrypt write failed! encrypt write ok! lensinfo [%.*s] get sn error! sn is empty! get license error! license is empty! get secret error! secret is empty! get p2pid error! p2pid is empty! get ethmac error! ethmac is empty! get identity error! identity is empty! entype %d, sn [%s], license [%s], secret [%s], p2pid [%s], ethmac [%s], identity [%s] sn length not valid! p2pid(20) length is odd, [%s]! License(20) length not valid, [%s]! secret(32) length not valid, [%s]! open encryption partition failed, ret is %d open encryption partition success get encrypt file from sd card failed: %d 056565099Open parririon 2 write permissions failed, ret is %d get encrypt file head info failed force encrypt %d, use txt encrypt info %d, encrypt type %d get encrytion info para failed write encrypt_info to flash failed! encrypt sucess! write encrypt operation log failed! delete assigned failed open infread failed! /home/sound/login.wav/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_board.cinput param is NULL create json failed p2p_idp2p_type/home/cfg/tutk_meari.cfgwrite file failed! read file failed! set p2p uuid NULL p2p type %d p2p id %s p2p legacy %s p2p type save config /etc/device_tp.confftell %s failed malloc tp file mem failed read %s failed parse json root failed 0x%xget tp json from root failed tp/tmp/tp.configwrite file[%s] failed PPS_HAL_HARDWARE_GetInfo failed, ret=%d wlan0get mac num failed, ret: %d wifi mac: %02hhx:%02hhx:%02hhx:%02hhx:%02hhx:%02hhx %02hhx:%02hhx:%02hhx:%02hhx:%02hhx:%02hhx2020-09-11 15:49:12 CST%4d-%2d-%2d %s %s%04d%02d%02dSmart Home Camera4.0.0ppstrong-%s-%s.%sa3-tuya2_merkurymeari device tuya device 000000000no support factory type: %d failed to create board object! camera init failed: %d board info: name: %s factory: %s device_type: 0X%X model: %s dev_tp: 0x%s hardware_version: %s software_version: %s firmware_version: %s sn: %s p2p_uuid: %s p2p_uuid_legacy: %s identity_card: %s licence_id: %s 056565099SPEED5S_V10_F23SPEED5S_V11_F23/home/cfg/capa.infow+/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_capa.copen /home/cfg/capa.info failed write file failed! ropen file failed read file failed SB3S_A2_V10_F37SB3S_A2_V20_F37SB3S_A2_V11_F37SB3S_A2_V12_F37SB3S_A2_V13_F37SB4S_A2_V10_F37SB4S_A2_V20_F37SB4S_A2_V11_F37SB4S_A2_V12_F37SB4S_A2_V13_F37/sys/devices/platform/usb-host/usb1/1-1/idVendorfopen %s failed fread failed, rlen:%d 007aNetcard idVendor: [%s], 6032 Netcard idVendor: [%s], 8188 {"vtk":%d,"fcr":0,"dcb":%d,"md":1,"ptz":%d,"tmpr":%d,"hmd":%d,"pir":0,"cst":%d,"geo":1,"nst":1,"evs":1,"vst":%d,"led":1,"cse":%d,"dnm":1,"cs2":%d, "bps":%d,"wfs":%d,"svc":%d,"flt":%d,"rng":%d,"pwm":0,"sd":1,"ota":1,"shd":0,"flp":%d,"slp":%d,"vec":%d,"bcd":%d,"ptr":%d,"pdt":%d,"rel":%d,"cct":%d,"ecs":%d,"esd":%d,"hms":%d,"alp":%d,"spp":%d,"ltl":%d,"ovc":%d}{"ver":18,"caps":%s}capa: %s /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_user.cpd is null or max len less than 0 anonymousdon't handler anonymous user info nullptr username or pd null too long username or pd username or pd no content no same user pd null check pd failed write to pd file failed admin056565099PpStRoNg#%&wL1@*tU123zvWeEyE&$ChuTian_91/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_error.carg invalid err buffer too small %s %s with %d Param is NULL a+fopen %s failed fwrite failed, wlen:%d err_str is null err_str length is 0 echo err_time------`date '+%Y/%m/%d %T'` >> /home/cfg/sys_timeerr_reason---- %s ---- buffer is too small /home/cfg/sys_timeFailed to write failed: %d /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_reboot.creboot function disabled reboot ... reboot error. reboot device(reset) error reboot beacause of %s reboot device disable reboot action reboot device(button reset) reboot_reset_press/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_watchdog.cwatchdog disabled ... exit watchdog faild feed watchdog failed exception ocurred: %d /home/cfg/watchdog_soft_reboottype %d, end_time---%02d-%02d-%02dT%02d:%02d:%02d error main media stream delay too much, reboot restful server module timeout, reboot sdcard module timeout, reboot network module timeout, reboot soft module id is invailed cpu usage is too high watchdog config is invailed watch dog is opened watchdogstart watch dog failed! restart after 10s... watchdog service opened to exit watchdog watchdog service exited %d:%d:%d%s%s%02d:%02d:%02d%s%02d:%02d:%02d%s%d:%d%s%02d:%02d:00/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_time.ctimezone information error! tzinfo: %s, tzinfo_formated: %s /etc/TZ%s TZ/home/cfg/TZUTC%d:%02dbuffer too small! param error system time: %04d-%02d-%02d %02d:%02d:%02d set timezone fialed /home/cfg/region%d/%02d/%02d %02d:%02d:%02d /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_gpio.cfailed to read axp228 status, ret: %d! short press=%d, long press=%d button_listener/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_media.cset input volume failed: %d set input volume to %d get vlo failed: %d set output volume failed: %d set output volume to %d get output volume failed: %d audio file name is invalid buf or buf size is invalid: %d frameinfo or info size is invalid: %d write streaming failed: %d audio stream cb failed: %d cb context is null media ioctl failed: %d buffer is null or len is null jpeg capture failed ret = %d! clear send frame ... argument invalid aec not enable close aec failed: %d get day night status failed: %d! get day night mode value failed! no used priority, return 0 always dayalways nightauto modehigest daynight switch mode index: %d, mode: %s recover priority not set before, set dn auto switch mode set daynight switch mode failed: %d priority: %d, daynight mode value: %d used priority: %d, auto set daynight mode %d set daynight switch mode automatic failed: %d set day night mode value failed! autoset day night switch mode to %s complete set mirror ret:%d error! set mirror %d set video type to %d set h264 param failed: %d pps_media_md_getMdPara sadThr:%d, minArea:%d pps_media_md_SetMdPara move detect continue move detect paused not process ev: %d move detected and ptz continue/pause error with: %d pic data null free md pic failed: %d get md pic failed: %d time not sync now md_callback.... get md pic failed md event callback failed: %d md_callback....end set md fast detect failed ret: %d fast move detect mode md set call failed ret: %d register alarm move detect callback pps_event_sd_record_init error rc = %d register common move detect callback md_ptz_stopmd_ptz_movebuffer or frame info is null get aec enable failed: %d get aec enable: %d set aec disable failed: %d style is NULL check audio aec enable failed config_io_call_cb is null io call config failed media init failed: %d aec init failed enter sleeping set day mode failed: %d anyka media start up path is null file %s is not accessible play %s failed %02d:%02d:%02d.%03ld /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_qrcode.cregister qrcode content process callback qrcode data process cb not register Y800length:%d decoded %s symbol "%s" %d ms<-----------------------------------------------------------> qrcode_handlemalloc error pthread create error register qrcode video stream failed: %d qrcode process start qrcode process has started unregister qrcode callback failed: %d qrcode stoped netctrl hostapd startnetctrl hostapd start --ssid=%s --passwd=%s/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_ap.cpps system cmd failed netctrl hostapd stophostapd start failed hostapd stoped wlan0eth0/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_netmng.cnull ssid or psk zero length ssid or psk too long length ssid or psk ssid: %s psk: %s no wifi info need save /home/cfg/wifi.infowrite wifi info to file failed!!! saved wifi info: ssid: %s, psk: %s, key_mgmt: %d /proc/net/routeropen %s failed!!! %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d we get key_mgmt %d exit from config key_managment loop, rc: %d, times: %d invalid parameter.%s didn't exist wifi ssid is invalid wrewrite wifi.info to new: open %s failed rewrite wifi.info to new: write to %s failed got wifi info: ssid: %s, psk: %s, key_mgmt: %d 127169%s IP is 127 or 169 compare ifname failed: %d /home/cfg/device.tokenread content form %s faild:%dgot wifi token %s token null or zero length too long length update token to %s write token %s to %s failed: %d wpa source stop wifi connect stop timeout wpa source start bell or flight device, wlan0 up ifconfig wlan0 upiwconfig wlan0 mode Managedwifi connect timeout get wifi config failed: %d /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_upgrade.cInvalid input param: src = %p, dst = %p ͼӺ˵magic error: %x file count error: %d header length error: %d device class error! %x new upgrade version platform id error firmware: %d, current: %d device is factory mode, not to check firmware debug version, ignore version application_id error, firmware: %d, current: %d current_factory_id error, upgrade failed current_factory_id=[%d]p->factory_id=[%d] can not upgrade low version, failed upgrade.bin: %d.%d.%d this board: %d.%d.%d Unsupported version! set pps hal upgrade ret %d set pps hal upgrade release ret %d mtd_write_percent didn't initialized dsp malloc size: %d upgrade data is NULL is upgrading... upgrade unlock..... upgrade param is invalid parse firmware header failed magic: %x, checksum: %d, len: %d, nums: %d file check sum[%d] is error file header parse failed file offset parse failed check file check_sum failed check file length failed malloc failed: %s get mtd info failed: %s mtd info is not support mtd size: %x, packet len: %x start write [%s] packet to [mtd%d] file len: %d offset: %d mtd open error %d mtd erase failed! mtd write failed! mtd read failed! verify write failed! upgrade process %d%% write [%s] packet failed write [%s] packet success upgrade by file upgrade ctrl failed %d ropen file %s failed: %s read file %s failed: %s upgrade file size: %d upgrade failed: %d url_upgradeinput url is invalid download firmare failed upgrade by buffer failed upgrade finish, wait reboot[%d]... upgrade version: %s url: %s Upgrade file name is too short not have enough info -ppstrongupgrade file name is not standard name ,forbiden upgrade! upgrade file platform not equal dev platform, forbiden upgrade! httpupgrade url is invalid firmware upgrading still processing... firmware upgrading process start failed! /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_led_ctrl.crgb: %d %d %d /home/cfg/ledwfopen return error! write led status failed write led status to %d rinvailed led status node led-serviceEYE_V21_AR0237M8C_AK_V10_1245MINI6C_MAIN_H62_V10MINI7S_V10B_F23S2S_V14_2235EYE_V30B2S_V10_2235SPEED3C_V12_H62SPEED4S_V10_F23SPEED4C_V12_H62/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_db_alarm.cspeed 3c-h62 4s-f23 4c-h62 adjust value S4S_V11_F23S4C_V13A_H62SPEED3C_V12A_H62S3S_V12A_F23S4C_A1_V10_1245S5C_A1_V10_1245set db alarm adjust value to %d set db alarm enable to %d db alarm level is %d double talk stop flag %d db value: %d error db_alarm_level scope error: %d db_detectdefault adjust value: %d db alarm gate %d now_db %d db alarm callback is null db alarm callback failed: %d device don't support db alram register audio ctrl failed: %d create db detect thread failed /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_sleeping.c%d, %d, %d sleep mode turn off sleep mode turn on sleep mode time sleep mode geo set geo mode to %d invailed vaule: %d add sleep plan: enable: %d, start_hour: %d, start_min: %d, stop_hour: %d, stop_min: %d, mask: 0x%x clear all sleep mode is null ptr sleep mode status is null ptr set sleep status to %d sleeping_monitorcreate thread failed sleeping awaking monitor inited /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_temp_humidity.cio ctrl get env failed env flag read nothing temp_humidityThis device don't support temp and humidity create thread failed temp humidity thread created ppstrong.bin/mnt/mmc01/%4d-%2d-%2d %2d:%2d:%2d%04d%02d%02d%02d%02d%02da3-tuya2_merkury%s-/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_sdcard_factory.cCann't find version split symbol Not are the same platform, forbiden upgrade The same version firmware, not to upgrade! Ready to upgrade /mnt/mmc01/%.*sreboot .... %s/%scomplete file path is too long, can't process no this file: %s rename %s to %s failed upgrade.binfind upgrade.bin file upgrade protect failed: %dupgrade by file failed: %d /mnt/mmc01upgrade_error.binrename upragde file failed: %d upgrade ok upgrade_ok.binupgrade protect release failed: %dft_sd_mtFactory mounted cb subscribe fail! ft_sd_rmFactory removed cb subscribe fail! sdcard event factory operate cb registed ft_sd_s_rm/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_sdcard.csdcard is not init! fsck... capacity correct... PPS_EV_SDCARD_FORMAT_START PPS_EV_SDCARD_FORMATED PPS_EV_SDCARD_MOUNTED PPS_EV_SDCARD_START_REMOVE PPS_EV_SDCARD_REMOVED PPS_EV_SDCARD_DISK_FULL sdcard_loop/dev/mmcblk0/mnt/mmc01sdcard init failed! sdcard_fscksdcard_full/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_factory.cEnter factory mode by %d Open parririon 2 write permissions failed, ret is %d we are now in factory mode 8|pd,TܷX $@dformat_vfat/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/pps_sdcard.cvfat create failed: %s Already umounted! umount failed! sd ptr is null!!! Already mounted! device node open error, try power on again! sd card fstype=%d, try to format sdcard! try to format fail format finish, new fs type %d. SD card fstype is unsupport and auto_format is turn off. No fs type data is read, reset power try read agin! No partition list %d! Force umount %s Not match with the request, umount %s! readonly test fail. Try to format fail SD card may be broken, cannot be mounted! mount failed! [fsck]Read only test file not exist, sdcard maybe broken, can't mount! formating is running! umount error. sdcard avail bytes:%lld, more than 512MB. sdcard usage %d, limit %d sdcard unformated, please run format! Get file system type, retry count:%d SD card file system type is not supported, please format your SD card! retry mount sdcard. Receive command %d sdcard is too full, call full function. /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/pps_fsck/pps_sdcard_fsck.c[fsck]No path. [fsck]Open path:%s error! recover read dbr error! [fsck]No fs. [fsck]No buf. open %s failed. read MBR fail! %sp%dGot one partition: %s No partition %s [fsck]New resources error. [fsck]Get DBR error! [fsck]Dir repia fail! total file size:%lld, used_size:%lld The total file size is too different from the record in fsinfo, start check and update fsinfo. [fsck]Read only file create error! SDCARD is too full, unable to readonly test! Please clean up your sdcard and test again manually. [fsck]Malloc error! %s/readonly.bin[fsck]Get DBR error! ret=%d [fsck]FAT check error! Cannot find partition! FAT32[fsck]Sdcard fs type is FAT32. [fsck]sdcard fs type is NTFS. [fsck]sdcard fs type is exFAT. [fsck]Sdcard fs type is FAT16. [fsck]Sdcard fs type is OPUS. [fsck]Sdcard fs type is OLD LINUX. [fsck]Sdcard fs type is LINUX SWAP. [fsck]Sdcard fs type is LINUX. [fsck]Sdcard fs type is BSD. [fsck]Sdcard fs type is OPEN BSD. [fsck]Sdcard fs type is not formatted, please try format! /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_device_ptz_old.cup failed: %d ptz stop error stop ptz moving, return stoped, return unsupport cmd: %d, return ptz error cmd:%d sem errorptz_servicesem init failed ptz sync timeout motor init failed: %d create ptz thread failed: %d ptz service started(old) usefree,errors=continue/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/pps_sdcard_hisilinux.cDir %s operation failed! /dev/mmcblk0p1vfatmount failed: %s umount failed: %s /proc/mountsThe %s has been mounted to %s! /dev/loopsdcard power on! sdcard power off! %sp%dGot one partition: %s No partition %s create part failed: %d, %s Cannot find partition! vfat create failed: %s statvfs failed SDCard: total_size: %.1fG, used: %.1fG, free: %.1fG /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/fstools/fdisk.cseek error = %d write error = %d ioctl blkssizget %d Note: sector size is %d (not %d) --seq--- ---addr--- -- -- -- -- -- -- -- -- -- -- -- -- -- -- -- -- ---------------- %8d %p %02X invalid part table got bytes %llu longsectors %lu limit eddddSector %llu is already allocated No free sectors available start %d -- limit %d start = %lld stop = %lld Calling ioctl() to re-read partition table. reread_partition_table ioctl err.i = %d, errno = %d reread_partition_table ioctl err. errno = %d, i = %d WARNING: Re-reading the partition table failed with error %d: %s. The kernel still uses the old table. The new table will be used at the next reboot. open %s failed. n part size 1 %lld max four partitions! nPart = %d start add_partition_autonpart %d -- size %lld start add_partition_auto end The partition table has been altered! get Total Sectors %s failed error %d get Total Sectors ioerror %d Disk Size = %.3fG mkdosfs%s: Bad FAT size (not 12, 16, or 32) %s: Invalid cluster number in mark_FAT_sector: probably bug! %s: seek failed during testing for blocks Unexpected values in do_check: probably bugs%lld... Searching for bad blocks %s: bad blocks before data-area: cannot make fs s%d bad block%s rlistfile = NULL, filename = %s %s: Can't open file of bad blocks %ld open failed, filename = %s /etc/mtab%s contains a mounted file system.%s: unable to get diskette geometry for '%s' ioctl err, errno = %d %s: unable to get loop device size Loop device does not match a floppy size, using default hd paramsunable to get drive geometry, using default 255/63Auto-selecting FAT32 for large filesystemmkdosfWarning: message too long; truncatedBoot jump code is %02x %02x %s: On FAT32 at least 2 reserved sectors are needed. Using %d reserved sectors %s: #hidden doesn't fit in 16bit field of Atari format %d sectors for FAT+data, starting with %d sectors/cluster Trying with %d sectors/cluster: FAT12: #clu=%u, fatlen=%u, maxclu=%u, limit=%u FAT12: too much clustersFAT16: #clu=%u, fatlen=%u, maxclu=%u, limit=%u FAT16: too much clustersFAT16: would be misdetected as FAT12 FAT16: too much clusters FAT32: not enough clusters (%d) FAT32: #clu=%u, fatlen=%u, maxclu=%u, limit=%u FAT32: too much clustersChoosing %d bits for FAT FAT12 WARNING: Not enough clusters for a 16 bit FAT! The filesystem will be misinterpreted as having a 12 bit FAT without mount option "fat=16". This filesystem has an unfortunate size. A 12 bit FAT cannot provide enough clusters, but a 16 bit FAT takes up a little bit more space so that the total number of clusters becomes less than the threshold value for distinction between 12 and 16 bit FATs. %s: Make the file system a bit smaller manually. FAT16 FAT32 %s: FAT not 12, 16 or 32 bits Sector size must be %d to have less than %d log. sectors ss=%d: #clu=%d, fat_len=%d, maxclu=%d Too many clusters FAT too big %s: With this sector size, the maximum number of FAT entries would be exceeded. %s: Would need a sector size > 16k, which GEMDOS can't work with %s: Backup boot sector must be after sector 1 %s: Backup boot sector must be a reserved sector Using sector %d as backup boot sector (0 = none) %s: GEMDOS can't handle more than 65531 sectors Warning: More than 32765 sector need TOS 1.04 or higher.%s: Too many clusters for file system - try more sectors per cluster %s: Attempting to create a too large file system %s: Too few blocks for viable file system %s has %d head%s and %d sector%s per track, logical sector size is %d, using 0x%02x media descriptor, with %d sectors; file system has %d %d-bit FAT%s and %d sector%s per cluster. FAT size is %d sector%s, and provides %d cluster%s. Root directory contains %d slots. Volume ID is %08lx, volume label %s. no volume label.%s: unable to allocate space for FAT image in memory %s: unable to allocate space for root directory in memory %s: Out of memory llseek err, errno = %d %s: seek to start of device failed whilst writing tables %s %d write err, errno = %d %s: failed whilst writing reserved sector %s: seek to boot sector failed whilst writing tables %s: failed whilst writing boot sector %s: seek to info sector failed whilst writing tables %s: failed whilst writing info sector %s: seek to backup boot sector failed whilst writing tables %s: failed whilst writing backup boot sector %s: seek to first FAT failed whilst writing tables %s: failed whilst writing FAT %s: failed whilst writing root directory Usage: mkdosfs [-A] [-c] [-C] [-v] [-I] [-l bad-block-file] [-b backup-boot-sector] [-m boot-msg-file] [-n volume-name] [-i volume-id] [-s sectors-per-cluster] [-S logical-sector-size] [-f number-of-FATs] [-h hidden-sectors] [-F fat-size] [-r root-dir-entries] [-R reserved-sectors] /dev/name [blocks] Bad location for backup boot sector : %s Bad number of FATs : %s Bad FAT type : %s Bad number of hidden sectors : %s Volume ID must be a hexadecimal number-%-11.11sAbcCf:F:Ii:l:m:n:r:R:s:S:h:vWarning: block count mismatch: found %llu but assuming %llu. %s: Need intended size with -C. No device specified! Bad block count : %s %s: -c and -l are incompatible open failed, errno = %d %s: unable to open %s %s: unable to create %s llseek failed, errno = %d %s: seek failed write failed, errno = %d %s: write failed fstat failed, errno = %d %s: unable to stat %s %s: Will not try to make filesystem on full-disk device '%s' (use -I if wanted) dosFsCreate%d-s-Smkfs_main failed/dev/hda4/dev/hda3/dev/hda2/dev/hda1write_tables/home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/pps_fsck/pps_fsck_io.c%s open fail!!! Seek to %lld Read %d bytes at %lld Got %d bytes instead of %d at %lld Seek to %lld, Did not write %d bytes. Writing %d bytes at %lld closing filesystem fail! /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/pps_fsck/pps_fsck_boot.cThere is no backup boot sector. And there is no space for creating one! Auto-creating backup boot block. Created backup of boot sector in sector %d fs read error! return! There are differences between boot sector and its backup. This is mostly harmless. Differences: (offset:original/backup) , %s%u:%02x/%02x%s No FSINFO sector Not automatically creating it. fsinfo sector is error, but can't write. sdcard maybe broken. FSINFO sector has bad magic number(s): Offset %llu: 0x%08x != expected 0x%08x Auto-correcting it. Dirty bit is set. Fs was not properly unmounted and some data may be corrupt. Automatically removing dirty bit. [fsck]Logical sector size is zero.Logical sector size (%d bytes) is not a multiple of the physical sector size.sector count per cluster (%d) is not to the nth power of 2. dir_entries(%d) must be zero. media(0x%x) must be 0xf8 or 0xf0. [fsck]fs.cs:%d, b.cs:%d, nfats:%d [fsck]Cluster size is zero.[fsck]Currently, only 1 or 2 FATs are supported, not %d. [fsck]total_sectors:%d, b.ts:%d [fsck]fat_length:%d, b.fat_length:%d, b.fat32_length:%d FAT size is zero.[fsck]fat_start:%lld, root_start:%lld, root_entries:%lld, data_start:%lld [fsck]data_size:%lld [fsck]Tool name:%s, fstype:%s [fsck]Filesystem has no space for any data clustersWarning: FAT32 root dir not in cluster chain! Compatibility mode... No root directory!Warning: FAT32 root dir is in a cluster chain, but a separate root dir area is defined. Cannot fix this easily. Warning: Filesystem is FAT32 according to fat_length and fat32_length fields, but has only %llu clusters, less than the required minimum of %d. This may lead to problems on some systems. [fsck]Read FSINFO error! Filesystem has %u clusters but only space for %u FAT entries.Root directory has zero size.Root directory (%d entries) doesn't span an integral number of sectors.Logical sector size (%u bytes) is not a multiple of the physical sector size./home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/pps_fsck/pps_fsck_fat.cInternal error: cluster out of range in pps_fsck_set_fat() (%llu > %llu). Internal error: new cluster out of range in pps_fsck_set_fat() (%llu > %llu). [fsck]Read default FAT error! defaultbackup[fsck]Read backup FAT error! read fat data fail! write fat data fail! [fsck]Get fat entry error! [fsck]start compare fat table entry. FAT is diff!!!, read_pos=%d diffsame[fsck]fat compare result is %s. FATs differ - using default FAT. [fsck]Repia fat error! FATs differ - using backup FAT. FATs differ but appear to be intact. Using default FAT. Both FATs appear to be corrupt, Can't use. Please try format, now exit fat check!!! [fsck]Fat repia error, sdcard may be broken! [fsck]fat table check finish. Internal error: pps_fsck_next_cluster on bad clusterfunction is time out! fsinfo is ture, no need modify. /home/rzq/code/4.2.x_2/camera-app/pps_device/pps_sdcard/pps_fsck/pps_fsck_file_check.cmalloc error! str_array[%d] malloc error! %s.%sDirectory entry is not the starting position! . .. RECORDDir:%s is not exist! dir:%s is already exist. dir:%s is not exist, link it. find link dir:%s, recovery it. open error! [fsck]Get DBR error! ret=%d [fsck]Get sde info error! ret=%d [fsck]Link dir error! ret=%d [fsck]Unlink dir error! ret=%d [fsck]Read only file unable delete, dir entry table maybe broken. [fsck]Read only file unable delete, FAT table maybe broken. find a can't repair dir, delete it. readonly.binREADONLYBINWrite dir entry error! Write fat entry error! Meari sdcard readonly test[fsck]Write readonly file error! [fsck]Cluster %d is bad cluster! Skip it. delete dir:%s, start_cluster is:%d, offset:%llu default[fsck]Get fat entry error! [fsck]Find a broken dir:%s, repia it. [fsck]File count to many, out onr cluster range, next cluster:%d. %d Dir repia func recursive level is too deep, must release the resource! [fsck]Start scan large dir next part. [fsck]free clusters:%d [fsck]Update fsinfo free_clusters error! [fsck]Update fsinfo next_cluster error! [fsck]Get next free cluster error, unable update fsinfo! [fsck]Not found readonly file, SD card maybe broken! build data:%s,%sSep 11 2020pps_media_version:20200512--4.5.0###---->reset input vol :%d ###---->reset ouput vol :%d wait all task exits all!aac create erraac create okaencaenc_appak_ai_close erranyka buf err:%d open out------------------>play errai handle errget ai frame errclose outak_ao_open err-------------vol %d ak_ai_open errvol %d set ai source mic failset ai source mic successak_ai_set_frame_interval err--%s--###debug:err###Debug:%d-%d-%x-%x:%s level/mode/osd/line/csc/dsp/debug/setstreamfile//dsp/debug/cmd__//dsp/debug/infodisplay%s-->okbuf:%s ak_vi_get_handle err---------------->no init jpegsnapshot ak_vi_get_frame err,ret:%d,%x snapshot ak_venc_send_frame errpps_venc_snapshot_save_jpeg size errsnapshot ak_venc_get_yuv err,ret:%d,%x ak_vi_get_channel_attr err------ak_venc_open pic err h:%d---w:%d---chn:%d ak_venc_open pic ok h:%d---w:%d----chn:%d ---------------->no initdefaultDsppps_defaultpsp_media_mutex_registerno support mutex###%s_line:%d_ERR------> init errZPF<72-((# cnt sxh nt lumn ag awb ag_diff ag_low ag_high ag_curr awb_diff awb_low awb_high awb_curr xch_num ct xch quo dn hour min sec /mnt/mmc01/test/dn.dat%u %u %u %u %u %u %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d L:%x,AG:%x,TT:%x,XC:%x,FC:%x,F:%x,IRS:%x,IRTS:%x---------->break short,lumn_max:%d,awb_min:%d ---------->break,lumn:%d,%d,awb:%d,%d %d:%d:%d Lumn:%d G:%d tt:%d xFlag:%d-%d Awb:%u-%u-%u Lumi:%u-%u-%u Quo:%u rxch:%d------->stop /mnt/mmc01/test/dn_debugdn debug start checkdnTaskDN!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>pps_media_md_task_loop_callcrc:%x MD_VALID_SIZE_MIN=MD_VALID_SIZE_MAX=MD_BOUNDARY_SIZE_H=MD_BOUNDARY_SIZE_V=set region:%d,%d MD_FLT_BIG=MD_FLT_SMALL=set flt:%d,%d F:%x,MC:%x,PC:%x,DNPC:%x,MDCC:%x,PMDCC:%x,TWC:%x,MDCF:%x,JFC:%xget 3d nr stat info fail%d%02d%02d%02d%02d%02dw%d,h:%d,%d,%d ---w%d,h:%d mdTask/mnt/mmc01/test/qr_debug---------->start qr debug/mnt/mmc01/test/qr_%d_%d_%d_%s.yuv/mnt/mmc01/test/qr_%d_%s.jpgmdCallcall user###%s_line:%d /home/sound/restart.wavMDpps_media_md_exitset md region from bitpara errset md region format no support ---PPS_MEDIA_MD_PARA para size err----size:%d,%d -------------sensity:%d--------:%d ---PPS_MEDIA_SYS_MD_SET para size err----size:%d,%d -------------sensity:%d-------- %3d pps_media_osd_createDisRegpps_media_osd_disChnTextpps_media_osd_taskLoopmalloc ERR %s chan:%d set rect err x:%d,y:%d,w:%d,h:%d pps_media_osd_creadReg err line:%s code:%x chn %d ###get time err, ::%u %d-%02d-%02d %02d:%02d:%02dfontLibAsc___NULLHI_MPI_RGN_UpdateCanvas err _______code : %x,chn:%d bitmap format not supportedno support no support format set chan:%d bitmap :%d--%d set chan:%d bitmap :%d--%d,base:%d--%d draw pic-----------errdraw pic create err-----------draw pic-----------create id:%d osd exit okosdTask___________________00000000000000_____osd ak_vi_get_handle err/home/ASC16set font file errak_osd_init errosd set init ok--------------->---->reflush osdvenc_readvenc_sendak_venc_request_stream errchan:%d ---enType = %d, enRcMode = %d, u32BitRate = %d, u32Gop = %d, fr32DstFrmRate = %d---%d-----%d -----------chan:%d, w:%lu,h:%lu,minqp:%ld,maxqp:%ld fps:%ld,goplen:%ld,bps:%ld, profile:%d,use_chn:%d,enc_grp:%d,br_mode:%d,enc_out_type:%d target:%d,max:%d set_end: target:%d,max:%d get channel attr errak_vi_change_channel_attr errak vi change size ok chan:%d,,w:%d,h:%d ---------->ak_vpss_isp_init_sdk err-------------set level 0/home/cfg/home/ispcfgmatch sensor failed ########## ak_vi_open failed!ak_mpi_vi_get_sensor_res failed!ak_vi_set_channel_attr failed!vi init okset flip mirror err:%x -----------------------------------seq:%d---> RIFFfmtfactLISTshould never be here!base:%d ----err:%d ----------->open dictortionvpss_rotation=snap exit okpps_recv_video_stream_callbackpps_recv_video_stream_uncallbackpps_recv_audio_stream_callbackpps_recv_audio_stream_callbackpps_recv_video_stream_uncallbackSendStreamToVLC_v3pps_media_SendStreamToVLC_v2%s/test_%d_%d-%d-%d.h264ipaddr err[STREAM_TEST]stream_test_mode=stream_test_wait_cnt=stream_test_ip=/mnt/mmc01/streamip:%s,port:%d,cnt:%d [AUDIO_PCM_REC]---pcm_rec test[AUDIO_G711U_REC]---g711u_rec testpps_media_strnio_ircut_ctlpps_media_strnio_noti_app_okpps_media_strnio_infr_ctlpps_media_strnio_initrecfgcodecAcShdnpthread exit:%d,%s irCutpps_media_strnio_noti_app_okpthread_attr_setschedpolicyid::%d pps_media_strnio_infr_ctl/dev/Strnioopengpiolistenerdown-----%u up-----%u BUTTON_EV_AXP-----%u BUTTON_EV_DOORBELL_KEY-----%u BUTTON_EV_PIR_STATUS_UNDETECTED-----%u pps_media_init_dsp_libpps_media_audio_get_para_pps_media_audio_set_para------>sys_cfg_size:%d init_dsp_lib malloc errsoih62soih62mipisc1245gc1054gc1034pps_media_audio_set_parapps_meida_ppsdev_getPara_char------------------------------------------------------------------%d %08x: 0000 %04x ******--------------------------------------------------------------------00 para:%s---%s %s,%u --------------------open write---%s .yuvdlopen ok-------------->:%s--%s ----->%s failed to read para info err para:%s /proc/ppshal/dev_info-modename-lensinfo-sensor-pcbversion-viewmirror-mmz:-inputvolumn-ouputvolumnnaturalvertical_horizontalverticalhorizontalEYE_V22_20160804ov9732EYE_V21_20151111HAIER_MAIN_V10_20160629ar0130ar0230ar0237ov9712MINI6_9732_V10_20160704MINI6_V10_20160316ar0230SSHELL_V30_20160621start rea random/home/cfg/random_para.txt/home/random_para.txtrandom_para.txtpara:%s---%d reread random/mnt/mmc01/random_para.txt/dsp/debug/isp/ldc/ldcopen/0x1/ldctype/0x0/CenterXOffset/0/CenterYOffset/40/Ratio/35//dsp/debug/isp/ldc/ldcopen/0x1/ldctype/0x0/CenterXOffset/0/CenterYOffset/0/Ratio/90//dsp/debug/isp/ldc/ldcopen/0x0//dsp/debug/isp/ldc/ldcopen/0x1/ldctype/0x0/CenterXOffset/0/CenterYOffset/70/Ratio/90/ ---->sensorName:%s,modeName:%s,lensInfo:%s sc1125vi_ldc=Speed^2f2.8Asoif23mipiSpeed^3Sf4.0ASpeed^1Cf2.6Aov9732mipisc2235Flight^1SBullet^3SFBOC:%x,FEC:%x,OIF:%xvencTaskyuvTask#### stop use chan errchan hand init:%d disable set h264-------------------->flag:%x,chan:%d VENCpps_media_talk_clear_bufpps_media_talk_send_frame_dspPPS_MPI_TALK_Enablepps_media_talk_clear_buftalk_fifo err#############################voice set pause#############################voice clear buf#############################voice clear pause###############buf no empty,pauseFlag:%d stop talk send frameclear talk buf %utalkTask/mnt/mmc01/test/audio_debug_outaudio debug out start check/mnt/mmc01/test/out_pre.g711g711 decode err----set audio aec----aiTaskaencTaskpps_media_audio_set_ppsencode_para%d_%s set stauration:%d set mode night err dL DX@ out of memory!rc >= 0zbar/refcnt.hEAN-8UPC-EISBN-10UPC-AEAN-13ISBN-13I2/5CODE-39CODE-128PDF417QR-CodeUNKNOWN+2+5n > 0zbar/symbol.cn <= maxleni > 0_zbar_refcntzbar_symbol_xmlrc >= 0zbar/refcnt.hnewimg->cleanup(newimg)img->refcntzbar/image.cdst->data%s.%.4s.zimg%s.%08x.zimgn < len%s: dumping %.4s(%08x) image to %s w%s: ERROR opening %s: %s %s: ERROR writing %s: %s _zbar_refcntzbar_image_free_datazbar_image_copyzbar_image_writezbar_image_writerc >= 0zbar/refcnt.hsym->data_alloczbar/img_scanner.c0sym->dataiscn->recycle[i].nsyms!sym->symsline%s: symbol sets allocated = %-4d %s: scanner syms in use = %-4d recycled = %-4d %s: image syms in use = %-4d recycled = %-4d %s: symbols allocated = %-4d %s: recycled[%d] = %-4d %s: img_x+: %04d,%04d @%p p == data + x + y * (intptr_t)w%s: img_x-: %04d,%04d @%p %s: img_y+: %04d,%04d @%p %s: img_y-: %04d,%04d @%p _zbar_image_scanner_recycle_syms_zbar_refcnt_zbar_image_scanner_alloc_symqr_handlerdump_statszbar_scan_imagezbar_scan_imagebuf[%04x]= %s%02x /O_o?WARNING: %s:%d: %s: Assertion "%s" failed. code=%02x e1=%x e2=%x s4=%x color=%x zbar/decoder/ean.ccode < 0x14WARNING: %s:%d: %s: Assertion "%s" failed. i=%x d=%x chk=%x %s d < 10WARNING: %s:%d: %s: Assertion "%s" failed. chk=%x n=%x %schk < 10WARNING: %s:%d: %s: Assertion "%s" failed. n=%x d=%x chk=%x %s WARNING: %s:%d: %s: Assertion "%s" failed. w=%x d=%x chk=%x %s decode4ean_verify_checksumisbn10_calc_checksum\* -_kiQ 3679:^,aVb2 P]+.S`1R4UW>;jTO8X/ $2@G?o/?O?#E/O_g?V?o#EoWARNING: %s:%d: %s: Assertion "%s" failed. sig=%x offset=%x idx=%x base=%x zbar/decoder/code128.cbase < 8WARNING: %s:%d: %s: Assertion "%s" failed. sig=%x offset=%x base=%x idx=%x idx <= 0x50WARNING: %s:%d: %s: Assertion "%s" failed. dir=%x i=%x sum=%x acc=%x %s sum < 103acc < 103WARNING: %s:%d: %s: Assertion "%s" failed. start=%x end=%x i=%x j=%x %s dcode->buf[j] <= '9'code <= 9WARNING: %s:%d: %s: Assertion "%s" failed. dir=%x %s dcode->buf[dcode128->character - 1] == STOP_REVdcode->buf[dcode128->character - 1] == STOP_FWDWARNING: %s:%d: %s: Assertion "%s" failed. %s code >= START_A && code <= START_CWARNING: %s:%d: %s: Assertion "%s" failed. i=%x j=%x code=%02x charset=%x cexp=%x %s !(code & 0x80)cexpcode >= CODE_C && code <= CODE_AWARNING: %s:%d: %s: Assertion "%s" failed. alloc=%x idx=%x c=%02x %s dcode->buf_alloc > dcode128->character_zbar_decode_code128decode_lovalidate_checksumpostprocesspostprocess_cBJ՗\$'*+ "# % **'14C%F&I L R+Xad p$)(!+()'*&#  !! $ 0 B$H `%" 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ-. $/+%*WARNING: %s:%d: %s: Assertion "%s" failed. enc=%x s9=%x zbar/decoder/code39.cenc < 0x20WARNING: %s:%d: %s: Assertion "%s" failed. idx=%x enc=%x s9=%x idx < 0x2cWARNING: %s:%d: %s: Assertion "%s" failed. c=%02x s9=%x c < 0x2c_zbar_decode_code39code39_decode9%s: max finder lines = %dx%d |ӤbG (x ]*25IVhwĎ?uP (7 K.TdjAuialign0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ $%*+-./:  7% 3';> ),A/!CC0 CCCCCCCCCCCCCC         "   # "% "( #*&-(0+3!-6#09%3<&5?(8B+;F->J/AM1DQ%s: %dx%d finders, %d centers: _zbar_qr_destroyA@B@lD8     _zbar_qr_decoderc >= 0./zbar/refcnt.hUTF-8ISO8859-1SJISISO8859-%iCP437next > syms->datalenzbar/qrcode/qrdectxt.cqr_code_data_list_extract_text_zbar_refcnt            FATAL ERRORERROROKWARNINGNOTE"""""processorvideowindowimage scanner"("0"8"H"no errorout of memoryinternal library errorunsupported requestinvalid requestsystem errorlocking errorall resources busyX11 display errorX11 protocol erroroutput window is closedwindows system errorunknown errorerr->magic == (0x5252457a)zbar/error.c%s%d%x %s: zbar %s in %s(): %s: : %s (%d) _zbar_error_spew_zbar_get_error_code_zbar_error_string/dev/motoropenmake the motor move failure!/dev/Strnioopenid:%d,sta:%d,t:%x gpiolistenerPPS_HAL_PIR_GetStatus:%d ioctl failed: %d wlanPwr/home/rzq/code/4.2.x_2/camera-app/pps_hal/arm-himix100-linux/hwl_net.cget_mac_num param error loThe mac need 18 byte ! socket failed: %s get_mac_num ioctl error and errno=%d /proc/mtd/home/rzq/code/4.2.x_2/camera-app/pps_hal/arm-himix100-linux/hwl_mtd.copen file failed: %s read file: %s failed dev: size erasesize name "%s" does not start with "%s"mtd%d: %llx %x"%s" pattern not foundopening " not foundclosing " not foundtoo long mtd%d device nameopening " " not foundget mtd info input is invalid u-boot.binEncrypt.binuImageapp.imgbackup.imgnot match name: %s malloc failed read mtd info failed: %d parse mtd info failed mtd get info mtd num %d mtd name %s, num %d, eb size 0x%x, data size 0x%llx /dev/mtd%dopen %s failed: %s MEMGETINFO failed! offset must be times of %d bytes size must be times of %d bytes MEMERASE failed! write incomplete, %d writen! read incomplete, %d read! 0%d%.0f%e%f"""\ u%04xnullfalsetrue[]%s%p/var/cmd is too long!/var/systemCmd.socketconnect %s fail! write cmd fail, errno is %d(%s) /proc/statropen /proc/stat error! %s %u %u %u %u %u %u %u/proc/meminfoopen /proc/meminfo! %s %lu %sERRWARNINFODEBUGVERBOSEة"ܩ""""UNKOWN FILE%s[%02d:%02d:%02d.%03ld %s %s:%d]%s/home/rzq/code/4.2.x_2/camera-app/common/core/pps_eventhub.c[eventhub]Event is exist. [eventhub]Sub malloc error. [eventhub]Event is not exist. [eventhub]Call event %s function. Event id:%d [eventhub]Event %s callback is not exist. Event id:%d /mnt/mmc01/ppsFactoryTool.txtr/home/rzq/code/4.2.x_2/camera-app/common/core/pps_factory_check_info.copen %s failed: %s fgets line [%d] failed or read nothing: %s read chars number less than %d readed line content: %s After reading the destructionmalloc factory text buffer failed del debug file errdel debug file okstyle or style_call is null module=can't find %s in %s no character after %s ,,lost ,, got content len is %d, but max size could storage is %d key_c :%s ssid=get ssid failed password=get psk failed ipaddr=gateway=content or line is NULL /mnt/mmc01/playfile=get playfile failed cutcnt=get cutcnt failed wifiaudiotalkircut/home/rzq/code/4.2.x_2/camera-app/common/core/pps_queue.calloc memory failed for stream_queue /home/rzq/code/4.2.x_2/camera-app/common/core/pps_thread.cgetTimespec: clock_gettime call fail, error %d(%s) getTimespec: current time sec = %ld, time = %ld, nsec = %ld, total nsec = %lld getTimespec: after time sec = %ld, time = %ld, nsec = %ld pthreadSpawn: arg[%d] = %d ipcamare""""""""""pthread create: tid = %d, priority = %d, stacksize = %d /proc/uptimer/home/rzq/code/4.2.x_2/camera-app/common/core/pps_util.cparameter invalid a+create file[%s] error %s invalid parameter open %s failed open %s failed,%s invalid paremeter fwrite error: %s %s System Volume Informationcan not remove this file ,return nnn %s remove failed delete file %s mkdir %s failed %s This is a regular file %s! stat() failed ...%s/%.*sfile %s is not existed: %s /procopen directory %s failed /proc/%.*s/commopen %s error%dopen dir %s failed!!!! rinvalid paramater wopen file failed: %s write %s failed: %s open %s failed! write %s %d bytes failed: %s! read %s failed! delate %s failed, %s /path is = %s invalid pathname get file stat failed open dir %s failed..... remove sub_dir or file failed Param is NULL fopen %s failed fread failed, rlen:%d fwrite failed, wlen:%d input filename is NULL cmd is: %s inter err: can't open pipe get_web_cmd_buf(): cmd is null get_web_cmd_buf(): command buffer length is invaild %.*s%s/%sbuffer is not enough, at least: %d w+write file failed: writed: %d, need_writed: %d ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./01230123456789abcdef   8@<!!!! @@  (h(h$$7    AutoAd-HocManagedMasterRepeaterSecondaryMonitorUnknown/bugIEEE 802.11a + 802.11g (2.4 & 5 GHz, up to 54 Mb/s)IEEE 802.11a + 802.11b (2.4 & 5 GHz, up to 54 Mb/s)IEEE 802.11g (2.4 GHz, up to 54 Mb/s)IEEE 802.11a (5 GHz, up to 54 Mb/s)IEEE 802.11b (2.4 GHz, up to 11 Mb/s)Atheros turbo mode at 5 GHz (up to 108 Mb/s)Atheros turbo mode at 2.4 GHz (up to 108 Mb/s)TI 802.11+ (2.4 GHz, up to 22 Mb/s)802.11g higher rates, OFDM at 2.4 GHz (up to 54 Mb/s)802.11a, OFDM at 5 GHz (up to 54 Mb/s)802.11b higher rates (2.4 GHz, up to 11 Mb/s)802.11 Direct Sequence (2.4 GHz, up to 2 Mb/s)802.11 Frequency Hopping (2,4 GHz, up to 2 Mb/s)Atheros turbo mode, channel bonding (up to 108 Mb/s)TI 802.11+ higher rates (2.4 GHz, up to 22 Mb/s)Driver specific modulation (check driver documentation)noneWEP-40TKIPWRAPCCMPWEP-104802.1xPSK%02X:%02X:%02X:%02X:%02X:%02X%g%g %cHzChannel%c%sFrequency%c%s (Channel %d)Frequency%c%son**-%.2X%g %cb/sQuality%c%d/%d Signal level%c%g dBm Noise level%c%g dBmSignal level%c%d dBm Noise level%c%d dBmSignal level%c%d/%d Noise level%c%d/%dQuality:%d Signal level:%d Noise level:%d unknown (%d) %sUnknown: %02XWPA Version %d IEEE 802.11i/WPA2 Version %d Group Cipher : TKIP Pairwise Cipher : TKIP Group Cipher : Proprietary Group Cipher : Pairwise Ciphers : TKIP Pairwise Ciphers (%d) : Proprietary Authentication Suites (%d) : Preauthentication SupportedP IE: Warning: Driver for device %s has been compiled with an ancient version of Wireless Extension, while this program support version 11 and later. Some things may be broken... Warning: Driver for device %s has been compiled with version %d of Wireless Extension, while this program supports up to version %d. Warning: Driver for device %s recommend version %d of Wireless Extension, but has been compiled with version %d, therefore some driver features may not be available... Cell %02d - Address: %s NWID:off/any NWID:%X %s Mode:%s Protocol:%-1.16s ESSID:"%s" [%d] ESSID:"%s" ESSID:off/any/hidden Encryption key:off%s [%d] Security mode:restricted Security mode:open Bit Rates: ; Modulations : ; Extra:%s (Unknown Wireless Token 0x%04X) %s [%d]off/any/hidden%-8.16s Interface doesn't support scanning. %-8.16s Interface doesn't support scanning : %s Unhandled signal - exiting... %s: Allocation failed %-8.16s Failed to read scan data : %s %-8.16s No scan results ̸"Ը"ܸ""""" "611ag"11abL"&11g"11a"11b̹"Pturboa"fturbog$"11+T" OFDMgx"OFDMa"CCKغ"DS"FH8"@turbol"PBCC"@customػ"print_scanning_infoprint_scanning_info_v2print_scanning_info_v3%-20s nulltruefalse%ld%ga != ((void *)0)/home/rzq/code/4.2.x_2/camera-app/common/net/mongoose.ca->len <= a->sizeoff <= a->len%p %puserproto%p %s ev=%d ev_data=%p flags=%lu rmbl=%d smbl=%d%p after %s flags=%lu rmbl=%d smbl=%d%p %lu==================================init mgr=%p%pfailed to create connectionfailed to init connectionudp://tcp://%u.%u.%u.%u:%u%n:%u%n%u%n%p %p %d %d, %p %p%p %d %u%p discarded %d bytesnc->flags & (1 << 1)%p %uOOMudptcp%p %s://%s:%hu%p connect, err=%dcannot parse addressResolver is disabledFailed to open listener: %dfailed to open listener%d.%d.%d.%d/%d%n%d.%d.%d.%d%n%08x %c%p %p %d -> %lu%p sock %d err %d%p: failed to accept: %dio->len > 0%p %d %d %d %s:%hu%p %d bytes -> %d%p %d bytes (PLAIN) <- %dOut of memory%p recvfrom: %s%p %d bytes from %s:%d%p fd=%d fd_flags=%d nc_flags=%lu rmbl=%d smbl=%d%p after fd=%d nc_flags=%lu rmbl=%d smbl=%dread %d from ctl socket%p %d%p using select()select @ %ld num_ev=%d of %d, timeout=%d://...: Content-Length PUTPOSTblen >= body_leni <= blenTransfer-EncodingchunkedContent-Typemultipartinvalid requestboundary--Content-Disposition: namefilename%p Not allowed to upload %sHTTP/1.1 403 Not Allowed Content-Type: text/plain Connection: close Not allowed to upload %s %p Receiving file %s -> %swHTTP/1.1 500 Internal Server Error Content-Type: text/plain Connection: close Failed to open %s: %d Failed to write to %s: %d, wrote %dHTTP/1.1 413 Payload Too Large Content-Type: text/plain Connection: close Failed to write to %s: no space left; wrote %d %p rec'd %d bytes, %d total%p Uploaded %s (%s), %d bytesHTTP/1.1 200 OK Content-Type: text/plain Connection: close Ok, %s - %d bytes. Failed to store %s (%s)OKPartial ContentMovedFoundBad RequestUnauthorizedForbiddenNot FoundRequested range not satisfiableI'm a teapotInternal Server ErrorHTTP/1.1 %d %s %s %sTransfer-Encoding: chunked Content-Length: %lld %lX <>:443:80/%s %shttp://https://GET%s %s HTTP/1.1 Host: %s Content-Length: %zu %s %s]%s:%d%d %s %04x %02x %s -C>XX<-%lu %p %s %s %s %d ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123mbuf_insertmg_add_connmg_callmg_close_connmg_mgr_initmg_mgr_freemg_if_accept_new_connmg_recv_commonmg_if_recv_udp_cbmg_if_recv_udp_cbmg_do_connectmg_if_connect_cbmg_bind_optmg_check_ip_aclmg_set_timermg_if_connect_tcpmg_accept_connmg_write_to_socketmg_write_to_socketmg_read_from_socketmg_recvfrommg_handle_udp_readmg_mgr_handle_connmg_mgr_handle_ctl_sockmg_sock_setmg_ev_mgr_initmg_mgr_pollmg_handle_chunkedmg_http_handlermg_http_multipart_beginmg_file_upload_handlermg_http_common_url_parse%1x01234567890123456789abcdef0123456789ABCDEF/home/rzq/code/4.2.x_2/camera-app/common/net/net_base_operate.csocket_create failed: errno %d socket_listen failed: errno %d socket_accept_with_timeout: param err. time out. select err. socket_accept_with_timeout failed NULL: errno %d socket_accept_with_timeout failed: errno %d set_socket_keeplive: SO_KEEPALIVE, setsockopt ERROR : set_socket_keeplive: TCP_KEEPIDLE setsockopt ERROR : set_socket_keeplive: TCP_KEEPINTVL, setsockopt ERROR : set_socket_keeplive: TCP_KEEPINTVL,setsockopt ERROR : param failed %dtcp_connect_xx: getaddrinfo failed %s,%s,%d ioctl socket failed tcp_connect_xx: failed %s,%s connect_with_timeout para error socket_recvfrom param failed para error send_data_insmal mabe erro!!!!!!!!! send_data_insmall mabe lost packet!!!!!!!!! send_data_insmall_packet write error readn: param err. readn: select failed, %s recv, %s writen: param err. EINTR Send() error, 0x%x %u.%u.%u.%u/home/rzq/code/4.2.x_2/camera-app/common/net/netconfig.cdel_active_route param error pps_del_route create socket error del_route ioctl error and %s pps_set_net_param param error name = %s, speed = %d, duplex = %d, and autoneg = %d Cannot get control socket Cannot get current device settings invalid speed mode invlid duplex mode Cannot set new settings: %s convert_ipv6str_tonum: param error convert_ipv6num_tostr: param error %02xinterface_is_used() praram invalid!!! /proc/net/routeropen %s failed and error information is %s %*[^ ] %63s%x%x%X%d%d%d%x%d%d%d wlan0eth0eth1get_net_connect_status param invalid!!!. get_gateway param invalid.!!! open %s failed %s get_gateway fscanf error and r=%d,error information is %s get_ipaddr param err. The ip need 16 byte ! socket failed ! %s get_ipaddr ioctl error and errno=%d get_mac param err. loThe mac need 18 byte ! socket failed! errno = %d get_mac ioctl error and error infor %s %02x%c%02x%c%02x%c%02x%c%02x%c%02xget_netmask param error The netmask need 16 byte ! socket failed !errno = %d get_netmask ioctl error and errno=%d get_broadcast_addr param error The broadcast need 16 byte ! get_broadcast ioctl error and errno=%d get_dns: param err. /etc/resolv.confcan not open file /etc/resolv.conf %snameserver%s%s/proc/net/if_inet6%32s%x%x%x%x%*[^ ] /proc/net/ipv6_routecannot open %s %32s%x%s%s%s%s%s%s%s%s%*[^ ] 00000000000000000000000000000000is_same_subnet() param invalid.!!! ip address: 0x%x ip mask: 0x%x ip gateway: 0x%x is in same subnet isn't in same subnet gateway is null !prog return err. 0.0.0.0interface isn't set gateway. set_gateway ioctl error and errno=%d param error set_ipaddr ioctl error and errno=%d ioctl error and errno=%d if_down failedset_mac ioctl error and errno=%d if_up down failed.. set_netmask: param err. set_netmask ioctl SIOCSIFNETMASK error: %s gateway is null! add route ioctl error and errno=%d del route ioctl error and errno=%d update_net_param-- get_ipv6addr_num failed,errno:%d set_broadcast_addr: param err. set_broadcast_addr ioctl error and errno=%d if_up: param failed if_up ioctl(SIOCGIFFLAGS) error and errno=%d if_up ioctl(SIOCSIFFLAGS) error and errno=%d if_down param failed %d You can't pull down interface lo if_down ioctl error and errno=%d set_route param failed %d set_route ioctl error and errno=%d set_mtu param failed %d set_mtu ioctl error and errno=%d del_gateway ioctl error and errno=%d interface:%s-ip:%s- interface:%s-mask:%s- reference-interface:%s-ip:%s- reference-interface:%s-mask:%s- is in same subnet connect_with_timeout para error ioctl socket failed get_peer_addr: param err. get_peer_addr peer_addr: %s ip_addr unlawful %d.%d.%d.%dis_mask_valid, IN_IS_ADDR_NETMASK ERR! is_mask_valid, IN_IS_ADDR_UNSPECIFIED ERR! is_ip_valid, IN_IS_ADDR_NETADDR ERR! is_ip_valid, IN_IS_ADDR_LOOPBACK ERR! is_ip_valid, IN_IS_ADDR_BROADCAST ERR! is_ip_valid, IN_IS_ADDR_MULTICAST ERR! is_ip_valid, beyond ip scope of A&B&C! is_address_valid, IN_IS_ADDR_LOOPBACK ERR! is_address_valid, beyond ip scope of A&B&C! is_stringip_multicast para error! is_stringip_multicast, ip addr error, p_ip:%s! is_stringip_multicast, IN_IS_ADDR_MULTICAST ERR, p_ip:%s! is_stringip_multicast, IN_IS_ADDR_RESERVE_MULTICAST ERR, p_ip:%s! is_domain_valid para error! is_domain_valid, domain length is %d! is_domain_valid, is_string_valid return error! is_domain_valid, domain head or tail error! is_domain_valid, domain is invalid! is_hostname_valid para error! is_hostname_valid, hostname length is %d! is_hostname_valid, hostname head or tail error! is_hostname_valid, hostname is invalid! is_string_ipaddr_ipv4, input is null! NULL entry The str_ipv4(%s) form not accord with IPv4! is_string_ipaddr_ipv4, inet_pton err! is_string_ipaddr_ipv6, input is null! is_string_ipaddr_ipv6, inet_pton err! check_str_ipv4, ipstr is null! check_net_ipv4, IN_IS_ADDR_LOOPBACK ERR! check_net_ipv4, IN_IS_ADDR_MULTICAST ERR! check_net_ipv4, beyond ip scope of A&B&C! check_str_ipv4, The string_ipv4 form not accord with IPV4! check_str_ipv6, ipstr is null! check_str_ipv6, IN6_IS_ADDR_LOOPBACK ERR! check_str_ipv6, IN6_IS_ADDR_MULTICAST ERR! check_str_ipv6, The string_ipv6 form not accord with IPv6! is_stringipv6_multicast para error! is_stringipv6_multicast, IN6_IS_ADDR_MULTICAST ERR! is_stringipv6_multicast, IN6_IS_ADDR_MULTICAST! is_stringipv6_multicast, The string_ipv6 form not accord with IPv6! is_v6_addr_valid para error! is_v6_addr_valid, IN6_IS_ADDR_LOOPBACK ERR is_v6_addr_valid, IN6_IS_ADDR_MULTICAST ERR is_v6_addr_valid, IN6_IS_ADDR_LINKLOCAL ERR is_v6_addr_valid, IN6_IS_ADDR_UNSPECIFIED is_v6_mask_valid para error! uni_set_net_cfg: prefixlen:%d error is_v6_mask_valid err. the mask is all 1. is_v6_mask_valid error! is_v6_mask_valid error. IN6_IS_ADDR_UNSPECIFIED error! is_v6_addr_multicast para error! is_v6_addr_multicast, IN6_IS_ADDR_MULTICAST ERR is_v6_addr_multicast, IN6_IS_ADDR_UNSPECIFIED can not get verify addr type... ::/proc/net/wireless %X%dsocketget wifi status failed /proc/net/dev%u%u%u%u%u%u%u%u%u%u%u%u%u%u%u%u/etc/tempwlan0/etc/tempeth0w+nameserver %s 8.8.8.8wFailed to create %s: %mr+Write failed to %s: %mioctl SIOCDELRT errno: %s %02x:%02x:%02x:%02x:%02x:%02xopen file failed %d %63s%lx%lx%X%d%d%d%lx%d%d%d file length: %d error firmware write to sd card error ret %d---- retx %d pps requests get resp header value name is null lllllllllllllllll %dhttps%s:%s?&%s%s=%s%s %.*s%s HTTP/1.1 %s /%s HTTP/1.1 HostHost: %s User-AgentUser-Agent: %s ppsRequests/0.0.1Content-LengthContent-Length: %d PUTPOSTContent-TypeContent-Type: %s application/json%s: %s Connection: keep-alive fault 162 pps_requests_prepare net io connect failed: %d prepare requests failed: %d write failed!write 2 failed!read failed!HEADread 2 failed!GETDELETE://httphttpsrtsprtsps"P""*"Plength: %ld bytes=%d-%dRange: Content-LengthTransfer-Encoding: chunked888888888888888888888 9999999999999999 PUTPOSTrecv failed, error %d! recvsend/home/rzq/code/4.2.x_2/camera-app/network_ctrl/pps_net_manager/pps_net_manager_client.cCMD ack timeout NETWORK KEEPALIVE /tmp/netcli.sockbind failed! chmod failed! /tmp/netmng.socketconnect failed! SEVER close netmanager_client/proc/net/pps_wifi_check/wifi_run_starwifi_err/proc/net/pps_wifi_check/wifi_err_cntopen file failedecho reboot time: `date` > /home/cfg/patch_wifiwifi connect error ,reset deviceecho wifi error >> /home/cfg/patch_wifiwlan0echo wifi error and we patch it >> /home/cfg/patch_wificontinuous_error_inc_times inc: %d monitor_wlan_driverpps_net_get_wifi_states: [%d] busybox ping %s -w 6ping %s ret %d ping_error_cnt %d start to pps_net_wifi_reconnectAutoAd-HocManagedMasterRepeaterSecondaryMonitorUnknown/bugerror""""""""4phj obH\Sp| (DHLPTX\X)8 \) `)[ $)g ()@[ ,)_ 0)Y D) @)lX L) T) h)x j) l) n) p)t r)% t)G v)D |)W ~)W x){ z)K ) )$ ) )p ) 0) T     ( 0 xPu s8}  0 l t | ( ,  $ 4 @ T h t       $ 4 D X\ 0<,\,1++! w#!!!dlt|$!$!L|$!$!'|9!'9!'9!'$:!%'\:!&':!'':!.';!/'H;!1';!8';!9'$!g'@>!h't>!j'>!k'>!l'?!m'\?!'?!x4 LA!x#x4 lA!x#.@!) @! |@!,A!) A! @! xp!p!p!p!p! p!p!p! p!p! p!!@p0! @x0!p,!,!l8lh!8,0p!8(P, !! !,!!T!!!d!! !@!!(!X!!!! !@4!l!! !jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-B! +,6l6 6D6  CI@BADEFGHJLM!"#'$%&(1542369:;<>=?fghfgh#!'M<=h<dddd<`[|"t V^2This is not a bootable disk. Please insert a bootable floppy and press any key to try again ... K" /dsp/debug/xchdaynight/day/ /dsp/debug/xchdaynight/stop/ /dsp/debug/xchdaynight/night/ /dsp/debug/xchdaynight/auto/ /dsp/debug/xchdaynight/hdr/0//dsp/debug/xchdaynight/hdr/1//dsp/debug/invqe/off//dsp/debug/outvqe/off//dsp/debug/invqe/on/aecon//dsp/debug/invqe/on/aecoff//dsp/debug/outvqe/on//dsp/debug/outvol/openEffect//dsp/debug/outvol/closeEffect//dsp/debug/audio/vol/$(/dsp/debug/isp/other/48/dsp/debug/daynight/para/,0/dsp/debug/isp/ae/ /dsp/debug/isp/awb/DH/dsp/debug/isp/saturation//dsp/debug/isp/3dnr/ /dsp/debug/isp/ldc//dsp/debug/isp/defog//dsp/debug/isp/cross//dsp/debug/isp/framrate//dsp/debug/isp/ccm/@/dsp/debug/isp/csc/<p/dsp/debug/sysdebug//dsp/debug/sensorcheck/start/p/dsp/debug/sensorcheck/ready/ ##j&@qJUK@Yu4`x,5hZ4CUK 8 ::8@@p @@pEE` PP`UUP ppPuu8h7A>#### # ###(#p~,~{d<~}{@ @@@# Ԓ,l<,LpXx??##???"<"H"\"h"t"""""Т"""""4"L"{ FÓFE)4E EHEEERxE\E:E(EmwE=gEYEqqKE>E2E'EREE E3E}DD*D^DeD0D3DD3D= DD=~D}pD cD/VDJD?DR5DN+DV"DٮD7D DDͬCXCC[CyC3sC޴CҫCGC4CדCq]C#C.~CRqChfCLw[CQCFC=Cf&5C,C$CoRC-C`eCC CVBBB+B1BBfBR8BnBBBF6BD˓BBׇBGByBoB%fB\BTB!KBCB;B4B-BN&Bv BQBqBBo BGB!Ad;A+A|A+A'1A7A33A+AjAARAAAAd;A&AEAuAoAxwA"oAgAsh_AWAPAIA)\CA