Permalink
Find file
Fetching contributors…
Cannot retrieve contributors at this time
31924 lines (21664 sloc) 1020 KB
</
TBLASTX 2.2.23+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.
Database: ../../mf1.05b/assembly/mira/zoox2_assembly/zoox2_d_results/zoox2_
out.unpadded.fasta
81,537 sequences; 45,255,800 total letters
Query= kb8_rep_c1
Length=1551
Score E
Sequences producing significant alignments: (Bits) Value N
zoox2_c9705 626 0.0 3
zoox2_c13280 592 0.0 4
zoox2_rep_c54775 630 2e-180 1
zoox2_c20773 334 3e-168 3
zoox2_c7354 213 1e-157 7
zoox2_rep_c52668 182 1e-130 4
zoox2_rep_c59199 236 2e-116 3
zoox2_c19828 290 6e-107 4
zoox2_rep_c31983 366 4e-101 1
zoox2_s56556 270 2e-90 2
zoox2_c34779 127 4e-79 5
zoox2_s78027 292 9e-79 1
zoox2_s59544 226 2e-70 3
zoox2_rep_c78602 171 1e-66 3
zoox2_c20434 169 3e-63 3
zoox2_s68779 221 3e-57 1
zoox2_c22253 149 8e-55 3
zoox2_s66101 185 6e-53 2
zoox2_rep_c44965 132 4e-47 2
zoox2_rep_c47039 160 4e-41 2
zoox2_c20476 85.4 1e-40 3
zoox2_s71662 165 2e-40 1
zoox2_s78781 160 5e-39 1
zoox2_s52244 153 6e-37 1
zoox2_c19657 134 4e-31 1
zoox2_s50104 101 3e-21 1
zoox2_s62985 56.5 7e-18 2
zoox2_c19219 82.2 2e-15 1
zoox2_s68667 69.3 1e-11 1
zoox2_c19785 56.1 6e-09 2
zoox2_s56123 51.5 8e-08 2
zoox2_s80182 37.7 2e-07 2
zoox2_c7316 51.5 3e-06 1
> zoox2_c9705
Length=1640
Score = 626 bits (1361), Expect(3) = 0.0
Identities = 285/309 (92%), Positives = 298/309 (96%), Gaps = 0/309 (0%)
Frame = +3/+1
Query 591 TGKTSICIDTILNQKYRSVFTVYtslgqsssstlqVFLSLLQKDAIFYFSMLVATASSSA 770
TGKTSI +D+ILNQKY +VFTVYTSLGQSSSSTLQVFLSL+QKDAIFYFSMLVATASSSA
Sbjct 676 TGKTSISMDSILNQKYSAVFTVYTSLGQSSSSTLQVFLSLVQKDAIFYFSMLVATASSSA 855
Query 771 VCQYLCAYSGAALSEFFMITGEFPSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIF 950
VCQYLCAYSGAALSEFFMITGE PSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIF
Sbjct 856 VCQYLCAYSGAALSEFFMITGELPSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIF 1035
Query 951 FVHSRLLERSAKLSYNLGGGSLTSFPVIETLAGDLSGYISTNVISITDGQIALSADLFLS 1130
FVHSRLLERSAKLSYNLGGGSLT FP++ETLAGD+SGYISTN+ISITDGQIALSADLFLS
Sbjct 1036 FVHSRLLERSAKLSYNLGGGSLTCFPIVETLAGDVSGYISTNIISITDGQIALSADLFLS 1215
Query 1131 GIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLELAQFVELQSFSQFAADLGQESKNKLT 1310
GI PAIDVGLSVTRVGSA QWYGMKYVA SYKLELAQFVELQSFSQFA+DLGQESKN+LT
Sbjct 1216 GILPAIDVGLSVTRVGSAGQWYGMKYVAGSYKLELAQFVELQSFSQFASDLGQESKNRLT 1395
Query 1311 RGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLEALAVEDVRLFLNLYLDIPAWILLLV 1490
RGLRLVEMLKQSNGSPISLMGQVGILSLANQ LLEALAV+DV LFLNLYLDIP+WILLLV
Sbjct 1396 RGLRLVEMLKQSNGSPISLMGQVGILSLANQELLEALAVKDVGLFLNLYLDIPSWILLLV 1575
Query 1491 PPRLLGKSI 1517
PP L+ KSI
Sbjct 1576 PPSLVAKSI 1602
Score = 257 bits (556), Expect(3) = 0.0
Identities = 113/126 (89%), Positives = 117/126 (92%), Gaps = 0/126 (0%)
Frame = +3/+3
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 299
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL
Sbjct 222 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 401
Query 300 LNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPG 479
LNPENPLGQGS+V A ++LATI LGD AIASILDPVGN+IFNSGRIDV CPWAIESPAP
Sbjct 402 LNPENPLGQGSTVHALSSLATITLGDCAIASILDPVGNVIFNSGRIDVQCPWAIESPAPV 581
Query 480 IIDRQS 497
II S
Sbjct 582 IISSVS 599
Score = 64.3 bits (134), Expect(3) = 0.0
Identities = 25/27 (92%), Positives = 25/27 (92%), Gaps = 0/27 (0%)
Frame = +2/+2
Query 494 ICHRSIANRCYSYRFKYTNRMWSERIN 574
IC RSIANR YSYRFKYTNRMWSERIN
Sbjct 590 ICIRSIANRSYSYRFKYTNRMWSERIN 670
Score = 560 bits (1217), Expect(4) = 0.0
Identities = 251/271 (92%), Positives = 255/271 (94%), Gaps = 0/271 (0%)
Frame = -3/-1
Query 1402 *LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSSL 1223
*LANDNMPTCPIKLIGDPLDCFSISTSR PLVNLFLLSCPRS ANCENDCNSTN*ASSSL
Sbjct 1487 *LANDNMPTCPIKLIGDPLDCFSISTSRKPLVNLFLLSCPRSDANCENDCNSTN*ASSSL 1308
Query 1222 YEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEMTFVLM*PERSPA 1043
E ATYFIPYH* AEPTRVTDNPTSIAG IPDRNKSADKAI*PSVIEM FVLM*PE SPA
Sbjct 1307 *EPATYFIPYH*PAEPTRVTDNPTSIAGRIPDRNKSADKAI*PSVIEMIFVLM*PETSPA 1128
Query 1042 NVSITGKEVRLPPPRLYDNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRDK 863
NVS GK+VRLPPPRLYDN ADLSKSRE TKNISPG*ASLPAGLLNRRYISL*A A RDK
Sbjct 1127 NVSTIGKQVRLPPPRLYDNFADLSKSRECTKNISPG*ASLPAGLLNRRYISL*AQAWRDK 948
Query 862 SSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRVL 683
SSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFC RDRKTCRVL
Sbjct 947 SSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCTRDRKTCRVL 768
Query 682 DEL*PREV*TVNTDLYF*LRIVSMQMDVLPV 590
DEL*PREV*TVNT LYF*LR++SM+MDVLPV
Sbjct 767 DEL*PREV*TVNTALYF*LRMLSMEMDVLPV 675
Score = 239 bits (517), Expect(4) = 0.0
Identities = 105/122 (86%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
Frame = -2/-1
Query 485 NYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CTHT*TLTKRIFR 306
+Y WSR FY PRA +IDST*IKN ITHWI*N SYC VS* DGG* +*C +*TLTKRIFR
Sbjct 587 DYNWSRRFYSPRALHIDST*IKNNITHWI*NGSYCTVS*GDGG**T*CMDS*TLTKRIFR 408
Query 305 IKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVL 126
IKQ* TNKKIHCVISIKIY KTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVL
Sbjct 407 IKQ*GTNKKIHCVISIKIYNKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVL 228
Query 125 FN 120
FN
Sbjct 227 FN 222
Score = 58.3 bits (121), Expect(4) = 0.0
Identities = 25/27 (92%), Positives = 25/27 (92%), Gaps = 0/27 (0%)
Frame = -3/-2
Query 574 INSL*PHPIGILESIAITPVCNASVTD 494
INSL*PHPIGILESIAI PVCNAS TD
Sbjct 670 INSL*PHPIGILESIAIRPVCNASDTD 590
Score = 42.3 bits (86), Expect(4) = 0.0
Identities = 16/21 (76%), Positives = 17/21 (80%), Gaps = 0/21 (0%)
Frame = -3/-1
Query 1522 HTIDFPSNLGGTNNKIHAGIS 1460
HTID + LGGTNNKIH GIS
Sbjct 1607 HTIDLATRLGGTNNKIHEGIS 1545
Score = 427 bits (927), Expect(5) = 0.0
Identities = 182/215 (84%), Positives = 189/215 (87%), Gaps = 0/215 (0%)
Frame = +2/+3
Query 590 DR*NIHLHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFIC 769
DR*NIHLH P*SKV* IHCLHLSWSKLIKHSTSLSI TKRCYLLLLNARG+SQFIC
Sbjct 675 DR*NIHLHG*HP*SKV*RRIHCLHLSWSKLIKHSTSLSIPCTKRCYLLLLNARGHSQFIC 854
Query 770 CLSILMCL*RCSFV*ILYDNW*ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNI 949
CLSILMCL* C FV*ILYDNW*I+F AYT**FIS C+CL*RNIPPIEKTSWKRSLSRRNI
Sbjct 855 CLSILMCL*WCCFV*ILYDNW*IAFLAYT**FISPCLCL*RNIPPIEKTSWKRSLSRRNI 1034
Query 950 LCPFSTFRKVCQVIIQSWWG*SYFFPSY*NISRRSFWLHKHKCHLNY*WSNSFICRLISI 1129
LC FSTFRKVC+VIIQSWW * Y FP+ *NISRR F LHKHK HL Y*WSNSFICRLISI
Sbjct 1035 LCAFSTFRKVCKVIIQSWWW*PYLFPNC*NISRRCFRLHKHKYHLYY*WSNSFICRLISI 1214
Query 1130 WNSTSYRCRIICNTCGFCSSMVWNEICGSFV*ARA 1234
S+SYRC IICNTCGFC SMVWNEICG +*ARA
Sbjct 1215 RYSSSYRCWIICNTCGFCRSMVWNEICGRLL*ARA 1319
Score = 221 bits (477), Expect(5) = 0.0
Identities = 106/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
Frame = +1/+1
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*IFLL 288
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL *IFIEMTQ*IFLL
Sbjct 211 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVLL*IFIEMTQ*IFLL 390
Query 289 VLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NP 468
V YCLIRKILLVKVQ+ +H +H*PPS *ET+Q*L F*IQWV+ FLIQVESM +ALG *N
Sbjct 391 VPYCLIRKILLVKVQLSMH*VH*PPSP*ETVQ*LPF*IQWVMLFLIQVESMCSALGL*NL 570
Query 469 LLQV* 483
LLQ+*
Sbjct 571 LLQL* 585
Score = 82.2 bits (173), Expect(5) = 0.0
Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
Frame = +2/+3
Query 1292 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 1393
KQE*INKR+TTCRNAKTIQWISNK NGTSWHIVI
Sbjct 1377 KQE*INKRLTTCRNAKTIQWISNKLNGTSWHIVI 1478
Score = 61.1 bits (127), Expect(5) = 0.0
Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
Frame = +3/+3
Query 471 APGIIDRQSVTEALQTGVIAIDSSIPIGCGQRELIL 578
+P + SV+EALQTG+IAIDSSIPIGCGQRELI+
Sbjct 567 SPAPVIISSVSEALQTGLIAIDSSIPIGCGQRELIV 674
Score = 55.1 bits (114), Expect(5) = 0.0
Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
Frame = +1/+2
Query 1432 MYASFSISILIYLHGFYY*FHQGY*ENLLC 1521
M ASFSISILIYLHGFYY*FH * NLLC
Sbjct 1517 M*ASFSISILIYLHGFYY*FHLVL*LNLLC 1606
Score = 564 bits (1226), Expect(3) = 0.0
Identities = 266/311 (85%), Positives = 277/311 (89%), Gaps = 0/311 (0%)
Frame = -1/-2
Query 1521 TQ*IFLVTLVELIIKSMQVYQDRD*ERGVHLQLLKLLEDFD*LMTICQLVPLNLLEIHWI 1342
TQ*I L VELIIKSM+VYQDRD*ERG+HL LLKLLE D*LMTICQLVPL+LLEIHWI
Sbjct 1606 TQ*I*LQD*VELIIKSMKVYQDRD*ERGLHL*LLKLLEALD*LMTICQLVPLSLLEIHWI 1427
Query 1341 VLAFLQVVILLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNPhvlq 1162
VLAFLQVV LLLIYSCFL LDQ+QIVRMIVIQQIEQALAY LPHISFHTI+LQNPHVLQ
Sbjct 1426 VLAFLQVVSLLLIYSCFLALDQMQIVRMIVIQQIEQALAYKSLPHISFHTIDLQNPHVLQ 1247
Query 1161 iilhl*lVEFQIEISLQIKLFDHQ*LR*HLCLCSQKDLLLMFQ*LGKK*DYPHQDCMITW 982
II HL*L E+ IEISLQIKLFDHQ* R*+LCLCS K LLLMFQ LG K* Y HQDCMIT
Sbjct 1246 IIQHL*LEEYLIEISLQIKLFDHQ**R*YLCLCSLKHLLLMFQQLGNK*GYHHQDCMITL 1067
Query 981 QTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*AKKEIHQLS*RIQTKL 802
QTFLKVEN QRIFLLDKLLFQLVFSIGGIFLYKH H EINHQV*A+K IHQLS*RIQTK
Sbjct 1066 QTFLKVENAQRIFLLDKLLFQLVFSIGGIFLYKHKHGEINHQV*ARKAIHQLS*RIQTKQ 887
Query 801 HRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQERCRQ*IQTYTFD*G 622
H YKHISIDRQQMNWL PRALRSRR*HLFV+ IERLVECLMSFDQERCRQ*I+ YTFD*G
Sbjct 886 HHYKHISIDRQQMNWLWPRALRSRR*HLFVQGIERLVECLMSFDQERCRQ*IRRYTFD*G 707
Query 621 SYLCKWMFYLS 589
Y +WMFYLS
Sbjct 706 CYPWRWMFYLS 674
Score = 152 bits (327), Expect(3) = 0.0
Identities = 77/93 (82%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
Frame = -1/-3
Query 495 IVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLDQE 316
I +L LEQ IL PKG+ HRFYLN*K* YPLDLE KLL SLLG*WWLV LMH LNLDQE
Sbjct 597 IQMRL*LEQEIL*PKGTAHRFYLN*K*HYPLDLEWKLLHSLLG*WWLVNLMHGQLNLDQE 418
Query 315 DFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 217
DFPD*AI+HQ*EDSLCHLDKDL QDQWRSFVW*
Sbjct 417 DFPD*AIRHQ*EDSLCHLDKDLQQDQWRSFVW* 319
Score = 55.1 bits (114), Expect(3) = 0.0
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-2
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 343 PMEELCVVKTSEMNAINNPSNV 278
Score = 528 bits (1147), Expect(2) = 9e-180
Identities = 270/310 (87%), Positives = 279/310 (90%), Gaps = 0/310 (0%)
Frame = -2/-3
Query 1520 HNRFS**PWWN***NPCRYikieiekEAYIFNC*SF*KILIS**QYANLSH*TYWRSIGL 1341
HNRFS WN***NP RYIKIEIEKEAYIFNC*SF*K+LIS**QYANLSH* YWRSIGL
Sbjct 1605 HNRFSYKTRWN***NP*RYIKIEIEKEAYIFNC*SF*KLLIS**QYANLSH*AYWRSIGL 1426
Query 1340 F*HFYKS*SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCRTHTCYR 1161
F*HFYKS*+SC* ILAFL *I CKL*E*L*FNKLSKL*LIR+CHIFHSIPL+CRTHTCYR
Sbjct 1425 F*HFYKS*ASC*SILAFLP*IRCKL*E*L*FNKLSKL*LIRACHIFHSIPLTCRTHTCYR 1246
Query 1160 *SYIYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC*CFNNWERSKTTPTKIV**LG 981
*S IYSW N+ *K*VCR*SYLTISN DDICAYVA ISC*CFNNWE SK T TKIV**L
Sbjct 1245 *SNIYSWKNT**K*VCR*SYLTISNRDDICAYVA*NISC*CFNNWETSKATTTKIV**LC 1066
Query 980 RPF*KSRMDKEYfswisfssswsSQ*EVYFSISTCMSR*IIKYKQRRKFTSYHKEFRQSC 801
RPF*KSRM KEYFSWISFSSSWSSQ*EVYFSIST M+R*IIKYKQ R+FTSYHKEFRQS
Sbjct 1065 RPF*KSRMHKEYFSWISFSSSWSSQ*EVYFSISTSMAR*IIKYKQGRQFTSYHKEFRQSS 886
Query 800 TAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRGVDSEYRPILLIKD 621
T IST*VLTDSR*TGC HEH*EVEDSIFL K *KDL*SA**ALTKRGVDSEY ILLIKD
Sbjct 885 TTIST*VLTDSR*TGCGHEH*EVEDSIFLYKG*KDL*SA**ALTKRGVDSEYGAILLIKD 706
Query 620 RIYANGCFTC 591
I+ +GCFTC
Sbjct 705 AIHGDGCFTC 676
Score = 121 bits (259), Expect(2) = 9e-180
Identities = 54/73 (73%), Positives = 62/73 (84%), Gaps = 0/73 (0%)
Frame = -3/-2
Query 505 SVTDCLSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMVASVADARTLEP 326
+ +D II GAGDSIAQG TSILPELK+ LPTGSR+EAIA+SPR+MVAS +A T+EP
Sbjct 607 NASDTDEIITGAGDSIAQGHCTSILPELKITLPTGSRMEAIAQSPRVMVASELNAWTVEP 428
Query 325 *PRGFSGLSNKAP 287
*PRGFSGLSNKAP
Sbjct 427 *PRGFSGLSNKAP 389
Score = 199 bits (428), Expect(7) = 1e-175
Identities = 104/122 (85%), Positives = 108/122 (88%), Gaps = 0/122 (0%)
Frame = +1/+2
Query 859 MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYHTIlvgvvlllsqllK 1038
MIYL M VLIEKYTSY*EDQLEEKLIQEKYSL ILDF*KGL SYHTILV V LL+SQLLK
Sbjct 944 MIYLAMLVLIEKYTSY*EDQLEEKLIQEKYSLCILDF*KGLQSYHTILVVVALLVSQLLK 1123
Query 1039 H*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQL 1218
H*QE+F AT*AQ+SS LLMVK*LYLQTYFY F QL*M DYL*HVWVLQ+NGME*NMWQ
Sbjct 1124 H*QEMFQAT*AQISSLLLMVK*LYLQTYFYQVFFQL*MLDYL*HVWVLQVNGME*NMWQA 1303
Query 1219 RI 1224
I
Sbjct 1304 LI 1309
Score = 177 bits (382), Expect(7) = 1e-175
Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
Frame = +2/+2
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNESSYWC 292
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC KSLSR*HNESSYWC
Sbjct 215 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCCKSLSR*HNESSYWC 394
Query 293 FIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
IA*SGKSSWSRF C CI +TSHHHPRRLCN
Sbjct 395 LIA*SGKSSWSRFNCPCIKFTSHHHPRRLCN 487
Score = 135 bits (289), Expect(7) = 1e-175
Identities = 60/70 (85%), Positives = 60/70 (85%), Gaps = 0/70 (0%)
Frame = +1/+2
Query 592 QVKHPFA*IRSLIKSIGLYSLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLL 771
QVKHP I SLIKSI YSLSTPLLVKAHQALYKSFY YKKMLSSTSQCSW QPVHLL
Sbjct 677 QVKHPSPWIASLIKSIAPYSLSTPLLVKAHQALYKSFYPLYKKMLSSTSQCSWPQPVHLL 856
Query 772 SVNTYVLIAV 801
SVNTYVLI V
Sbjct 857 SVNTYVLIVV 886
Score = 79.0 bits (166), Expect(7) = 1e-175
Identities = 35/39 (89%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
Frame = +1/+2
Query 1279 I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 1395
I* KKARI+*QE YDL*KC*NNPMDLQ* *WDKLAYCH*
Sbjct 1364 I*GKKARID*QEAYDL*KC*NNPMDLQ*A*WDKLAYCH* 1480
Score = 55.6 bits (115), Expect(7) = 1e-175
Identities = 26/29 (89%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
Frame = +1/+1
Query 493 NLSQKHCKQVL*L*IQVYQ*DVVREN*FL 579
+L QKHCKQVL*L*IQVYQ*DVVREN* L
Sbjct 589 HLYQKHCKQVL*L*IQVYQ*DVVREN*LL 675
Score = 49.2 bits (101), Expect(7) = 1e-175
Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 0/30 (0%)
Frame = +2/+3
Query 1433 CTPLSQSLS*YTCMDFIISSTKVTRKIYCV 1522
C PLSQSLS*YT MDFIISST IYCV
Sbjct 1518 CRPLSQSLS*YTFMDFIISST*SCS*IYCV 1607
Score = 36.3 bits (73), Expect(7) = 1e-175
Identities = 14/19 (73%), Positives = 15/19 (78%), Gaps = 0/19 (0%)
Frame = +2/+2
Query 428 R*NRCKLPLGDRIPCSRYN 484
R*NRC +PLG RI CS YN
Sbjct 530 R*NRCAVPLGYRISCSSYN 586
> zoox2_c13280
Length=1353
Score = 592 bits (1287), Expect(4) = 0.0
Identities = 271/291 (93%), Positives = 282/291 (96%), Gaps = 0/291 (0%)
Frame = +3/+1
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 299
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL
Sbjct 37 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 216
Query 300 LNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPG 479
LNPENPLGQGS+V A ++LATI LGD AIASILDPVGN+IFNSGRIDV CPWAIESPAPG
Sbjct 217 LNPENPLGQGSTVHALSSLATITLGDCAIASILDPVGNVIFNSGRIDVQCPWAIESPAPG 396
Query 480 IIDRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGKTSICIDTILNQKYRSVFTVY 659
IIDRQSV+EALQTG+IAIDSSIPIGCGQRELI+GDRQTGKTSI +D+ILNQKY +VFTVY
Sbjct 397 IIDRQSVSEALQTGLIAIDSSIPIGCGQRELIVGDRQTGKTSISMDSILNQKYSAVFTVY 576
Query 660 tslgqsssstlqVFLSLLQKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEFFMITGEF 839
TSLGQSSSSTLQVFLSL+QKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEFFMITGE
Sbjct 577 TSLGQSSSSTLQVFLSLVQKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEFFMITGEL 756
Query 840 PSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLS 992
PSLLILDDLSRHACAYR IYLLLRRPAGREAYPGEIFFVHSRLLERSAKLS
Sbjct 757 PSLLILDDLSRHACAYR*IYLLLRRPAGREAYPGEIFFVHSRLLERSAKLS 909
Score = 227 bits (490), Expect(4) = 0.0
Identities = 101/107 (94%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
Frame = +3/+3
Query 1077 VISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLELAQFVELQ 1256
VISITDGQIALSADLFLSGI PAIDVGLSVTRVGSA QWYGMKYVA SYKLELAQFVELQ
Sbjct 906 VISITDGQIALSADLFLSGILPAIDVGLSVTRVGSAGQWYGMKYVAGSYKLELAQFVELQ 1085
Query 1257 SFSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLA 1397
SFSQFA+DLGQESKN+LTRGLRLVEMLKQSNGSPIS MGQVGILSLA
Sbjct 1086 SFSQFASDLGQESKNRLTRGLRLVEMLKQSNGSPISSMGQVGILSLA 1226
Score = 58.3 bits (121), Expect(4) = 0.0
Identities = 23/30 (76%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
Frame = +3/+1
Query 1398 NQNLLEALAVEDVRLFLNLYLDIPAWILLL 1487
NQ LLEALAV+DV LFLNLYLDIP+WI ++
Sbjct 1228 NQELLEALAVKDVGLFLNLYLDIPSWIFII 1317
Score = 25.8 bits (50), Expect(4) = 0.0
Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
Frame = +1/+3
Query 1477 FYY*FHQGY*ENLLC 1521
FYY*FH * NLLC
Sbjct 1308 FYY*FHLVL*LNLLC 1352
Score = 297 bits (643), Expect(5) = 0.0
Identities = 127/147 (86%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
Frame = -1/-3
Query 993 MITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*AKKEIHQLS*RI 814
M T QTFLKVEN QRIFLLDKLLFQLVFSIGGIF+YKH H EINHQV*A+K IHQLS*RI
Sbjct 910 MTTLQTFLKVENAQRIFLLDKLLFQLVFSIGGIFIYKHKHGEINHQV*ARKAIHQLS*RI 731
Query 813 QTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQERCRQ*IQTYT 634
QTK H YKHISIDRQQMNWL PRALRSRR*HLFV+ IERLVECLMSFDQERCRQ*I+ YT
Sbjct 730 QTKQHHYKHISIDRQQMNWLWPRALRSRR*HLFVQGIERLVECLMSFDQERCRQ*IRRYT 551
Query 633 FD*GSYLCKWMFYLSDDHQELILSDHI 553
FD*G Y +WMFYLSDDHQ+LILSDHI
Sbjct 550 FD*GCYPWRWMFYLSDDHQQLILSDHI 470
Score = 261 bits (565), Expect(5) = 0.0
Identities = 115/133 (86%), Positives = 118/133 (88%), Gaps = 0/133 (0%)
Frame = -2/-1
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT 339
CLQCF RL VNYTWSR FY PRA +IDST*IKN ITHWI*N SYC VS* DGG* +*C
Sbjct 435 CLQCF*YRLPVNYTWSRRFYSPRALHIDST*IKNNITHWI*NGSYCTVS*GDGG**T*CM 256
Query 338 HT*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN 159
+*TLTKRIFRIKQ* TNKKIHCVISIKIY KTNGGALCGKNL*DECH**SF*CDYSTTN
Sbjct 255 DS*TLTKRIFRIKQ*GTNKKIHCVISIKIYNKTNGGALCGKNL*DECH**SF*CDYSTTN 76
Query 158 *DYNSIN*NVLFN 120
*DYNSIN*NVLFN
Sbjct 75 *DYNSIN*NVLFN 37
Score = 237 bits (511), Expect(5) = 0.0
Identities = 101/108 (93%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
Frame = -3/-3
Query 1399 LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSSLY 1220
LANDNMPTCPI+LIGDPLDCFSISTSR PLVNLFLLSCPRS ANCENDCNSTN*ASSSL
Sbjct 1228 LANDNMPTCPIELIGDPLDCFSISTSRKPLVNLFLLSCPRSDANCENDCNSTN*ASSSL* 1049
Query 1219 EAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEMT 1076
E ATYFIPYH* AEPTRVTDNPTSIAG IPDRNKSADKAI*PSVIEMT
Sbjct 1048 EPATYFIPYH*PAEPTRVTDNPTSIAGRIPDRNKSADKAI*PSVIEMT 905
Score = 50.6 bits (104), Expect(5) = 0.0
Identities = 22/27 (81%), Positives = 24/27 (88%), Gaps = 0/27 (0%)
Frame = -1/-3
Query 1479 KSMQVYQDRD*ERGVHLQLLKLLEDFD 1399
KSM+VYQDRD*ERG+HL LLKLLE D
Sbjct 1309 KSMKVYQDRD*ERGLHL*LLKLLEALD 1229
Score = 30.9 bits (61), Expect(5) = 0.0
Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
Frame = -3/-1
Query 1522 HTIDFPSNLGGTNNK 1478
HTID + LGGTNNK
Sbjct 1353 HTIDLATRLGGTNNK 1309
Score = 380 bits (823), Expect(6) = 0.0
Identities = 163/189 (86%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
Frame = +2/+3
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR*NIH 607
R*NRC +PLG RI CSRYN*Q IC RSIANR YSYRFKYTNRMWSERIN W*SSDR*NIH
Sbjct 345 R*NRCAVPLGYRISCSRYN*QAICIRSIANRSYSYRFKYTNRMWSERINCW*SSDR*NIH 524
Query 608 LHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFICCLSILM 787
LH P*SKV* IHCLHLSWSKLIKHSTSLSI TKRCYLLLLNARG+SQFICCLSILM
Sbjct 525 LHG*HP*SKV*RRIHCLHLSWSKLIKHSTSLSIPCTKRCYLLLLNARGHSQFICCLSILM 704
Query 788 CL*RCSFV*ILYDNW*ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNILCPFST 967
CL* C FV*ILYDNW*I+F AYT**FIS C+CL* NIPPIEKTSWKRSLSRRNILC FST
Sbjct 705 CL*WCCFV*ILYDNW*IAFLAYT**FISPCLCL*INIPPIEKTSWKRSLSRRNILCAFST 884
Query 968 FRKVCQVII 994
FRKVC+V+I
Sbjct 885 FRKVCKVVI 911
Score = 177 bits (382), Expect(6) = 0.0
Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
Frame = +2/+3
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNESSYWC 292
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC KSLSR*HNESSYWC
Sbjct 30 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCCKSLSR*HNESSYWC 209
Query 293 FIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
IA*SGKSSWSRF C CI +TSHHHPRRLCN
Sbjct 210 LIA*SGKSSWSRFNCPCIKFTSHHHPRRLCN 302
Score = 115 bits (245), Expect(6) = 0.0
Identities = 45/53 (84%), Positives = 47/53 (88%), Gaps = 0/53 (0%)
Frame = +2/+2
Query 1076 CHLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMVWNEICGSFV*ARA 1234
CHL Y*WSNSFICRLISI S+SYRC IICNTCGFC SMVWNEICG F+*ARA
Sbjct 905 CHLYY*WSNSFICRLISIRYSSSYRCWIICNTCGFCRSMVWNEICGRFL*ARA 1063
Score = 82.2 bits (173), Expect(6) = 0.0
Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
Frame = +2/+2
Query 1292 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 1393
KQE*INKR+TTCRNAKTIQWISNK NGTSWHIVI
Sbjct 1121 KQE*INKRLTTCRNAKTIQWISNKLNGTSWHIVI 1222
Score = 35.0 bits (70), Expect(6) = 0.0
Identities = 15/16 (93%), Positives = 15/16 (93%), Gaps = 0/16 (0%)
Frame = +1/+2
Query 1432 MYASFSISILIYLHGF 1479
M ASFSISILIYLHGF
Sbjct 1262 M*ASFSISILIYLHGF 1309
Score = 24.4 bits (47), Expect(6) = 0.0
Identities = 10/13 (76%), Positives = 11/13 (84%), Gaps = 0/13 (0%)
Frame = +3/+2
Query 1479 LLLVPPRLLGKSI 1517
LLLVPP L+ KSI
Sbjct 1310 LLLVPPSLVAKSI 1348
Score = 460 bits (998), Expect(4) = 0.0
Identities = 210/235 (89%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
Frame = -3/-2
Query 991 DNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRDKSSSISKEGNSPVIIKNS 812
DN ADLSKSRE TKNISPG*ASLPAGLLNRRYI L*A A RDKSSSISKEGNSPVIIKNS
Sbjct 908 DNFADLSKSRECTKNISPG*ASLPAGLLNRRYIYL*AQAWRDKSSSISKEGNSPVIIKNS 729
Query 811 DKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRVLDEL*PREV*TVNTDLYF 632
DKAAPL*AHKY*QTADELAVATSIEK*KIASFC RDRKTCRVLDEL*PREV*TVNT LYF
Sbjct 728 DKAAPL*AHKY*QTADELAVATSIEK*KIASFCTRDRKTCRVLDEL*PREV*TVNTALYF 549
Query 631 *LRIVSMQMDVLPV*RSPRINSL*PHPIGILESIAITPVCNASVTDCLSIIPGAGDSIAQ 452
*LR++SM+MDVLPV*RSP INSL*PHPIGILESIAI PVCNAS TDCLSIIPGAGDSIAQ
Sbjct 548 *LRMLSMEMDVLPV*RSPTINSL*PHPIGILESIAIRPVCNASDTDCLSIIPGAGDSIAQ 369
Query 451 GQLTSILPELKMRLPTGSRIEAIAESPRMMVASVADARTLEP*PRGFSGLSNKAP 287
G TSILPELK+ LPTGSR+EAIA+SPR+MVAS +A T+EP*PRGFSGLSNKAP
Sbjct 368 GHCTSILPELKITLPTGSRMEAIAQSPRVMVASELNAWTVEP*PRGFSGLSNKAP 204
Score = 191 bits (411), Expect(4) = 0.0
Identities = 97/110 (88%), Positives = 101/110 (91%), Gaps = 0/110 (0%)
Frame = -1/-1
Query 1398 *LMTICQLVPLNLLEIHWIVLAFLQVVILLLIYSCFLVLDQLQIVRMIVIQQIEQALAYT 1219
*LMTICQLVPL+LLEIHWIVLAFLQVV LLLIYSCFL LDQ+QIVRMIVIQQIEQALAY
Sbjct 1227 *LMTICQLVPLSLLEIHWIVLAFLQVVSLLLIYSCFLALDQMQIVRMIVIQQIEQALAYK 1048
Query 1218 KLPHISFHTIELQNPhvlqiilhl*lVEFQIEISLQIKLFDHQ*LR*HLC 1069
LPHISFHTI+LQNPHVLQII HL*L E+ IEISLQIKLFDHQ* R* LC
Sbjct 1047 NLPHISFHTIDLQNPHVLQIIQHL*LEEYLIEISLQIKLFDHQ**R*QLC 898
Score = 55.1 bits (114), Expect(4) = 0.0
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-2
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 158 PMEELCVVKTSEMNAINNPSNV 93
Score = 37.7 bits (76), Expect(4) = 0.0
Identities = 25/27 (92%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
Frame = -2/-1
Query 1478 NPCRYikieiekEAYIFNC*SF*KILI 1398
NP RYIKIEIEKEAYIFNC*SF*K+LI
Sbjct 1308 NP*RYIKIEIEKEAYIFNC*SF*KLLI 1228
Score = 421 bits (914), Expect(5) = 1e-180
Identities = 200/231 (86%), Positives = 207/231 (89%), Gaps = 0/231 (0%)
Frame = +1/+2
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*IFLL 288
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL *IFIEMTQ*IFLL
Sbjct 26 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVLL*IFIEMTQ*IFLL 205
Query 289 VLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NP 468
V YCLIRKILLVKVQ+ +H +H*PPS *ET+Q*L F*IQWV+ FLIQVESM +ALG *N
Sbjct 206 VPYCLIRKILLVKVQLSMH*VH*PPSP*ETVQ*LPF*IQWVMLFLIQVESMCSALGL*NL 385
Query 469 LLQV*LTDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQVKHPFA*IRSLIKSIGLY 648
LLQV*LT NL QKHCKQVL*L*IQVYQ*DVVREN* LVIVRQVKHP I SLIKSI Y
Sbjct 386 LLQV*LTGNLYQKHCKQVL*L*IQVYQ*DVVREN*LLVIVRQVKHPSPWIASLIKSIAPY 565
Query 649 SLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLSVNTYVLIAV 801
SLSTPLLVKAHQALYKSFY YKKMLSSTSQCSW QPVHLLSVNTYVLI V
Sbjct 566 SLSTPLLVKAHQALYKSFYPLYKKMLSSTSQCSWPQPVHLLSVNTYVLIVV 718
Score = 94.1 bits (199), Expect(5) = 1e-180
Identities = 42/52 (80%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
Frame = +1/+1
Query 1069 AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQLRI 1224
A++SS LLMVK*LYLQTYFY F QL*M DYL*HVWVLQ+NGME*NMWQ+ I
Sbjct 898 AKLSSLLLMVK*LYLQTYFYQVFFQL*MLDYL*HVWVLQVNGME*NMWQVLI 1053
Score = 85.4 bits (180), Expect(5) = 1e-180
Identities = 39/45 (86%), Positives = 40/45 (88%), Gaps = 0/45 (0%)
Frame = +1/+2
Query 859 MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYH 993
MIYL M VLI+KYTSY*EDQLEEKLIQEKYSL ILDF*KGL S H
Sbjct 776 MIYLAMLVLIDKYTSY*EDQLEEKLIQEKYSLCILDF*KGLQSCH 910
Score = 76.7 bits (161), Expect(5) = 1e-180
Identities = 34/39 (87%), Positives = 35/39 (89%), Gaps = 0/39 (0%)
Frame = +1/+1
Query 1279 I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 1395
I* KKARI+*QE YDL*KC*NNPMDLQ* WDKLAYCH*
Sbjct 1108 I*GKKARID*QEAYDL*KC*NNPMDLQ*AQWDKLAYCH* 1224
Score = 34.1 bits (68), Expect(5) = 1e-180
Identities = 14/16 (87%), Positives = 14/16 (87%), Gaps = 0/16 (0%)
Frame = +2/+3
Query 1433 CTPLSQSLS*YTCMDF 1480
C PLSQSLS*YT MDF
Sbjct 1263 CRPLSQSLS*YTFMDF 1310
Score = 227 bits (491), Expect(2) = 3e-103
Identities = 121/140 (86%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
Frame = -2/-1
Query 986 LGRPF*KSRMDKEYfswisfssswsSQ*EVYFSISTCMSR*IIKYKQRRKFTSYHKEFRQ 807
L RPF*KSRM KEYFSWISFSSSWSSQ*EVY SIST M+R*IIKYKQ R+FTSYHKEFRQ
Sbjct 903 LCRPF*KSRMHKEYFSWISFSSSWSSQ*EVYLSISTSMAR*IIKYKQGRQFTSYHKEFRQ 724
Query 806 SCTAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRGVDSEYRPILLI 627
S T IST*VLTDSR*TGC HEH*EVEDSIFL K *KDL*SA**ALTKRGVDSEY ILLI
Sbjct 723 SSTTIST*VLTDSR*TGCGHEH*EVEDSIFLYKG*KDL*SA**ALTKRGVDSEYGAILLI 544
Query 626 KDRIYANGCFTCLTITKN*F 567
KD I+ +GCFTCLTIT N*F
Sbjct 543 KDAIHGDGCFTCLTITNN*F 484
Score = 167 bits (359), Expect(2) = 3e-103
Identities = 81/94 (86%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
Frame = -1/-3
Query 498 QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLDQ 319
QI CQLYLEQ IL PKG+ HRFYLN*K* YPLDLE KLL SLLG*WWLV LMH LNLDQ
Sbjct 415 QIACQLYLEQEIL*PKGTAHRFYLN*K*HYPLDLEWKLLHSLLG*WWLVNLMHGQLNLDQ 236
Query 318 EDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 217
EDFPD*AI+HQ*EDSLCHLDKDL QDQWRSFVW*
Sbjct 235 EDFPD*AIRHQ*EDSLCHLDKDLQQDQWRSFVW* 134
Score = 210 bits (453), Expect = 5e-54
Identities = 97/118 (82%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
Frame = -2/-2
Query 1397 S**QYANLSH*TYWRSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIR 1218
S**QYANLSH* YWRSIGLF*HFYKS*+SC* ILAFL *I CKL*E*L*FNKLSKL*LIR
Sbjct 1226 S**QYANLSH*AYWRSIGLF*HFYKS*ASC*SILAFLP*IRCKL*E*L*FNKLSKL*LIR 1047
Query 1217 SCHIFHSIPLSCRTHTCYR*SYIYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC 1044
+CHIFHSIPL+CRTHTCYR*S IYSW N+ *K*VCR*SYLTISN DD A +++ C
Sbjct 1046 TCHIFHSIPLTCRTHTCYR*SNIYSWKNT**K*VCR*SYLTISNRDDNFADLSKSREC 873
> zoox2_rep_c54775
Length=900
Score = 630 bits (1369), Expect = 2e-180
Identities = 290/293 (98%), Positives = 291/293 (99%), Gaps = 0/293 (0%)
Frame = -1/-3
Query 1533 KTHSTQ*IFLVTLVELIIKSMQVYQDRD*ERGVHLQLLKLLEDFD*LMTICQLVPLNLLE 1354
KT STQ*I LVTLVELIIKSMQVYQDRD*ERGVHLQLLKLLEDFD*LMTICQLVPLNLLE
Sbjct 880 KTXSTQ*ISLVTLVELIIKSMQVYQDRD*ERGVHLQLLKLLEDFD*LMTICQLVPLNLLE 701
Query 1353 IHWIVLAFLQVVILLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNP 1174
IHWIVLAFLQVVILLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNP
Sbjct 700 IHWIVLAFLQVVILLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNP 521
Query 1173 hvlqiilhl*lVEFQIEISLQIKLFDHQ*LR*HLCLCSQKDLLLMFQ*LGKK*DYPHQDC 994
HVLQIILHL*LVEFQIEISLQIKLFDHQ*LR*HLCLCSQKDLLLMFQ*LGKK*DYPHQDC
Sbjct 520 HVLQIILHL*LVEFQIEISLQIKLFDHQ*LR*HLCLCSQKDLLLMFQ*LGKK*DYPHQDC 341
Query 993 MITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*AKKEIHQLS*RI 814
MITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*AKKEIHQLS*RI
Sbjct 340 MITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*AKKEIHQLS*RI 161
Query 813 QTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQERCR 655
QTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQERC+
Sbjct 160 QTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQERCK 2
Score = 613 bits (1333), Expect = 2e-175
Identities = 271/274 (98%), Positives = 271/274 (98%), Gaps = 0/274 (0%)
Frame = +3/+1
Query 696 VFLSLLQKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEFFMITGEFPSLLILDDLSRH 875
VFLSLLQKDAIFYFSMLVATASSSAV QYLCAYSGAALSEFFMI GEFPSLLILDDLSRH
Sbjct 43 VFLSLLQKDAIFYFSMLVATASSSAVXQYLCAYSGAALSEFFMIXGEFPSLLILDDLSRH 222
Query 876 ACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGGSLTSFPVIETLAGDL 1055
ACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGGSLTSFPVIETLAGDL
Sbjct 223 ACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGGSLTSFPVIETLAGDL 402
Query 1056 SGYISTNVISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLEL 1235
SGYISTNVISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLEL
Sbjct 403 SGYISTNVISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLEL 582
Query 1236 AQFVELQSFSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLE 1415
AQFVELQSFSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLE
Sbjct 583 AQFVELQSFSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLE 762
Query 1416 ALAVEDVRLFLNLYLDIPAWILLLVPPRLLGKSI 1517
ALAVEDVRLFLNLYLDIPAWILLLVPPRLL KSI
Sbjct 763 ALAVEDVRLFLNLYLDIPAWILLLVPPRLLXKSI 864
Score = 477 bits (1035), Expect(3) = 2e-174
Identities = 193/193 (100%), Positives = 193/193 (100%), Gaps = 0/193 (0%)
Frame = +2/+3
Query 656 LHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFICCLSILMCL*RCSFV*ILYDNW* 835
LHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFICCLSILMCL*RCSFV*ILYDNW*
Sbjct 3 LHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFICCLSILMCL*RCSFV*ILYDNW* 182
Query 836 ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNILCPFSTFRKVCQVIIQSWWG*S 1015
ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNILCPFSTFRKVCQVIIQSWWG*S
Sbjct 183 ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNILCPFSTFRKVCQVIIQSWWG*S 362
Query 1016 YFFPSY*NISRRSFWLHKHKCHLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMV 1195
YFFPSY*NISRRSFWLHKHKCHLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMV
Sbjct 363 YFFPSY*NISRRSFWLHKHKCHLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMV 542
Query 1196 WNEICGSFV*ARA 1234
WNEICGSFV*ARA
Sbjct 543 WNEICGSFV*ARA 581
Score = 90.0 bits (190), Expect(3) = 2e-174
Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
Frame = +1/+2
Query 1279 I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 1395
I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH*
Sbjct 626 I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 742
Score = 84.9 bits (179), Expect(3) = 2e-174
Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
Frame = +1/+2
Query 1432 MYASFSISILIYLHGFYY*FHQGY*ENLLCAVCFK 1536
MYASFSISILIYLHGFYY*FHQGY* NLLCAVCFK
Sbjct 779 MYASFSISILIYLHGFYY*FHQGY*XNLLCAVCFK 883
Score = 566 bits (1230), Expect(2) = 1e-171
Identities = 248/250 (99%), Positives = 248/250 (99%), Gaps = 0/250 (0%)
Frame = -3/-2
Query 1405 F*LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSS 1226
F*LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSS
Sbjct 752 F*LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSS 573
Query 1225 LYEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEMTFVLM*PERSP 1046
LYEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEMTFVLM*PERSP
Sbjct 572 LYEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEMTFVLM*PERSP 393
Query 1045 ANVSITGKEVRLPPPRLYDNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRD 866
ANVSITGKEVRLPPPRLYDNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRD
Sbjct 392 ANVSITGKEVRLPPPRLYDNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRD 213
Query 865 KSSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRV 686
KSSSISKEGNSP IIKNSDKAAPL*AHKY* TADELAVATSIEK*KIASFCRRDRKTCRV
Sbjct 212 KSSSISKEGNSPXIIKNSDKAAPL*AHKY*XTADELAVATSIEK*KIASFCRRDRKTCRV 33
Query 685 LDEL*PREV* 656
LDEL*PREV*
Sbjct 32 LDEL*PREV* 3
Score = 56.5 bits (117), Expect(2) = 1e-171
Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
Frame = -3/-2
Query 1534 *NTQHTIDFPSNLGGTNNKIHAGIS 1460
*N QHTIDF SNLGGTNNKIHAGIS
Sbjct 881 *NXQHTIDFXSNLGGTNNKIHAGIS 807
Score = 587 bits (1276), Expect = 1e-167
Identities = 289/294 (98%), Positives = 290/294 (98%), Gaps = 0/294 (0%)
Frame = -2/-1
Query 1538 TLKHTAHNRFS**PWWN***NPCRYikieiekEAYIFNC*SF*KILIS**QYANLSH*TY 1359
+LK TAHNRF **PWWN***NPCRYIKIEIEKEAYIFNC*SF*KILIS**QYANLSH*TY
Sbjct 885 SLKXTAHNRFX**PWWN***NPCRYIKIEIEKEAYIFNC*SF*KILIS**QYANLSH*TY 706
Query 1358 WRSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCR 1179
WRSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCR
Sbjct 705 WRSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCR 526
Query 1178 THTCYR*SYIYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC*CFNNWERSKTTPTK 999
THTCYR*SYIYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC*CFNNWERSKTTPTK
Sbjct 525 THTCYR*SYIYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC*CFNNWERSKTTPTK 346
Query 998 IV**LGRPF*KSRMDKEYfswisfssswsSQ*EVYFSISTCMSR*IIKYKQRRKFTSYHK 819
IV**LGRPF*KSRMDKEYFSWISFSSSWSSQ*EVYFSISTCMSR*IIKYKQRRKFT YHK
Sbjct 345 IV**LGRPF*KSRMDKEYFSWISFSSSWSSQ*EVYFSISTCMSR*IIKYKQRRKFTXYHK 166
Query 818 EFRQSCTAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRGV 657
EFRQSCTAIST*VL DSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRGV
Sbjct 165 EFRQSCTAIST*VLXDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRGV 4
Score = 242 bits (522), Expect(4) = 1e-129
Identities = 122/122 (100%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
Frame = +1/+2
Query 859 MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYHTIlvgvvlllsqllK 1038
MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYHTILVGVVLLLSQLLK
Sbjct 206 MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYHTILVGVVLLLSQLLK 385
Query 1039 H*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQL 1218
H*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQL
Sbjct 386 H*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQL 565
Query 1219 RI 1224
RI
Sbjct 566 RI 571
Score = 116 bits (247), Expect(4) = 1e-129
Identities = 48/49 (97%), Positives = 48/49 (97%), Gaps = 0/49 (0%)
Frame = +1/+2
Query 658 TPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLSVNTYVLIAVQ 804
TPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLS NTYVLIAVQ
Sbjct 5 TPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLSXNTYVLIAVQ 151
Score = 85.8 bits (181), Expect(4) = 1e-129
Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
Frame = +2/+3
Query 1292 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 1393
KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI
Sbjct 639 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 740
Score = 77.6 bits (163), Expect(4) = 1e-129
Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
Frame = +2/+3
Query 1433 CTPLSQSLS*YTCMDFIISSTKVTRKIYCVLCVLR 1537
CTPLSQSLS*YTCMDFIISSTKVTR+IYCVL VL+
Sbjct 780 CTPLSQSLS*YTCMDFIISSTKVTREIYCVLXVLK 884
> zoox2_c20773
Length=852
Score = 334 bits (723), Expect(3) = 3e-168
Identities = 140/140 (100%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
Frame = -2/+3
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT 339
CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT
Sbjct 408 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT 587
Query 338 HT*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN 159
HT*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN
Sbjct 588 HT*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN 767
Query 158 *DYNSIN*NVLFN*LHDVGR 99
*DYNSIN*NVLFN*LHDVGR
Sbjct 768 *DYNSIN*NVLFN*LHDVGR 827
Score = 229 bits (495), Expect(3) = 3e-168
Identities = 95/98 (96%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
Frame = -1/+2
Query 846 KKEIHQLS*RIQTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQ 667
+++IHQLS*RIQTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQ
Sbjct 80 RRKIHQLS*RIQTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERLVECLMSFDQ 259
Query 666 ERCRQ*IQTYTFD*GSYLCKWMFYLSDDHQELILSDHI 553
ERCRQ*IQTYTFD*GSYLCKWMFYLSDDHQELILSDHI
Sbjct 260 ERCRQ*IQTYTFD*GSYLCKWMFYLSDDHQELILSDHI 373
Score = 68.0 bits (142), Expect(3) = 3e-168
Identities = 28/29 (96%), Positives = 28/29 (96%), Gaps = 0/29 (0%)
Frame = -1/+1
Query 924 FQLVFSIGGIFLYKHMHVEINHQV*AKKE 838
FQLVFSIGGIFLYKH HVEINHQV*AKKE
Sbjct 1 FQLVFSIGGIFLYKHTHVEINHQV*AKKE 87
Score = 532 bits (1155), Expect(2) = 7e-166
Identities = 247/247 (100%), Positives = 247/247 (100%), Gaps = 0/247 (0%)
Frame = +3/-2
Query 99 PTNIVELIEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMN 278
PTNIVELIEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMN
Sbjct 827 PTNIVELIEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMN 648
Query 279 LLIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWA 458
LLIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWA
Sbjct 647 LLIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWA 468
Query 459 IESPAPGIIDRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGKTSICIDTILNQKY 638
IESPAPGIIDRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGKTSICIDTILNQKY
Sbjct 467 IESPAPGIIDRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGKTSICIDTILNQKY 288
Query 639 RSVFTVYtslgqsssstlqVFLSLLQKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEF 818
RSVFTVYTSLGQSSSSTLQVFLSLLQKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEF
Sbjct 287 RSVFTVYTSLGQSSSSTLQVFLSLLQKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEF 108
Query 819 FMITGEF 839
FMITGEF
Sbjct 107 FMITGEF 87
Score = 71.6 bits (150), Expect(2) = 7e-166
Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
Frame = +3/-3
Query 837 FPSLLILDDLSRHACAYREIYLLLRRPAG 923
FPSLLILDDLSRHACAYREIYLLLRRPAG
Sbjct 88 FPSLLILDDLSRHACAYREIYLLLRRPAG 2
Score = 334 bits (724), Expect(3) = 8e-162
Identities = 137/137 (100%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
Frame = +2/-1
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR*NIH 607
R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR*NIH
Sbjct 498 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR*NIH 319
Query 608 LHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFICCLSILM 787
LHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFICCLSILM
Sbjct 318 LHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFICCLSILM 139
Query 788 CL*RCSFV*ILYDNW*I 838
CL*RCSFV*ILYDNW*I
Sbjct 138 CL*RCSFV*ILYDNW*I 88
Score = 208 bits (449), Expect(3) = 8e-162
Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
Frame = +2/-1
Query 98 PDQHRGVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNE 277
PDQHRGVN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNE
Sbjct 828 PDQHRGVN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNE 649
Query 278 SSYWCFIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
SSYWCFIA*SGKSSWSRFKCACISYTSHHHPRRLCN
Sbjct 648 SSYWCFIA*SGKSSWSRFKCACISYTSHHHPRRLCN 541
Score = 67.0 bits (140), Expect(3) = 8e-162
Identities = 27/28 (96%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
Frame = +2/-2
Query 839 SFFAYT**FISTCMCL*RNIPPIEKTSW 922
SFFAYT**FISTC+CL*RNIPPIEKTSW
Sbjct 86 SFFAYT**FISTCVCL*RNIPPIEKTSW 3
Score = 512 bits (1113), Expect(2) = 2e-153
Identities = 235/235 (100%), Positives = 235/235 (100%), Gaps = 0/235 (0%)
Frame = +1/-3
Query 100 RPTSWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*I 279
RPTSWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*I
Sbjct 826 RPTSWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*I 647
Query 280 FLLVLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR 459
FLLVLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR
Sbjct 646 FLLVLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR 467
Query 460 *NPLLQV*LTDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQVKHPFA*IRSLIKSI 639
*NPLLQV*LTDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQVKHPFA*IRSLIKSI
Sbjct 466 *NPLLQV*LTDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQVKHPFA*IRSLIKSI 287
Query 640 GLYSLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLSVNTYVLIAVQ 804
GLYSLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLSVNTYVLIAVQ
Sbjct 286 GLYSLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLSVNTYVLIAVQ 122
Score = 49.6 bits (102), Expect(2) = 2e-153
Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
Frame = +1/-1
Query 859 MIYLDMHVLIEKYTSY*EDQLE 924
MIYLDM VLIEKYTSY*EDQLE
Sbjct 66 MIYLDMRVLIEKYTSY*EDQLE 1
Score = 411 bits (892), Expect(4) = 3e-145
Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
Frame = -3/+1
Query 850 SKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRVLDEL* 671
+K+ NSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRVLDEL*
Sbjct 76 AKKENSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRVLDEL* 255
Query 670 PREV*TVNTDLYF*LRIVSMQMDVLPV*RSPRINSL*PHPIGILESIAITPVCNASVTDC 491
PREV*TVNTDLYF*LRIVSMQMDVLPV*RSPRINSL*PHPIGILESIAITPVCNASVTDC
Sbjct 256 PREV*TVNTDLYF*LRIVSMQMDVLPV*RSPRINSL*PHPIGILESIAITPVCNASVTDC 435
Query 490 LSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMVASVADARTLEP*PRGF 311
LSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMVASVADARTLEP*PRGF
Sbjct 436 LSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMVASVADARTLEP*PRGF 615
Query 310 SGLSNKAP 287
SGLSNKAP
Sbjct 616 SGLSNKAP 639
Score = 66.1 bits (138), Expect(4) = 3e-145
Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
Frame = -3/+3
Query 922 PAGLLNRRYISL*AHACRDKSSSISKEG 839
PAGLLNRRYISL*AHACRDKSSSISKEG
Sbjct 3 PAGLLNRRYISL*AHACRDKSSSISKEG 86
Score = 55.1 bits (114), Expect(4) = 3e-145
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/+1
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 685 PMEELCVVKTSEMNAINNPSNV 750
Score = 41.4 bits (84), Expect(4) = 3e-145
Identities = 13/14 (92%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
Frame = -1/+2
Query 135 ECPFQLTPRCWSGQ 94
ECPFQLTPRCWSG+
Sbjct 791 ECPFQLTPRCWSGR 832
Score = 204 bits (439), Expect(4) = 1e-117
Identities = 91/91 (100%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
Frame = -2/+3
Query 839 KFTSYHKEFRQSCTAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRG 660
KFTSYHKEFRQSCTAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRG
Sbjct 87 KFTSYHKEFRQSCTAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKRG 266
Query 659 VDSEYRPILLIKDRIYANGCFTCLTITKN*F 567
VDSEYRPILLIKDRIYANGCFTCLTITKN*F
Sbjct 267 VDSEYRPILLIKDRIYANGCFTCLTITKN*F 359
Score = 195 bits (421), Expect(4) = 1e-117
Identities = 95/95 (100%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
Frame = -1/+2
Query 501 *QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLD 322
*QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPLDLESKLLQSLLG*WWLV*LMHAHLNLD
Sbjct 425 *QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPLDLESKLLQSLLG*WWLV*LMHAHLNLD 604
Query 321 QEDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 217
QEDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW*
Sbjct 605 QEDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 709
Score = 49.6 bits (102), Expect(4) = 1e-117
Identities = 23/24 (95%), Positives = 23/24 (95%), Gaps = 0/24 (0%)
Frame = -2/+2
Query 908 Q*EVYFSISTCMSR*IIKYKQRRK 837
Q*EVYFSIST MSR*IIKYKQRRK
Sbjct 17 Q*EVYFSISTRMSR*IIKYKQRRK 88
Score = 32.2 bits (64), Expect(4) = 1e-117
Identities = 14/16 (87%), Positives = 14/16 (87%), Gaps = 0/16 (0%)
Frame = -3/+1
Query 136 RMSFSINSTMLVGXKL 89
RMSFSINSTMLVG L
Sbjct 790 RMSFSINSTMLVGPPL 837
> zoox2_c7354
Length=1179
Score = 213 bits (459), Expect(7) = 1e-157
Identities = 94/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
Frame = +3/+2
Query 1203 KYVAASYKLELAQFVELQSFSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVG 1382
KYVA YKLELAQFVELQSFSQFA+DLGQESKN+LTRGLRLVEMLKQSNGSPISLMGQVG
Sbjct 827 KYVAGFYKLELAQFVELQSFSQFASDLGQESKNRLTRGLRLVEMLKQSNGSPISLMGQVG 1006
Query 1383 ILSLANQNLLEALAVEDVRLFLNLYLDIPAWILLLVPPRLLGKSI 1517
ILSLANQ LLEALAV+DV LFLNLYLDIP+WILLLVPP L+ KSI
Sbjct 1007 ILSLANQELLEALAVKDVGLFLNLYLDIPSWILLLVPPSLVAKSI 1141
Score = 139 bits (299), Expect(7) = 1e-157
Identities = 59/62 (95%), Positives = 60/62 (96%), Gaps = 0/62 (0%)
Frame = +3/+1
Query 807 LSEFFMITGEFPSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAK 986
L EFF+ITGE PSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAK
Sbjct 613 LIEFFVITGELPSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAK 792
Query 987 LS 992
LS
Sbjct 793 LS 798
Score = 109 bits (232), Expect(7) = 1e-157
Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
Frame = +1/+1
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEM 267
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL *IFIE+
Sbjct 202 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVLL*IFIEV 360
Score = 71.2 bits (149), Expect(7) = 1e-157
Identities = 31/37 (83%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
Frame = +2/+3
Query 599 NIHLHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSIS 709
+IHLHR P*SKV* IHCLHLSWSKLIKHSTSLS+S
Sbjct 420 SIHLHR*HP*SKV*RRIHCLHLSWSKLIKHSTSLSMS 530
Score = 67.5 bits (141), Expect(7) = 1e-157
Identities = 29/30 (96%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
Frame = +3/+2
Query 696 VFLSLLQKDAIFYFSMLVATASSSAVCQYL 785
VFLSL+QKDAIFYFSMLVATASSSAVCQYL
Sbjct 527 VFLSLVQKDAIFYFSMLVATASSSAVCQYL 616
Score = 53.3 bits (110), Expect(7) = 1e-157
Identities = 18/23 (78%), Positives = 19/23 (82%), Gaps = 0/23 (0%)
Frame = +2/+2
Query 317 SWSRFKCACISYTSHHHPRRLCN 385
S SRF C CI +TSHHHPRRLCN
Sbjct 347 SLSRFNCPCIKFTSHHHPRRLCN 415
Score = 29.5 bits (58), Expect(7) = 1e-157
Identities = 10/11 (90%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
Frame = +2/+2
Query 1076 CHLNY*WSNSF 1108
CHL Y*WSNSF
Sbjct 794 CHLYY*WSNSF 826
Score = 198 bits (426), Expect(7) = 6e-141
Identities = 92/107 (85%), Positives = 96/107 (89%), Gaps = 0/107 (0%)
Frame = -1/-2
Query 1524 STQ*IFLVTLVELIIKSMQVYQDRD*ERGVHLQLLKLLEDFD*LMTICQLVPLNLLEIHW 1345
STQ*I L VELIIKSM+VYQDRD*ERG+HL LLKLLE D*LMTICQLVPL+LLEIHW
Sbjct 1148 STQ*I*LQD*VELIIKSMKVYQDRD*ERGLHL*LLKLLEALD*LMTICQLVPLSLLEIHW 969
Query 1344 IVLAFLQVVILLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHI 1204
IVLAFLQVV LLLIYSCFL LDQ+QIVRMIVIQQIEQALAY LPHI
Sbjct 968 IVLAFLQVVSLLLIYSCFLALDQMQIVRMIVIQQIEQALAYKNLPHI 828
Score = 119 bits (255), Expect(7) = 6e-141
Identities = 55/60 (91%), Positives = 55/60 (91%), Gaps = 0/60 (0%)
Frame = -3/-2
Query 991 DNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRDKSSSISKEGNSPVIIKNS 812
DN ADLSKSRE TKNISPG*ASLPAGLLNRRYISL*A A RDKSSSISKEGNSPVI KNS
Sbjct 797 DNFADLSKSRECTKNISPG*ASLPAGLLNRRYISL*AQAWRDKSSSISKEGNSPVITKNS 618
Score = 109 bits (233), Expect(7) = 6e-141
Identities = 47/48 (97%), Positives = 47/48 (97%), Gaps = 0/48 (0%)
Frame = -2/-2
Query 263 SIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN 120
SIKIY KTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN
Sbjct 356 SIKIYNKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN 213
Score = 71.6 bits (150), Expect(7) = 6e-141
Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
Frame = -1/-3
Query 711 EEIERLVECLMSFDQERCRQ*IQTYTFD*GSYLCKWMFYLSDDHQELILSD 559
++IERLVECLMSFDQERCRQ*I+ YTFD*G YL + M ++ + ++ S+
Sbjct 532 KDIERLVECLMSFDQERCRQ*IRRYTFD*GCYLWR*MEAIAQSPRVMVASE 380
Score = 65.2 bits (136), Expect(7) = 6e-141
Identities = 29/31 (93%), Positives = 30/31 (96%), Gaps = 0/31 (0%)
Frame = -3/-1
Query 787 HKY*QTADELAVATSIEK*KIASFCRRDRKT 695
+KY*QTADELAVATSIEK*KIASFC RDRKT
Sbjct 618 NKY*QTADELAVATSIEK*KIASFCTRDRKT 526
Score = 36.3 bits (73), Expect(7) = 6e-141
Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
Frame = -1/-1
Query 369 G*WWLV*LMHAHLNLDQE 316
G*WWLV LMH LNLD++
Sbjct 399 G*WWLVNLMHGQLNLDKD 346
Score = 26.7 bits (52), Expect(7) = 6e-141
Identities = 11/14 (78%), Positives = 12/14 (85%), Gaps = 0/14 (0%)
Frame = -1/-1
Query 1110 IKLFDHQ*LR*HLC 1069
+KLFDHQ* R* LC
Sbjct 828 LKLFDHQ**R*QLC 787
Score = 183 bits (395), Expect(7) = 3e-118
Identities = 97/114 (85%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
Frame = -2/-3
Query 1535 LKHTAHNRFS**PWWN***NPCRYikieiekEAYIFNC*SF*KILIS**QYANLSH*TYW 1356
LK+ AHNRFS WN***NP RYIKIEIEKEAYIFNC*SF*K+LIS**QYANLSH* YW
Sbjct 1159 LKNRAHNRFSYKTRWN***NP*RYIKIEIEKEAYIFNC*SF*KLLIS**QYANLSH*AYW 980
Query 1355 RSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSI 1194
RSIGLF*HFYKS*+SC* ILAFL *I CKL*E*L*FNKLSKL*LI++CHIF +I
Sbjct 979 RSIGLF*HFYKS*ASC*SILAFLP*IRCKL*E*L*FNKLSKL*LIKTCHIFKAI 818
Score = 119 bits (255), Expect(7) = 3e-118
Identities = 53/61 (86%), Positives = 54/61 (88%), Gaps = 0/61 (0%)
Frame = -1/-3
Query 993 MITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*AKKEIHQLS*RI 814
M T QTFLKVEN QRIFLLDKLLFQLVFSIGGIFLYKH H EINHQV*A+K IHQLS RI
Sbjct 799 MTTLQTFLKVENAQRIFLLDKLLFQLVFSIGGIFLYKHKHGEINHQV*ARKAIHQLSQRI 620
Query 813 Q 811
Q
Sbjct 619 Q 617
Score = 68.4 bits (143), Expect(7) = 3e-118
Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
Frame = -3/-2
Query 709 RDRKTCRVLDEL*PREV*TVNTDLYF*LRIVSMQMD 602
R RKTCRVLDEL*PREV*TVNT LYF*LR++SM+M+
Sbjct 530 RHRKTCRVLDEL*PREV*TVNTALYF*LRMLSMEMN 423
Score = 62.9 bits (131), Expect(7) = 3e-118
Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
Frame = -1/-2
Query 786 ISIDRQQMNWL*PRALRSRR*HLFVEEIER 697
ISIDRQQMNWL PRALRSRR*HLFV+ IER
Sbjct 617 ISIDRQQMNWLWPRALRSRR*HLFVQGIER 528
Score = 55.1 bits (114), Expect(7) = 3e-118
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-3
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 334 PMEELCVVKTSEMNAINNPSNV 269
Score = 35.4 bits (71), Expect(7) = 3e-118
Identities = 15/23 (65%), Positives = 20/23 (86%), Gaps = 0/23 (0%)
Frame = -3/-3
Query 394 IEAIAESPRMMVASVADARTLEP 326
+EAIA+SPR+MVAS +A T+EP
Sbjct 424 MEAIAQSPRVMVASELNAWTVEP 356
Score = 24.9 bits (48), Expect(7) = 3e-118
Identities = 11/11 (100%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
Frame = -3/-3
Query 1108 KAI*PSVIEMT 1076
KAI*PSVIEMT
Sbjct 826 KAI*PSVIEMT 794
Score = 127 bits (271), Expect(7) = 4e-114
Identities = 53/61 (86%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
Frame = +2/+3
Query 812 *ILYDNW*ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNILCPFSTFRKVCQVI 991
*IL DNW*I+F AYT**FIS C+CL*RNIPPIEKTSWKRSLSRRNILC FSTFRKVC+V+
Sbjct 618 *ILCDNW*IAFLAYT**FISPCLCL*RNIPPIEKTSWKRSLSRRNILCAFSTFRKVCKVV 797
Query 992 I 994
I
Sbjct 798 I 800
Score = 112 bits (240), Expect(7) = 4e-114
Identities = 50/55 (90%), Positives = 52/55 (94%), Gaps = 0/55 (0%)
Frame = +3/+3
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLL 284
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYR T++ L
Sbjct 213 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRGSTVHAL 377
Score = 82.2 bits (173), Expect(7) = 4e-114
Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
Frame = +2/+1
Query 1292 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 1393
KQE*INKR+TTCRNAKTIQWISNK NGTSWHIVI
Sbjct 916 KQE*INKRLTTCRNAKTIQWISNKLNGTSWHIVI 1017
Score = 66.6 bits (139), Expect(7) = 4e-114
Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 0/37 (0%)
Frame = +1/+2
Query 601 HPFA*IRSLIKSIGLYSLSTPLLVKAHQALYKSFYLF 711
H *I SLIKSI YSLSTPLLVKAHQALYKSFY+F
Sbjct 422 HSSP*IASLIKSIAPYSLSTPLLVKAHQALYKSFYVF 532
Score = 64.3 bits (134), Expect(7) = 4e-114
Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
Frame = +2/+1
Query 698 LSISSTKRCYLLLLNARGYSQFICCLSILM 787
LSI TKRCYLLLLNARG+SQFICCLSIL+
Sbjct 529 LSIPCTKRCYLLLLNARGHSQFICCLSILI 618
Score = 57.4 bits (119), Expect(7) = 4e-114
Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
Frame = +1/+3
Query 1432 MYASFSISILIYLHGFYY*FHQGY*ENLLCAV 1527
M ASFSISILIYLHGFYY*FH * NLLCA+
Sbjct 1056 M*ASFSISILIYLHGFYY*FHLVL*LNLLCAL 1151
Score = 26.3 bits (51), Expect(7) = 4e-114
Identities = 11/12 (91%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
Frame = +3/+3
Query 1077 VISITDGQIALS 1112
VISITDGQIAL+
Sbjct 795 VISITDGQIALN 830
Score = 145 bits (312), Expect(7) = 1e-93
Identities = 61/66 (92%), Positives = 62/66 (93%), Gaps = 0/66 (0%)
Frame = -3/-1
Query 1402 *LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSSL 1223
*LANDNMPTCPIKLIGDPLDCFSISTSR PLVNLFLLSCPRS ANCENDCNSTN*ASSSL
Sbjct 1026 *LANDNMPTCPIKLIGDPLDCFSISTSRKPLVNLFLLSCPRSDANCENDCNSTN*ASSSL 847
Query 1222 YEAATY 1205
+ ATY
Sbjct 846 *KPATY 829
Score = 85.4 bits (180), Expect(7) = 1e-93
Identities = 52/60 (86%), Positives = 55/60 (91%), Gaps = 0/60 (0%)
Frame = -2/-1
Query 986 LGRPF*KSRMDKEYfswisfssswsSQ*EVYFSISTCMSR*IIKYKQRRKFTSYHKEFRQ 807
L RPF*KSRM KEYFSWISFSSSWSSQ*EVYFSIST M+R*IIKYKQ R+FTSYHKEF +
Sbjct 792 LCRPF*KSRMHKEYFSWISFSSSWSSQ*EVYFSISTSMAR*IIKYKQGRQFTSYHKEFNK 613
Score = 59.3 bits (123), Expect(7) = 1e-93
Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
Frame = -2/-3
Query 785 *VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL 693
*VLTDSR*TGC HEH*EVEDSIFL K *KD+
Sbjct 616 *VLTDSR*TGCGHEH*EVEDSIFLYKG*KDI 524
Score = 58.3 bits (121), Expect(7) = 1e-93
Identities = 29/35 (82%), Positives = 30/35 (85%), Gaps = 0/35 (0%)
Frame = -2/-1
Query 710 KR*KDL*SA**ALTKRGVDSEYRPILLIKDRIYAN 606
K *KDL*SA**ALTKRGVDSEY ILLIKD IY +
Sbjct 531 KT*KDL*SA**ALTKRGVDSEYGAILLIKDAIYGD 427
Score = 45.5 bits (93), Expect(7) = 1e-93
Identities = 17/23 (73%), Positives = 19/23 (82%), Gaps = 0/23 (0%)
Frame = -3/-1
Query 1528 TQHTIDFPSNLGGTNNKIHAGIS 1460
T+HTID + LGGTNNKIH GIS
Sbjct 1152 TEHTIDLATRLGGTNNKIHEGIS 1084
Score = 40.5 bits (82), Expect(7) = 1e-93
Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
Frame = -1/-1
Query 267 HLDKDLLQDQWRSFVW* 217
+LDKDL QDQWRSFVW*
Sbjct 360 NLDKDLQQDQWRSFVW* 310
Score = 32.2 bits (64), Expect(7) = 1e-93
Identities = 16/26 (61%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
Frame = -2/-2
Query 395 NRSYCRVS*DDGG*CS*CTHT*TLTK 318
N SYC VS* DGG* +*C +*T K
Sbjct 425 NGSYCTVS*GDGG**T*CMDS*TSIK 348
Score = 86.8 bits (183), Expect(6) = 2e-83
Identities = 40/45 (88%), Positives = 40/45 (88%), Gaps = 0/45 (0%)
Frame = +1/+2
Query 859 MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYH 993
MIYL M VLIEKYTSY*EDQLEEKLIQEKYSL ILDF*KGL S H
Sbjct 665 MIYLAMLVLIEKYTSY*EDQLEEKLIQEKYSLCILDF*KGLQSCH 799
Score = 83.5 bits (176), Expect(6) = 2e-83
Identities = 49/51 (96%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
Frame = +2/+2
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR 265
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC KSLSR
Sbjct 206 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCCKSLSR 358
Score = 79.0 bits (166), Expect(6) = 2e-83
Identities = 35/39 (89%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
Frame = +1/+3
Query 1279 I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 1395
I* KKARI+*QE YDL*KC*NNPMDLQ* *WDKLAYCH*
Sbjct 903 I*GKKARID*QEAYDL*KC*NNPMDLQ*A*WDKLAYCH* 1019
Score = 73.5 bits (154), Expect(6) = 2e-83
Identities = 32/45 (71%), Positives = 34/45 (75%), Gaps = 0/45 (0%)
Frame = +1/+3
Query 652 LSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLSVNTY 786
LS L+K +L SFY YKKMLSSTSQCSW QPVHLLSVNTY
Sbjct 483 LSWSKLIKHSTSLSMSFYPLYKKMLSSTSQCSWPQPVHLLSVNTY 617
Score = 55.1 bits (114), Expect(6) = 2e-83
Identities = 25/32 (78%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
Frame = +2/+1
Query 1433 CTPLSQSLS*YTCMDFIISSTKVTRKIYCVLC 1528
C PLSQSLS*YT MDFIISST IYCVLC
Sbjct 1057 CRPLSQSLS*YTFMDFIISST*SCS*IYCVLC 1152
Score = 36.3 bits (73), Expect(6) = 2e-83
Identities = 15/27 (55%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
Frame = +1/+1
Query 316 LLVKVQVCVHQLH*PPSS*ETLQ*LRF 396
+ ++VQ+ +H +H*PPS *ET+Q*L F
Sbjct 346 IFIEVQLSMH*VH*PPSP*ETVQ*LPF 426
Score = 37.7 bits (76), Expect(2) = 4e-06
Identities = 30/35 (85%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
Frame = +3/+1
Query 606 ICIDTILNQKYRSVFTVYtslgqsssstlqVFLSL 710
I ID+ILNQKY +VFTVYTSLGQSSSSTLQVFL L
Sbjct 427 ISIDSILNQKYSAVFTVYTSLGQSSSSTLQVFLCL 531
Score = 35.9 bits (72), Expect(2) = 4e-06
Identities = 17/26 (65%), Positives = 21/26 (80%), Gaps = 0/26 (0%)
Frame = +3/+3
Query 318 LGQGSSVRASATLATIILGDSAIASI 395
L +GS+V A ++LATI LGD AIASI
Sbjct 348 LYRGSTVHALSSLATITLGDCAIASI 425
> zoox2_rep_c52668
Length=775
Score = 182 bits (391), Expect(4) = 1e-130
Identities = 74/85 (87%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
Frame = +3/-1
Query 405 VGNLIFNSGRIDVSCPWAIESPAPGIIDRQSVTEALQTGVIAIDSSIPIGCGQRELILGD 584
+GN+IFNSGRIDV CPWAIESPAPGIIDRQSV+EALQTG+IAIDSSIPIGCGQRELI+GD
Sbjct 607 MGNVIFNSGRIDVQCPWAIESPAPGIIDRQSVSEALQTGLIAIDSSIPIGCGQRELIVGD 428
Query 585 RQTGKTSICIDTILNQKYRSVFTVY 659
RQTGKTSI +D+ILNQKY +VFTVY
Sbjct 427 RQTGKTSISMDSILNQKYSAVFTVY 353
Score = 143 bits (306), Expect(4) = 1e-130
Identities = 58/63 (92%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
Frame = +3/-2
Query 891 EIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGGSLTSFPVIETLAGDLSGYIS 1070
EIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGGSLT FP++ETLAGD+SGYIS
Sbjct 213 EIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGGSLTCFPIVETLAGDVSGYIS 34
Query 1071 TNV 1079
TN+
Sbjct 33 TNI 25
Score = 109 bits (233), Expect(4) = 1e-130
Identities = 46/48 (95%), Positives = 46/48 (95%), Gaps = 0/48 (0%)
Frame = +3/-1
Query 747 VATASSSAVCQYLCAYSGAALSEFFMITGEFPSLLILDDLSRHACAYR 890
V TASSSAVCQYLCAYSGAALSEFFMITGE PSLLILDDLSRHACAYR
Sbjct 358 VYTASSSAVCQYLCAYSGAALSEFFMITGELPSLLILDDLSRHACAYR 215
Score = 90.4 bits (191), Expect(4) = 1e-130
Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
Frame = +2/-1
Query 275 ESSYWCFIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
ESSYWC IA*SGKSSWSRF C CI +TSHHHPRRLCN
Sbjct 736 ESSYWCLIA*SGKSSWSRFNCPCIKFTSHHHPRRLCN 626
Score = 165 bits (355), Expect(4) = 3e-112
Identities = 74/85 (87%), Positives = 78/85 (91%), Gaps = 0/85 (0%)
Frame = -3/+3
Query 661 V*TVNTDLYF*LRIVSMQMDVLPV*RSPRINSL*PHPIGILESIAITPVCNASVTDCLSI 482
V*TVNT LYF*LR++SM+MDVLPV*RSP INSL*PHPIGILESIAI PVCNAS TDCLSI
Sbjct 351 V*TVNTALYF*LRMLSMEMDVLPV*RSPTINSL*PHPIGILESIAIRPVCNASDTDCLSI 530
Query 481 IPGAGDSIAQGQLTSILPELKMRLP 407
IPGAGDSIAQG TSILPELK+ LP
Sbjct 531 IPGAGDSIAQGHCTSILPELKITLP 605
Score = 125 bits (268), Expect(4) = 3e-112
Identities = 55/64 (85%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
Frame = -3/+2
Query 1081 MTFVLM*PERSPANVSITGKEVRLPPPRLYDNLADLSKSREWTKNISPG*ASLPAGLLNR 902
+ FVLM*PE SPA VS GK+VRLPPPRLYDN ADLSKSRE TKNISPG*ASLPAGLLNR
Sbjct 23 LIFVLM*PETSPAXVSTIGKQVRLPPPRLYDNFADLSKSRECTKNISPG*ASLPAGLLNR 202
Query 901 RYIS 890
RYIS
Sbjct 203 RYIS 214
Score = 97.3 bits (206), Expect(4) = 3e-112
Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
Frame = -1/+1
Query 894 FLYKHMHVEINHQV*AKKEIHQLS*RIQTKLHRYKHISIDRQQMNWL 754
F YKH H EINHQV*A+K IHQLS*RIQTK H YKHISIDRQQMNWL
Sbjct 211 FSYKHKHGEINHQV*ARKAIHQLS*RIQTKQHHYKHISIDRQQMNWL 351
Score = 74.8 bits (157), Expect(4) = 3e-112
Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
Frame = -2/+1
Query 404 WI*NRSYCRVS*DDGG*CS*CTHT*TLTKRIFRIKQ*STNKKIHCVIS 261
WI*N SYC VS* DGG* +*C +*TLTKRIFRIKQ* TNKKI V S
Sbjct 607 WI*NGSYCTVS*GDGG**T*CMDS*TLTKRIFRIKQ*GTNKKIQLVSS 750
Score = 152 bits (327), Expect(4) = 3e-110
Identities = 66/78 (84%), Positives = 67/78 (85%), Gaps = 0/78 (0%)
Frame = +2/-3
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR*NIH 607
R*NRC +PLG RI CSRYN*QTIC RSIANR YSYRFKYTNRMWSERIN W*SSDR*NIH
Sbjct 584 R*NRCAVPLGYRISCSRYN*QTICIRSIANRSYSYRFKYTNRMWSERINCW*SSDR*NIH 405
Query 608 LHRYDP*SKV*VCIHCLH 661
LH P*SKV* IHCLH
Sbjct 404 LHG*HP*SKV*RRIHCLH 351
Score = 128 bits (274), Expect(4) = 3e-110
Identities = 52/62 (83%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
Frame = +2/-1
Query 890 RNIPPIEKTSWKRSLSRRNILCPFSTFRKVCQVIIQSWWG*SYFFPSY*NISRRSFWLHK 1069
RNIPPIEKTSWKRSLSRRNILC FSTFRKVC+VIIQSWW * Y FP+ *N SRR F LHK
Sbjct 214 RNIPPIEKTSWKRSLSRRNILCAFSTFRKVCKVIIQSWWW*PYLFPNC*NXSRRCFRLHK 35
Query 1070 HK 1075
HK
Sbjct 34 HK 29
Score = 92.7 bits (196), Expect(4) = 3e-110
Identities = 39/46 (84%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
Frame = +2/-3
Query 752 YSQFICCLSILMCL*RCSFV*ILYDNW*ISFFAYT**FISTCMCL* 889
+SQFICCLSILMCL* C FV*ILYDNW*I+F AYT**FIS C+CL*
Sbjct 353 HSQFICCLSILMCL*WCCFV*ILYDNW*IAFLAYT**FISPCLCL* 216
Score = 83.1 bits (175), Expect(4) = 3e-110
Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 0/44 (0%)
Frame = +3/-2
Query 273 MNLLIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDP 404
+NLLIGALLLNPENPLGQGS+V A ++LATI LGD AIASILDP
Sbjct 738 LNLLIGALLLNPENPLGQGSTVHALSSLATITLGDCAIASILDP 607
Score = 121 bits (259), Expect(5) = 4e-100
Identities = 54/64 (84%), Positives = 55/64 (85%), Gaps = 0/64 (0%)
Frame = -1/+3
Query 1080 *HLCLCSQKDLLLMFQ*LGKK*DYPHQDCMITWQTFLKVENGQRIFLLDKLLFQLVFSIG 901
*+LCLCS K LLL FQ LG K* Y HQDCMIT QTFLKVEN QRIFLLDKLLFQLVFSIG
Sbjct 24 *YLCLCSLKHLLLXFQQLGNK*GYHHQDCMITLQTFLKVENAQRIFLLDKLLFQLVFSIG 203
Query 900 GIFL 889
GIFL
Sbjct 204 GIFL 215
Score = 95.0 bits (201), Expect(5) = 4e-100
Identities = 45/48 (93%), Positives = 45/48 (93%), Gaps = 0/48 (0%)
Frame = -3/+3
Query 889 L*AHACRDKSSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVAT 746
L*A A RDKSSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAV T
Sbjct 216 L*AQAWRDKSSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAV*T 359
Score = 76.2 bits (160), Expect(5) = 4e-100
Identities = 31/38 (81%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
Frame = -2/+2
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITH 405
CLQCF RLSVNYTWSR FY PRA +IDST*IKN ITH
Sbjct 494 CLQCF*YRLSVNYTWSRRFYSPRALHIDST*IKNNITH 607
Score = 74.4 bits (156), Expect(5) = 4e-100
Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 0/36 (0%)
Frame = -1/+1
Query 660 CRQ*IQTYTFD*GSYLCKWMFYLSDDHQELILSDHI 553
CRQ*I+ YTFD*G Y +WMFYLSDDHQ+LILSDHI
Sbjct 352 CRQ*IRRYTFD*GCYPWRWMFYLSDDHQQLILSDHI 459
Score = 73.9 bits (155), Expect(5) = 4e-100
Identities = 32/46 (69%), Positives = 39/46 (84%), Gaps = 0/46 (0%)
Frame = -3/+2
Query 424 LKMRLPTGSRIEAIAESPRMMVASVADARTLEP*PRGFSGLSNKAP 287
+K + GSR+EAIA+SPR+MVAS +A T+EP*PRGFSGLSNKAP
Sbjct 587 IKNNITHGSRMEAIAQSPRVMVASELNAWTVEP*PRGFSGLSNKAP 724
Score = 90.9 bits (192), Expect(5) = 7e-79
Identities = 56/64 (87%), Positives = 56/64 (87%), Gaps = 0/64 (0%)
Frame = -2/+1
Query 1079 DICAYVARKISC*CFNNWERSKTTPTKIV**LGRPF*KSRMDKEYfswisfssswsSQ*E 900
DICAYVA ISC* FNNWE SK T TKIV**L RPF*KSRM KEYFSWISFSSSWSSQ*E
Sbjct 25 DICAYVA*NISC*XFNNWETSKATTTKIV**LCRPF*KSRMHKEYFSWISFSSSWSSQ*E 204
Query 899 VYFS 888
VYFS
Sbjct 205 VYFS 216
Score = 87.7 bits (185), Expect(5) = 7e-79
Identities = 39/45 (86%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
Frame = -2/+2
Query 887 ISTCMSR*IIKYKQRRKFTSYHKEFRQSCTAIST*VLTDSR*TGC 753
IST M+R*IIKYKQ R+FTSYHKEFRQS T IST*VLTDSR*TGC
Sbjct 218 ISTSMAR*IIKYKQGRQFTSYHKEFRQSSTTIST*VLTDSR*TGC 352
Score = 70.3 bits (147), Expect(5) = 7e-79
Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 0/33 (0%)
Frame = -1/+3
Query 369 G*WWLV*LMHAHLNLDQEDFPD*AIKHQ*EDSL 271
G*WWLV LMH LNLDQEDFPD*AI+HQ*EDS+
Sbjct 642 G*WWLVNLMHGQLNLDQEDFPD*AIRHQ*EDSI 740
Score = 61.6 bits (128), Expect(5) = 7e-79
Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
Frame = -1/+1
Query 498 QIVCQLYLEQGILSPKGSLHRFYLN*K*DYP 406
QIVCQLYLEQ IL PKG+ HRFYLN*K* YP
Sbjct 514 QIVCQLYLEQEIL*PKGTAHRFYLN*K*HYP 606
Score = 58.8 bits (122), Expect(5) = 7e-79
Identities = 24/31 (77%), Positives = 26/31 (83%), Gaps = 0/31 (0%)
Frame = -2/+2
Query 659 VDSEYRPILLIKDRIYANGCFTCLTITKN*F 567
VDSEY ILLIKD I+ +GCFTCLTIT N*F
Sbjct 353 VDSEYGAILLIKDAIHGDGCFTCLTITNN*F 445
Score = 142 bits (305), Expect(4) = 5e-78
Identities = 71/85 (83%), Positives = 73/85 (85%), Gaps = 0/85 (0%)
Frame = +1/-2
Query 406 WVISFLIQVESM*AALGR*NPLLQV*LTDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVI 585
WV+ FLIQVESM +ALG *N LLQV*LTDNL QKHCKQVL*L*IQVYQ*DVVREN* LVI
Sbjct 606 WVMLFLIQVESMCSALGL*NLLLQV*LTDNLYQKHCKQVL*L*IQVYQ*DVVREN*LLVI 427
Query 586 VRQVKHPFA*IRSLIKSIGLYSLST 660
VRQVKHP I SLIKSI YSLST
Sbjct 426 VRQVKHPSPWIASLIKSIAPYSLST 352
Score = 95.0 bits (201), Expect(4) = 5e-78
Identities = 55/64 (85%), Positives = 58/64 (90%), Gaps = 0/64 (0%)
Frame = +1/-3
Query 889 EKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYHTIlvgvvlllsqllKH*QEIFLAT* 1068
EKYTSY*EDQLEEKLIQEKYSL ILDF*KGL SYHTILV V LL+SQLLK *QE+F AT*
Sbjct 215 EKYTSY*EDQLEEKLIQEKYSLCILDF*KGLQSYHTILVVVALLVSQLLKX*QEMFQAT* 36
Query 1069 AQMS 1080
AQ+S
Sbjct 35 AQIS 24
Score = 73.9 bits (155), Expect(4) = 5e-78
Identities = 37/54 (68%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
Frame = +1/-3
Query 241 VL**IFIEMTQ*IFLLVLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*I 402
+L* ++ + T *IFLLV YCLIRKILLVKVQ+ +H +H*PPS *ET+Q*L F*I
Sbjct 770 LL*ILYRDDTN*IFLLVPYCLIRKILLVKVQLSMH*VH*PPSP*ETVQ*LPF*I 609
Score = 36.8 bits (74), Expect(4) = 5e-78
Identities = 15/16 (93%), Positives = 15/16 (93%), Gaps = 0/16 (0%)
Frame = +1/-2
Query 754 QPVHLLSVNTYVLIAV 801
QPVHLLSVNTYVLI V
Sbjct 351 QPVHLLSVNTYVLIVV 304
> zoox2_rep_c59199
Length=747
Score = 236 bits (509), Expect(3) = 2e-116
Identities = 103/108 (95%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
Frame = -3/-3
Query 1324 SRNPLVNLFLLSCPRSAANCENDCNSTN*ASSSLYEAATYFIPYH*AAEPTRVTDNPTSI 1145
S + VNLFLLSCPRSAANCENDCNSTN*ASSSLYEAATYFIPYH*AAEPTR TDNPTSI
Sbjct 652 SVSSFVNLFLLSCPRSAANCENDCNSTN*ASSSLYEAATYFIPYH*AAEPTRDTDNPTSI 473
Query 1144 AG*IPDRNKSADKAI*PSVIEMTFVLM*PERSPANVSITGKEVRLPPP 1001
AG*IPDRNKSADKAI*PSVIEMTFVLM*PERSPANVSITGKEVRLPPP
Sbjct 472 AG*IPDRNKSADKAI*PSVIEMTFVLM*PERSPANVSITGKEVRLPPP 329
Score = 195 bits (421), Expect(3) = 2e-116
Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
Frame = -2/-3
Query 515 LQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CTH 336
LQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CTH
Sbjct 265 LQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CTH 86
Query 335 T*TLTKRIFRIKQ*STNKKIH 273
T*TLTKRIFRIKQ*STNKKIH
Sbjct 85 T*TLTKRIFRIKQ*STNKKIH 23
Score = 32.7 bits (65), Expect(3) = 2e-116
Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 0/32 (0%)
Frame = -1/-2
Query 1008 PHQDCMITWQTFLKVENGQRIFLLDKLLFQLV 913
P + ITWQTFLKVEN L+ LL Q+V
Sbjct 335 PTKXXXITWQTFLKVENL*L*HLVAMLL*QIV 240
Score = 235 bits (508), Expect(2) = 9e-115
Identities = 103/105 (98%), Positives = 105/105 (100%), Gaps = 0/105 (0%)
Frame = +3/+3
Query 999 LGGGSLTSFPVIETLAGDLSGYISTNVISITDGQIALSADLFLSGIQPAIDVGLSVTRVG 1178
LGGGSLTSFPVIETLAGDLSGYISTNVISITDGQIALSADLFLSGIQPAIDVGLSV+RVG
Sbjct 327 LGGGSLTSFPVIETLAGDLSGYISTNVISITDGQIALSADLFLSGIQPAIDVGLSVSRVG 506
Query 1179 SAAQWYGMKYVAASYKLELAQFVELQSFSQFAADLGQESKNKLTR 1313
SAAQWYGMKYVAASYKLELAQFVELQSFSQFAADLGQESKNKLT+
Sbjct 507 SAAQWYGMKYVAASYKLELAQFVELQSFSQFAADLGQESKNKLTK 641
Score = 201 bits (433), Expect(2) = 9e-115
Identities = 88/91 (96%), Positives = 89/91 (97%), Gaps = 0/91 (0%)
Frame = +3/+2
Query 273 MNLLIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCP 452
MNLLIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCP
Sbjct 23 MNLLIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCP 202
Query 453 WAIESPAPGIIDRQSVTEALQTGVIAIDSSI 545
WAIESPAPGIIDRQSVTEALQ GVIAIDS +
Sbjct 203 WAIESPAPGIIDRQSVTEALQPGVIAIDSRL 295
Score = 235 bits (507), Expect(3) = 2e-111
Identities = 104/111 (93%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
Frame = -2/-2
Query 1331 FYKS*SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCRTHTCYR*SY 1152
++K C*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCRTHT YR*SY
Sbjct 659 YFKRFLFC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCRTHT*YR*SY 480
Query 1151 IYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC*CFNNWERSKTTPTK 999
IYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC*CFNNWERSKTTPTK
Sbjct 479 IYSWLNSR*K*VCR*SYLTISN*DDICAYVARKISC*CFNNWERSKTTPTK 327
Score = 188 bits (406), Expect(3) = 2e-111
Identities = 83/84 (98%), Positives = 83/84 (98%), Gaps = 0/84 (0%)
Frame = -3/-1
Query 538 ESIAITPVCNASVTDCLSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMV 359
ESIAITP CNASVTDCLSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMV
Sbjct 288 ESIAITPGCNASVTDCLSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMV 109
Query 358 ASVADARTLEP*PRGFSGLSNKAP 287
ASVADARTLEP*PRGFSGLSNKAP
Sbjct 108 ASVADARTLEP*PRGFSGLSNKAP 37
Score = 23.5 bits (45), Expect(3) = 2e-111
Identities = 10/11 (90%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
Frame = -2/-3
Query 989 *LGRPF*KSRM 957
*LGRPF*KSR+
Sbjct 316 *LGRPF*KSRI 284
Score = 207 bits (447), Expect(2) = 7e-90
Identities = 104/105 (99%), Positives = 105/105 (100%), Gaps = 0/105 (0%)
Frame = -1/-1
Query 1314 LLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNPhvlqiilhl*lVE 1135
LLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNPHV+QIILHL*LVE
Sbjct 642 LLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNPHVIQIILHL*LVE 463
Query 1134 FQIEISLQIKLFDHQ*LR*HLCLCSQKDLLLMFQ*LGKK*DYPHQ 1000
FQIEISLQIKLFDHQ*LR*HLCLCSQKDLLLMFQ*LGKK*DYPHQ
Sbjct 462 FQIEISLQIKLFDHQ*LR*HLCLCSQKDLLLMFQ*LGKK*DYPHQ 328
Score = 146 bits (313), Expect(2) = 7e-90
Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
Frame = -1/-2
Query 501 *QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLD 322
*QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPLDLESKLLQSLLG*WWLV*LMHAHLNLD
Sbjct 251 *QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPLDLESKLLQSLLG*WWLV*LMHAHLNLD 72
Query 321 QEDFPD*AIKHQ*EDS 274
QEDFPD*AIKHQ*EDS
Sbjct 71 QEDFPD*AIKHQ*EDS 24
Score = 185 bits (398), Expect(3) = 9e-82
Identities = 87/89 (97%), Positives = 88/89 (98%), Gaps = 0/89 (0%)
Frame = +1/+3
Query 271 Q*IFLLVLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AA 450
+*IFLLVLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AA
Sbjct 21 K*IFLLVLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AA 200
Query 451 LGR*NPLLQV*LTDNLSQKHCKQVL*L*I 537
LGR*NPLLQV*LTDNLSQKHC QVL*L*I
Sbjct 201 LGR*NPLLQV*LTDNLSQKHCNQVL*L*I 287
Score = 138 bits (296), Expect(3) = 9e-82
Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
Frame = +1/+1
Query 1036 KH*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQ 1215
KH*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL HVWVLQLNGME*NMWQ
Sbjct 364 KH*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYLYHVWVLQLNGME*NMWQ 543
Query 1216 LRI 1224
LRI
Sbjct 544 LRI 552
Score = 24.4 bits (47), Expect(3) = 9e-82
Identities = 11/12 (91%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
Frame = +1/+1
Query 1279 I*DKKARIN*QE 1314
I*DKKARIN*Q+
Sbjct 607 I*DKKARIN*QK 642
Score = 203 bits (438), Expect(2) = 5e-76
Identities = 81/110 (73%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
Frame = +2/+2
Query 905 IEKTSWKRSLSRRNILCPFSTFRKVCQVIIQSWWG*SYFFPSY*NISRRSFWLHKHKCHL 1084
I++ S +L I + ++ + WWG*SYFFPSY*NISRRSFWLHKHKCHL
Sbjct 233 IDRQSVTEALQPGVIAIDSRLLERSAKLSXRXWWG*SYFFPSY*NISRRSFWLHKHKCHL 412
Query 1085 NY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMVWNEICGSFV*ARA 1234
NY*WSNSFICRLISIWNSTSYRCRIIC TCGFCSSMVWNEICGSFV*ARA
Sbjct 413 NY*WSNSFICRLISIWNSTSYRCRIICITCGFCSSMVWNEICGSFV*ARA 562
Score = 104 bits (221), Expect(2) = 5e-76
Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
Frame = +2/+1
Query 272 NESSYWCFIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
NESSYWCFIA*SGKSSWSRFKCACISYTSHHHPRRLCN
Sbjct 22 NESSYWCFIA*SGKSSWSRFKCACISYTSHHHPRRLCN 135
Score = 93.2 bits (197), Expect = 1e-18
Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
Frame = +2/+1
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRF 538
R*NRCKLPLGDRIPCSRYN*QTICHRSIA RCYSYRF
Sbjct 178 R*NRCKLPLGDRIPCSRYN*QTICHRSIATRCYSYRF 288
> zoox2_c19828
Length=752
Score = 290 bits (627), Expect(4) = 6e-107
Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
Frame = +3/+3
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 299
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL
Sbjct 48 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 227
Query 300 LNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPG 479
LNPENPLGQGS+V A ++LATI LGD AIASILDPVGN+IFNSGRIDV CPWAIESPAPG
Sbjct 228 LNPENPLGQGSTVHALSSLATITLGDCAIASILDPVGNVIFNSGRIDVQCPWAIESPAPG 407
Query 480 IIDRQSVTEALQTGVIAIDSS 542
IIDRQSV+EALQTG+I + S
Sbjct 408 IIDRQSVSEALQTGLICYEHS 470
Score = 64.8 bits (135), Expect(4) = 6e-107
Identities = 25/29 (86%), Positives = 28/29 (96%), Gaps = 0/29 (0%)
Frame = +3/+2
Query 984 KLSYNLGGGSLTSFPVIETLAGDLSGYIS 1070
KLSYNLGGGSLT FP++ETLAGD+SGYIS
Sbjct 494 KLSYNLGGGSLTCFPIVETLAGDVSGYIS 580
Score = 50.1 bits (103), Expect(4) = 6e-107
Identities = 17/19 (89%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
Frame = +2/+3
Query 1148 RCRIICNTCGFCSSMVWNE 1204
RC IICNTCGFC SMVWNE
Sbjct 660 RCWIICNTCGFCRSMVWNE 716
Score = 47.8 bits (98), Expect(4) = 6e-107
Identities = 20/26 (76%), Positives = 22/26 (84%), Gaps = 0/26 (0%)
Frame = +2/+2
Query 1070 HKCHLNY*WSNSFICRLISIWNSTSY 1147
+K HL Y*WSNSFICRLISI S+SY
Sbjct 581 NKYHLYY*WSNSFICRLISIRYSSSY 658
Score = 261 bits (565), Expect(5) = 1e-99
Identities = 115/133 (86%), Positives = 118/133 (88%), Gaps = 0/133 (0%)
Frame = -2/-1
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT 339
CLQCF RL VNYTWSR FY PRA +IDST*IKN ITHWI*N SYC VS* DGG* +*C
Sbjct 446 CLQCF*YRLPVNYTWSRRFYSPRALHIDST*IKNNITHWI*NGSYCTVS*GDGG**T*CM 267
Query 338 HT*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN 159
+*TLTKRIFRIKQ* TNKKIHCVISIKIY KTNGGALCGKNL*DECH**SF*CDYSTTN
Sbjct 266 DS*TLTKRIFRIKQ*GTNKKIHCVISIKIYNKTNGGALCGKNL*DECH**SF*CDYSTTN 87
Query 158 *DYNSIN*NVLFN 120
*DYNSIN*NVLFN
Sbjct 86 *DYNSIN*NVLFN 48
Score = 59.7 bits (124), Expect(5) = 1e-99
Identities = 24/29 (82%), Positives = 26/29 (89%), Gaps = 0/29 (0%)
Frame = -3/-3
Query 1072 VLM*PERSPANVSITGKEVRLPPPRLYDN 986
+LM*PE SPANVS GK+VRLPPPRLYDN
Sbjct 582 LLM*PETSPANVSTIGKQVRLPPPRLYDN 496
Score = 52.8 bits (109), Expect(5) = 1e-99
Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
Frame = -3/-2
Query 1147 IAG*IPDRNKSADKAI*PSVIEMTFV 1070
IAG IPDRNKSADKAI*PSVIEM FV
Sbjct 658 IAGRIPDRNKSADKAI*PSVIEMIFV 581
Score = 43.2 bits (88), Expect(5) = 1e-99
Identities = 16/18 (88%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
Frame = -2/-3
Query 1202 HSIPLSCRTHTCYR*SYI 1149
HSIPL+CRTHTCYR*S I
Sbjct 714 HSIPLTCRTHTCYR*SNI 661
Score = 29.9 bits (59), Expect(5) = 1e-99
Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
Frame = -2/-1
Query 1241 LSKL*LIRSCHIF 1203
LSKL*LIR+CHIF
Sbjct 752 LSKL*LIRACHIF 714
Score = 250 bits (541), Expect(3) = 2e-90
Identities = 119/139 (85%), Positives = 126/139 (90%), Gaps = 0/139 (0%)
Frame = +1/+1
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*IFLL 288
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL *IFIEMTQ*IFLL
Sbjct 37 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVLL*IFIEMTQ*IFLL 216
Query 289 VLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NP 468
V YCLIRKILLVKVQ+ +H +H*PPS *ET+Q*L F*IQWV+ FLIQVESM +ALG *N
Sbjct 217 VPYCLIRKILLVKVQLSMH*VH*PPSP*ETVQ*LPF*IQWVMLFLIQVESMCSALGL*NL 396
Query 469 LLQV*LTDNLSQKHCKQVL 525
LLQV*LT NL QKHCKQVL
Sbjct 397 LLQV*LTGNLYQKHCKQVL 453
Score = 75.8 bits (159), Expect(3) = 2e-90
Identities = 36/58 (62%), Positives = 40/58 (68%), Gaps = 0/58 (0%)
Frame = +3/+3
Query 1068 STNVISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLELAQ 1241
+TN+ISITDGQIALSADLFLSGI PAI + G +YVA SYKLELAQ
Sbjct 579 ATNIISITDGQIALSADLFLSGILPAIRCWIICNTCGFCRSMVWNEYVAGSYKLELAQ 752
Score = 51.0 bits (105), Expect(3) = 2e-90
Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 0/30 (0%)
Frame = +2/+1
Query 986 VIIQSWWG*SYFFPSY*NISRRSFWLHKHK 1075
VIIQSWW * Y FP+ *NISRR F LHK +
Sbjct 496 VIIQSWWW*PYLFPNC*NISRRCFRLHKQQ 585
Score = 167 bits (359), Expect(5) = 6e-78
Identities = 81/94 (86%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
Frame = -1/-3
Query 498 QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLDQ 319
QI CQLYLEQ IL PKG+ HRFYLN*K* YPLDLE KLL SLLG*WWLV LMH LNLDQ
Sbjct 426 QIACQLYLEQEIL*PKGTAHRFYLN*K*HYPLDLEWKLLHSLLG*WWLVNLMHGQLNLDQ 247
Query 318 EDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 217
EDFPD*AI+HQ*EDSLCHLDKDL QDQWRSFVW*
Sbjct 246 EDFPD*AIRHQ*EDSLCHLDKDLQQDQWRSFVW* 145
Score = 55.1 bits (114), Expect(5) = 6e-78
Identities = 23/29 (79%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
Frame = -1/-1
Query 1071 CLCSQKDLLLMFQ*LGKK*DYPHQDCMIT 985
CLCS K LLLMFQ LG K* Y HQDCMIT
Sbjct 581 CLCSLKHLLLMFQQLGNK*GYHHQDCMIT 495
Score = 55.1 bits (114), Expect(5) = 6e-78
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-2
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 169 PMEELCVVKTSEMNAINNPSNV 104
Score = 48.3 bits (99), Expect(5) = 6e-78
Identities = 20/26 (76%), Positives = 20/26 (76%), Gaps = 0/26 (0%)
Frame = -3/-1
Query 1225 LYEAATYFIPYH*AAEPTRVTDNPTS 1148
L A FIPYH* AEPTRVTDNPTS
Sbjct 737 LIRACHIFIPYH*PAEPTRVTDNPTS 660
Score = 48.3 bits (99), Expect(5) = 6e-78
Identities = 22/31 (70%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
Frame = -2/-1
Query 1145 SWLNSR*K*VCR*SYLTISN*DDICAYVARK 1053
SW N+ *K*VCR*SYLTISN DDIC + K
Sbjct 656 SWKNT**K*VCR*SYLTISNRDDICCLCSLK 564
Score = 177 bits (382), Expect(5) = 3e-73
Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
Frame = +2/+2
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNESSYWC 292
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC KSLSR*HNESSYWC
Sbjct 41 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCCKSLSR*HNESSYWC 220
Query 293 FIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
IA*SGKSSWSRF C CI +TSHHHPRRLCN
Sbjct 221 LIA*SGKSSWSRFNCPCIKFTSHHHPRRLCN 313
Score = 62.0 bits (129), Expect(5) = 3e-73
Identities = 26/33 (78%), Positives = 27/33 (81%), Gaps = 0/33 (0%)
Frame = +2/+2
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCY 526
R*NRC +PLG RI CSRYN*Q IC RSIANR Y
Sbjct 356 R*NRCAVPLGYRISCSRYN*QAICIRSIANRSY 454
Score = 45.1 bits (92), Expect(5) = 3e-73
Identities = 17/19 (89%), Positives = 18/19 (94%), Gaps = 0/19 (0%)
Frame = +3/+1
Query 1146 IDVGLSVTRVGSAAQWYGM 1202
+DVGLSVTRVGSA QWYGM
Sbjct 658 LDVGLSVTRVGSAGQWYGM 714
Score = 43.2 bits (88), Expect(5) = 3e-73
Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
Frame = +1/+1
Query 1072 QMSSQLLMVK*LYLQTYFYLEFNQL 1146
Q+SS LLMVK*LYLQTYFY F QL
Sbjct 583 QISSLLLMVK*LYLQTYFYQVFFQL 657
Score = 29.9 bits (59), Expect(5) = 3e-73
Identities = 24/29 (82%), Positives = 26/29 (89%), Gaps = 0/29 (0%)
Frame = +1/+3
Query 985 SYHTIlvgvvlllsqllKH*QEIFLAT*A 1071
SYHTILV V LL+SQLLKH*QE+F AT*A
Sbjct 495 SYHTILVVVALLVSQLLKH*QEMFQAT*A 581
Score = 152 bits (326), Expect(5) = 6e-56
Identities = 66/80 (82%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
Frame = -3/-2
Query 526 ITPVCNASVTDCLSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMMVASVA 347
I PVCNAS TDCLSIIPGAGDSIAQG TSILPELK+ LPTGSR+EAIA+SPR+MVAS
Sbjct 454 IRPVCNASDTDCLSIIPGAGDSIAQGHCTSILPELKITLPTGSRMEAIAQSPRVMVASEL 275
Query 346 DARTLEP*PRGFSGLSNKAP 287
+A T+EP*PRGFSGLSNKAP
Sbjct 274 NAWTVEP*PRGFSGLSNKAP 215
Score = 54.2 bits (112), Expect(5) = 6e-56
Identities = 24/29 (82%), Positives = 24/29 (82%), Gaps = 0/29 (0%)
Frame = -2/-2
Query 1070 AYVARKISC*CFNNWERSKTTPTKIV**L 984
AYVA ISC*CFNNWE SK T TKIV**L
Sbjct 580 AYVA*NISC*CFNNWETSKATTTKIV**L 494
Score = 40.5 bits (82), Expect(5) = 6e-56
Identities = 19/24 (79%), Positives = 21/24 (87%), Gaps = 0/24 (0%)
Frame = -1/-3
Query 1137 EFQIEISLQIKLFDHQ*LR*HLCL 1066
E+ IEISLQIKLFDHQ* R*+L L
Sbjct 648 EYLIEISLQIKLFDHQ**R*YLLL 577
Score = 26.3 bits (51), Expect(5) = 6e-56
Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
Frame = -1/-3
Query 1239 EQALAYTKLPHI 1204
EQALAY LPHI
Sbjct 750 EQALAYKSLPHI 715
Score = 26.3 bits (51), Expect(5) = 6e-56
Identities = 9/10 (90%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
Frame = -1/-2
Query 1203 SFHTIELQNP 1174
SFHTI+LQNP
Sbjct 715 SFHTIDLQNP 686
> zoox2_rep_c31983
Length=736
Score = 366 bits (794), Expect = 4e-101
Identities = 158/173 (91%), Positives = 167/173 (96%), Gaps = 0/173 (0%)
Frame = +3/+1
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 299
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL
Sbjct 61 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 240
Query 300 LNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPG 479
LNPENPLGQGS+V A ++LATI LGD AIASILDPVGN+IFNSGRIDV CPWAIESPAPG
Sbjct 241 LNPENPLGQGSTVHALSSLATITLGDCAIASILDPVGNVIFNSGRIDVQCPWAIESPAPG 420
Query 480 IIDRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGKTSICIDTILNQKY 638
IIDRQSV+EALQTG+IAIDSSIPIGCGQRELI+GDRQTGKTSI +D+ILNQKY
Sbjct 421 IIDRQSVSEALQTGLIAIDSSIPIGCGQRELIVGDRQTGKTSISMDSILNQKY 579
Score = 312 bits (675), Expect = 1e-84
Identities = 152/177 (85%), Positives = 159/177 (89%), Gaps = 0/177 (0%)
Frame = +1/+2
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*IFLL 288
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL *IFIEMTQ*IFLL
Sbjct 50 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVLL*IFIEMTQ*IFLL 229
Query 289 VLYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NP 468
V YCLIRKILLVKVQ+ +H +H*PPS *ET+Q*L F*IQWV+ FLIQVESM +ALG *N
Sbjct 230 VPYCLIRKILLVKVQLSMH*VH*PPSP*ETVQ*LPF*IQWVMLFLIQVESMCSALGL*NL 409
Query 469 LLQV*LTDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQVKHPFA*IRSLIKSI 639
LLQV*LT NL QKHCKQVL*L*IQVYQ*DVVREN* LVIVRQVKHP I SLIKSI
Sbjct 410 LLQV*LTGNLYQKHCKQVL*L*IQVYQ*DVVREN*LLVIVRQVKHPSPWIASLIKSI 580
Score = 261 bits (565), Expect(2) = 3e-82
Identities = 115/133 (86%), Positives = 118/133 (88%), Gaps = 0/133 (0%)
Frame = -2/-2
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT 339
CLQCF RL VNYTWSR FY PRA +IDST*IKN ITHWI*N SYC VS* DGG* +*C
Sbjct 459 CLQCF*YRLPVNYTWSRRFYSPRALHIDST*IKNNITHWI*NGSYCTVS*GDGG**T*CM 280
Query 338 HT*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN 159
+*TLTKRIFRIKQ* TNKKIHCVISIKIY KTNGGALCGKNL*DECH**SF*CDYSTTN
Sbjct 279 DS*TLTKRIFRIKQ*GTNKKIHCVISIKIYNKTNGGALCGKNL*DECH**SF*CDYSTTN 100
Query 158 *DYNSIN*NVLFN 120
*DYNSIN*NVLFN
Sbjct 99 *DYNSIN*NVLFN 61
Score = 63.4 bits (132), Expect(2) = 3e-82
Identities = 24/29 (82%), Positives = 26/29 (89%), Gaps = 0/29 (0%)
Frame = -1/-1
Query 639 YTFD*GSYLCKWMFYLSDDHQELILSDHI 553
YTFD*G Y +WMFYLSDDHQ+LILSDHI
Sbjct 580 YTFD*GCYPWRWMFYLSDDHQQLILSDHI 494
Score = 177 bits (382), Expect(2) = 2e-79
Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
Frame = +2/+3
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNESSYWC 292
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC KSLSR*HNESSYWC
Sbjct 54 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCCKSLSR*HNESSYWC 233
Query 293 FIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
IA*SGKSSWSRF C CI +TSHHHPRRLCN
Sbjct 234 LIA*SGKSSWSRFNCPCIKFTSHHHPRRLCN 326
Score = 138 bits (295), Expect(2) = 2e-79
Identities = 60/71 (84%), Positives = 61/71 (85%), Gaps = 0/71 (0%)
Frame = +2/+3
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR*NIH 607
R*NRC +PLG RI CSRYN*Q IC RSIANR YSYRFKYTNRMWSERIN W*SSDR*NIH
Sbjct 369 R*NRCAVPLGYRISCSRYN*QAICIRSIANRSYSYRFKYTNRMWSERINCW*SSDR*NIH 548
Query 608 LHRYDP*SKV* 640
LH P*SKV*
Sbjct 549 LHG*HP*SKV* 581
Score = 226 bits (488), Expect(2) = 3e-69
Identities = 100/118 (84%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
Frame = -3/-3
Query 640 LYF*LRIVSMQMDVLPV*RSPRINSL*PHPIGILESIAITPVCNASVTDCLSIIPGAGDS 461
LYF*LR++SM+MDVLPV*RSP INSL*PHPIGILESIAI PVCNAS TDCLSIIPGAGDS
Sbjct 581 LYF*LRMLSMEMDVLPV*RSPTINSL*PHPIGILESIAIRPVCNASDTDCLSIIPGAGDS 402
Query 460 IAQGQLTSILPELKMRLPTGSRIEAIAESPRMMVASVADARTLEP*PRGFSGLSNKAP 287
IAQG TSILPELK+ LPTGSR+EAIA+SPR+MVAS +A T+EP*PRGFSGLSNKAP
Sbjct 401 IAQGHCTSILPELKITLPTGSRMEAIAQSPRVMVASELNAWTVEP*PRGFSGLSNKAP 228
Score = 55.1 bits (114), Expect(2) = 3e-69
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-3
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 182 PMEELCVVKTSEMNAINNPSNV 117
Score = 167 bits (359), Expect(2) = 2e-49
Identities = 81/94 (86%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
Frame = -1/-1
Query 498 QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLDQ 319
QI CQLYLEQ IL PKG+ HRFYLN*K* YPLDLE KLL SLLG*WWLV LMH LNLDQ
Sbjct 439 QIACQLYLEQEIL*PKGTAHRFYLN*K*HYPLDLEWKLLHSLLG*WWLVNLMHGQLNLDQ 260
Query 318 EDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 217
EDFPD*AI+HQ*EDSLCHLDKDL QDQWRSFVW*
Sbjct 259 EDFPD*AIRHQ*EDSLCHLDKDLQQDQWRSFVW* 158
Score = 48.3 bits (99), Expect(2) = 2e-49
Identities = 19/24 (79%), Positives = 21/24 (87%), Gaps = 0/24 (0%)
Frame = -2/-2
Query 638 ILLIKDRIYANGCFTCLTITKN*F 567
ILLIKD I+ +GCFTCLTIT N*F
Sbjct 579 ILLIKDAIHGDGCFTCLTITNN*F 508
> zoox2_s56556
Length=487
Score = 270 bits (583), Expect(2) = 2e-90
Identities = 121/121 (100%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
Frame = +3/+2
Query 1080 ISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLELAQFVELQS 1259
ISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLELAQFVELQS
Sbjct 125 ISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLELAQFVELQS 304
Query 1260 FSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLEALAVEDVR 1439
FSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLEALAVEDVR
Sbjct 305 FSQFAADLGQESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLEALAVEDVR 484
Query 1440 L 1442
L
Sbjct 485 L 487
Score = 85.4 bits (180), Expect(2) = 2e-90
Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
Frame = +3/+2
Query 99 PTNIVELIEKDILIYGVIISVGCGVVTLEGLLMAFIS 209
PTNIVELIEKDILIYGVIISVGCGVVTLEGLLMAFIS
Sbjct 20 PTNIVELIEKDILIYGVIISVGCGVVTLEGLLMAFIS 130
Score = 264 bits (572), Expect(2) = 7e-89
Identities = 120/121 (99%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
Frame = -2/-1
Query 1439 AYIFNC*SF*KILIS**QYANLSH*TYWRSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E 1260
AYIFNC*SF*KILIS**QYANLSH*TYWRSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E
Sbjct 484 AYIFNC*SF*KILIS**QYANLSH*TYWRSIGLF*HFYKS*SSC*FILAFLS*ISCKL*E 305
Query 1259 *L*FNKLSKL*LIRSCHIFHSIPLSCRTHTCYR*SYIYSWLNSR*K*VCR*SYLTISN*D 1080
*L*FNKLSKL*LIRSCHIFHSIPLSCRTHTCYR*SYIYSWLNSR*K*VCR*SYLTISN*D
Sbjct 304 *L*FNKLSKL*LIRSCHIFHSIPLSCRTHTCYR*SYIYSWLNSR*K*VCR*SYLTISN*D 125
Query 1079 D 1077
+
Sbjct 124 E 122
Score = 84.9 bits (179), Expect(2) = 7e-89
Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
Frame = -2/-1
Query 209 *DECH**SF*CDYSTTN*DYNSIN*NVLFN*LHDVGR 99
*DECH**SF*CDYSTTN*DYNSIN*NVLFN*LHDVGR
Sbjct 130 *DECH**SF*CDYSTTN*DYNSIN*NVLFN*LHDVGR 20
Score = 257 bits (556), Expect(3) = 4e-76
Identities = 109/112 (97%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
Frame = -3/-2
Query 1405 F*LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSS 1226
F*LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSS
Sbjct 450 F*LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSCPRSAANCENDCNSTN*ASSS 271
Query 1225 LYEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEMTFV 1070
LYEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEM +
Sbjct 270 LYEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSVIEMNAI 115
Score = 41.4 bits (84), Expect(3) = 4e-76
Identities = 13/14 (92%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
Frame = -1/-3
Query 135 ECPFQLTPRCWSGQ 94
ECPFQLTPRCWSG+
Sbjct 56 ECPFQLTPRCWSGR 15
Score = 29.0 bits (57), Expect(3) = 4e-76
Identities = 11/11 (100%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
Frame = -3/-2
Query 208 EMNAINNPSNV 176
EMNAINNPSNV
Sbjct 129 EMNAINNPSNV 97
Score = 136 bits (291), Expect(3) = 1e-70
Identities = 52/52 (100%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
Frame = +2/+1
Query 1079 HLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMVWNEICGSFV*ARA 1234
HLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMVWNEICGSFV*ARA
Sbjct 124 HLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCSSMVWNEICGSFV*ARA 279
Score = 90.0 bits (190), Expect(3) = 1e-70
Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
Frame = +1/+3
Query 1279 I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 1395
I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH*
Sbjct 324 I*DKKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 440
Score = 83.1 bits (175), Expect(3) = 1e-70
Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
Frame = +1/+3
Query 100 RPTSWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQ 210
RPTSWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQ
Sbjct 21 RPTSWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQ 131
Score = 240 bits (518), Expect(2) = 4e-66
Identities = 121/121 (100%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
Frame = -1/-3
Query 1440 GVHLQLLKLLEDFD*LMTICQLVPLNLLEIHWIVLAFLQVVILLLIYSCFLVLDQLQIVR 1261
GVHLQLLKLLEDFD*LMTICQLVPLNLLEIHWIVLAFLQVVILLLIYSCFLVLDQLQIVR
Sbjct 485 GVHLQLLKLLEDFD*LMTICQLVPLNLLEIHWIVLAFLQVVILLLIYSCFLVLDQLQIVR 306
Query 1260 MIVIQQIEQALAYTKLPHISFHTIELQNPhvlqiilhl*lVEFQIEISLQIKLFDHQ*LR 1081
MIVIQQIEQALAYTKLPHISFHTIELQNPHVLQIILHL*LVEFQIEISLQIKLFDHQ*LR
Sbjct 305 MIVIQQIEQALAYTKLPHISFHTIELQNPHVLQIILHL*LVEFQIEISLQIKLFDHQ*LR 126
Query 1080 * 1078
*
Sbjct 125 * 123
Score = 33.6 bits (67), Expect(2) = 4e-66
Identities = 15/19 (78%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
Frame = -3/-2
Query 136 RMSFSINSTMLVGXKLRWV 80
RMSFSINSTMLVG L +V
Sbjct 57 RMSFSINSTMLVGPPLFYV 1
Score = 112 bits (239), Expect(3) = 2e-53
Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
Frame = +1/+3
Query 1078 SSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQLRI 1224
SSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQLRI
Sbjct 123 SSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQLRI 269
Score = 85.8 bits (181), Expect(3) = 2e-53
Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
Frame = +2/+1
Query 1292 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 1393
KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI
Sbjct 337 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 438
Score = 53.8 bits (111), Expect(3) = 2e-53
Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
Frame = +2/+1
Query 98 PDQHRGVN*KGHsnlwsynlswlwssHIRRIINGIHL 208
PDQHRGVN*KGHSNLWSYNLSWLWSSHIRRIINGIHL
Sbjct 19 PDQHRGVN*KGHSNLWSYNLSWLWSSHIRRIINGIHL 129
> zoox2_c34779
Length=1106
Score = 127 bits (271), Expect(5) = 4e-79
Identities = 54/117 (46%), Positives = 78/117 (66%), Gaps = 0/117 (0%)
Frame = +3/-3
Query 285 IGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIE 464
+G ++ + + +G SV+ + T+ + +G+ + ++D +G I +G I + +E
Sbjct 1029 VGVVVFGDDRAIVEGDSVKCTGTIVDVPIGEELLGRVVDALGTPIDGAGPIKTTTRRRVE 850
Query 465 SPAPGIIDRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGKTSICIDTILNQK 635
APGII RQSV E + TG+ A+DS IPIG GQRELI+GDRQTGKT+I IDTILNQK
Sbjct 849 LKAPGIIPRQSVHEPMTTGLKAVDSLIPIGRGQRELIIGDRQTGKTAIAIDTILNQK 679
Score = 86.3 bits (182), Expect(5) = 4e-79
Identities = 33/56 (58%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
Frame = +3/-3
Query 843 SLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGG 1010
+++ DDLS+ A AYR++ LLLRRP GREAYPG++F++HSRLLER+AK++ GG
Sbjct 450 AVIFYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNEETMGG 283
Score = 67.5 bits (141), Expect(5) = 4e-79
Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 0/35 (0%)
Frame = +3/-3
Query 999 LGGGSLTSFPVIETLAGDLSGYISTNVISITDGQI 1103
+GGGSLT+ PVIET AGD+S YI TNVISITDGQI
Sbjct 291 MGGGSLTALPVIETQAGDVSAYIPTNVISITDGQI 187
Score = 47.3 bits (97), Expect(5) = 4e-79
Identities = 20/33 (60%), Positives = 26/33 (78%), Gaps = 0/33 (0%)
Frame = +3/-2
Query 1107 LSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMK 1205
L +LF GI+PA++VGLSV+RVGSAAQ M+
Sbjct 184 LETELFYKGIRPAVNVGLSVSRVGSAAQIKAME 86
Score = 41.8 bits (85), Expect(5) = 4e-79
Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
Frame = +3/-3
Query 699 FLSLLQKDAIFYFSMLVATASSSAVCQYLCAYSGAALSEFFMITGE 836
F L + D + Y +++ ATAS +A Q+L Y+G A++E+F G+
Sbjct 591 FEVLRKNDCLKYTTVVAATASDAAPLQFLAPYTGCAMAEYFRDNGK 454
Score = 66.6 bits (139), Expect(4) = 2e-25
Identities = 37/88 (42%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
Frame = -3/+2
Query 634 F*LRIVSMQMDVLPV*RSPRINSL*PHPIGILESIAITPVCNASVTDCLSIIPGAGDSIA 455
F* R+VSM M V PV RSP ++S P P+GI S A+ PV S T C +IPGA S
Sbjct 680 F*FRMVSMAMAVFPVCRSPMMSSRWPRPMGIKLSTALRPVVMGSCTLCRGMIPGAFSSTR 859
Query 454 QGQLTSILPELKMRLPTGSRIEAIAESP 371
+ + I P M +P S SP
Sbjct 860 RRVVVLIGPAPSMGVPNASTTRPNNSSP 943
Score = 47.8 bits (98), Expect(4) = 2e-25
Identities = 22/32 (68%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
Frame = -3/+2
Query 1096 PSVIEMTFVLM*PERSPANVSITGKEVRLPPP 1001
PSV+EMTFV M* SPA VS+TG+ VR PPP
Sbjct 194 PSVMEMTFVGM*ALTSPACVSMTGRAVREPPP 289
Score = 32.7 bits (65), Expect(4) = 2e-25
Identities = 16/28 (57%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
Frame = -3/+3
Query 1189 *AAEPTRVTDNPTSIAG*IPDRNKSADK 1106
*AA PTR+TD PT AG IP N S +
Sbjct 102 *AALPTRLTDRPTFTAGRIPL*NSSVSR 185
Score = 31.3 bits (62), Expect(4) = 2e-25
Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 0/39 (0%)
Frame = -3/+2
Query 973 SKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRDKSS 857
S+ RE SPG*AS P G + I A AC D+SS
Sbjct 320 SRRRECK*KTSPG*ASRPGGRRRSKDIWRYATACLDRSS 436
> zoox2_s78027
Length=480
Score = 292 bits (632), Expect = 9e-79
Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
Frame = +3/+1
Query 126 KDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALLLN 305
KDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALLLN
Sbjct 52 KDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALLLN 231
Query 306 PENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPGII 485
PENPLGQGS+V A ++LATI LGD AIASILDPVGN+IFNSGRIDV CPWAIESPAPGII
Sbjct 232 PENPLGQGSTVHALSSLATITLGDCAIASILDPVGNVIFNSGRIDV*CPWAIESPAPGII 411
Query 486 DRQSVTEALQTGVIAIDSS 542
DRQSV+EALQTG+IAIDSS
Sbjct 412 DRQSVSEALQTGLIAIDSS 468
Score = 256 bits (553), Expect = 7e-68
Identities = 113/131 (86%), Positives = 116/131 (88%), Gaps = 0/131 (0%)
Frame = -2/-1
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT 339
CLQCF RL VNYTWSR FY PRA +IDST*IKN ITHWI*N SYC VS* DGG* +*C
Sbjct 444 CLQCF*YRLPVNYTWSRRFYSPRALHIDST*IKNNITHWI*NGSYCTVS*GDGG**T*CM 265
Query 338 HT*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN 159
+*TLTKRIFRIKQ* TNKKIHCVISIKIY KTNGGALCGKNL*DECH**SF*CDYSTTN
Sbjct 264 DS*TLTKRIFRIKQ*GTNKKIHCVISIKIYNKTNGGALCGKNL*DECH**SF*CDYSTTN 85
Query 158 *DYNSIN*NVL 126
*DYNSIN*NVL
Sbjct 84 *DYNSIN*NVL 52
Score = 251 bits (542), Expect = 2e-66
Identities = 121/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
Frame = +1/+2
Query 121 LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*IFLLVLYC 300
++RTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL *IFIEMTQ*IFLLV YC
Sbjct 47 IERTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVLL*IFIEMTQ*IFLLVPYC 226
Query 301 LIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NPLLQV 480
LIRKILLVKVQ+ +H +H*PPS *ET+Q*L F*IQWV+ FLIQVESM +ALG *N LLQV
Sbjct 227 LIRKILLVKVQLSMH*VH*PPSP*ETVQ*LPF*IQWVMLFLIQVESMCSALGL*NLLLQV 406
Query 481 *LTDNLSQKHCKQVL*L*IQV 543
*LT NL QKHCKQVL*L*IQV
Sbjct 407 *LTGNLYQKHCKQVL*L*IQV 469
Score = 173 bits (372), Expect(2) = 6e-59
Identities = 81/87 (93%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
Frame = +2/+3
Query 125 KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNESSYWCFIA* 304
KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC KSLSR*HNESSYWC IA*
Sbjct 51 KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCCKSLSR*HNESSYWCLIA* 230
Query 305 SGKSSWSRFKCACISYTSHHHPRRLCN 385
SGKSSWSRF C CI +TSHHHPRRLCN
Sbjct 231 SGKSSWSRFNCPCIKFTSHHHPRRLCN 311
Score = 73.9 bits (155), Expect(2) = 6e-59
Identities = 31/38 (81%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
Frame = +2/+3
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFK 541
R*NRC +PLG RI CSRYN*Q IC RSIANR YSYRFK
Sbjct 354 R*NRCVVPLGYRISCSRYN*QAICIRSIANRSYSYRFK 467
Score = 167 bits (359), Expect(2) = 1e-51
Identities = 81/94 (86%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
Frame = -1/-3
Query 498 QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLDQ 319
QI CQLYLEQ IL PKG+ HRFYLN*K* YPLDLE KLL SLLG*WWLV LMH LNLDQ
Sbjct 424 QIACQLYLEQEIL*PKGTTHRFYLN*K*HYPLDLEWKLLHSLLG*WWLVNLMHGQLNLDQ 245
Query 318 EDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 217
EDFPD*AI+HQ*EDSLCHLDKDL QDQWRSFVW*
Sbjct 244 EDFPD*AIRHQ*EDSLCHLDKDLQQDQWRSFVW* 143
Score = 55.1 bits (114), Expect(2) = 1e-51
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-2
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 167 PMEELCVVKTSEMNAINNPSNV 102
Score = 161 bits (347), Expect = 2e-39
Identities = 71/85 (83%), Positives = 77/85 (90%), Gaps = 0/85 (0%)
Frame = -3/-2
Query 541 LESIAITPVCNASVTDCLSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAESPRMM 362
LESIAI PVCNAS TDCLSIIPGAGDSIAQG TSILPELK+ LPTGSR+EAIA+SPR+M
Sbjct 467 LESIAIRPVCNASDTDCLSIIPGAGDSIAQGHYTSILPELKITLPTGSRMEAIAQSPRVM 288
Query 361 VASVADARTLEP*PRGFSGLSNKAP 287
VAS +A T+EP*PRGFSGLSNKAP
Sbjct 287 VASELNAWTVEP*PRGFSGLSNKAP 213
> zoox2_s59544
Length=435
Score = 226 bits (488), Expect(3) = 2e-70
Identities = 97/98 (98%), Positives = 97/98 (98%), Gaps = 0/98 (0%)
Frame = +3/+3
Query 306 PENPLGQGSSVRASATLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPGII 485
PENPLGQGSSVRAS TLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPGII
Sbjct 3 PENPLGQGSSVRASVTLATIILGDSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPGII 182
Query 486 DRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGK 599
DRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGK
Sbjct 183 DRQSVTEALQTGVIAIDSSIPIGCGQRELILGDRQTGK 296
Score = 56.1 bits (116), Expect(3) = 2e-70
Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
Frame = +1/+3
Query 598 KHPFA*IRSLIKSIGLYSLSTPLLVKAHQALYKS 699
KHPFA*IRSLIKS GLYS L +AHQALYKS
Sbjct 294 KHPFA*IRSLIKSXGLYSTVYTSLGQAHQALYKS 395
Score = 22.1 bits (42), Expect(3) = 2e-70
Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%)
Frame = +2/+2
Query 716 KRCYLLLL 739
KRCYLLLL
Sbjct 410 KRCYLLLL 433
Score = 220 bits (475), Expect(2) = 1e-68
Identities = 97/98 (98%), Positives = 97/98 (98%), Gaps = 0/98 (0%)
Frame = -3/-3
Query 598 LPV*RSPRINSL*PHPIGILESIAITPVCNASVTDCLSIIPGAGDSIAQGQLTSILPELK 419
LPV*RSPRINSL*PHPIGILESIAITPVCNASVTDCLSIIPGAGDSIAQGQLTSILPELK
Sbjct 295 LPV*RSPRINSL*PHPIGILESIAITPVCNASVTDCLSIIPGAGDSIAQGQLTSILPELK 116
Query 418 MRLPTGSRIEAIAESPRMMVASVADARTLEP*PRGFSG 305
MRLPTGSRIEAIAESPRMMVASV DARTLEP*PRGFSG
Sbjct 115 MRLPTGSRIEAIAESPRMMVASVTDARTLEP*PRGFSG 2
Score = 59.3 bits (123), Expect(2) = 1e-68
Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 0/41 (0%)
Frame = -1/-2
Query 720 LFVEEIERLVECLMSFDQERCRQ*IQTYTFD*GSYLCKWMF 598
+F RLVECLMS + IQT TFD*GSYLCKWMF
Sbjct 416 IFCRRDRRLVECLMSLTKRGVDSRIQTXTFD*GSYLCKWMF 294
Score = 204 bits (440), Expect(3) = 6e-64
Identities = 97/97 (100%), Positives = 97/97 (100%), Gaps = 0/97 (0%)
Frame = +1/+1
Query 307 RKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NPLLQV*L 486
RKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NPLLQV*L
Sbjct 4 RKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQWVISFLIQVESM*AALGR*NPLLQV*L 183
Query 487 TDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQV 597
TDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQV
Sbjct 184 TDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQV 294
Score = 56.1 bits (116), Expect(3) = 6e-64
Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
Frame = +2/+1
Query 599 NIHLHRYDP*SKV*VCIHCLHLSWSKLIKHSTSL 700
NIHLHRYDP*SKV*VCI KLIKHSTSL
Sbjct 295 NIHLHRYDP*SKV*VCIRLSTPLLVKLIKHSTSL 396
Score = 22.1 bits (42), Expect(3) = 6e-64
Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%)
Frame = +3/+3
Query 717 KDAIFYFS 740
KDAIFYFS
Sbjct 411 KDAIFYFS 434
Score = 174 bits (375), Expect(3) = 4e-58
Identities = 70/71 (98%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
Frame = -2/-2
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CS*CT 339
CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*C+*CT
Sbjct 215 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRVS*DDGG*CN*CT 36
Query 338 HT*TLTKRIFR 306
HT*TLTKRIFR
Sbjct 35 HT*TLTKRIFR 3
Score = 51.9 bits (107), Expect(3) = 4e-58
Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 0/34 (0%)
Frame = -3/-1
Query 700 KTCRVLDEL*PREV*TVNTDLYF*LRIVSMQMDV 599
KTCRVLDEL NTDL F*LRIVSMQMDV
Sbjct 396 KTCRVLDELDQERCRQSNTDLXF*LRIVSMQMDV 295
Score = 36.3 bits (73), Expect(3) = 4e-58
Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
Frame = -1/-1
Query 597 YLSDDHQELILSDHI 553
YLSDDHQE ILSDHI
Sbjct 294 YLSDDHQESILSDHI 250
Score = 141 bits (302), Expect(4) = 1e-57
Identities = 56/57 (98%), Positives = 57/57 (100%), Gaps = 0/57 (0%)
Frame = +2/+2
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR* 598
R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERI+SW*SSDR*
Sbjct 125 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERIDSW*SSDR* 295
Score = 76.2 bits (160), Expect(4) = 1e-57
Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
Frame = +2/+2
Query 305 SGKSSWSRFKCACISYTSHHHPRRLCN 385
SGKSSWSRFKCACISYTSHHHPRRLCN
Sbjct 2 SGKSSWSRFKCACISYTSHHHPRRLCN 82
Score = 39.1 bits (79), Expect(4) = 1e-57
Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
Frame = +3/+2
Query 600 TSICIDTILNQKYRSVF 650
TSICIDTILNQK RSVF
Sbjct 296 TSICIDTILNQKXRSVF 346
Score = 23.1 bits (44), Expect(4) = 1e-57
Identities = 7/7 (100%), Positives = 7/7 (100%), Gaps = 0/7 (0%)
Frame = +2/+2
Query 653 CLHLSWS 673
CLHLSWS
Sbjct 350 CLHLSWS 370
Score = 124 bits (266), Expect(3) = 2e-39
Identities = 65/66 (98%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
Frame = -1/-1
Query 501 *QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPldleskllqslLG*WWLV*LMHAHLNLD 322
*QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPLDLESKLLQSLLG*WWLV*LMHAHLNLD
Sbjct 198 *QIVCQLYLEQGILSPKGSLHRFYLN*K*DYPLDLESKLLQSLLG*WWLV*LMHAHLNLD 19
Query 321 QEDFPD 304
QEDFP+
Sbjct 18 QEDFPE 1
Score = 48.7 bits (100), Expect(3) = 2e-39
Identities = 24/34 (70%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
Frame = -2/-3
Query 701 KDL*SA**ALTKRGVDSEYRPILLIKDRIYANGC 600
+DL*SA**A + EYRP LLIKDRIYANGC
Sbjct 397 EDL*SA**A*PREV*TVEYRPXLLIKDRIYANGC 296
Score = 26.3 bits (51), Expect(3) = 2e-39
Identities = 10/11 (90%), Positives = 10/11 (90%), Gaps = 0/11 (0%)
Frame = -2/-2
Query 599 FTCLTITKN*F 567
FTCLTITKN F
Sbjct 296 FTCLTITKNQF 264
> zoox2_rep_c78602
Length=460
Score = 171 bits (368), Expect(3) = 1e-66
Identities = 75/89 (84%), Positives = 78/89 (87%), Gaps = 0/89 (0%)
Frame = +2/+3
Query 584 SSDR*NIHLHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQF 763
SSDR*NIHLH P*SKV IHCLHLSWSKLIKHSTSLSI TKRCYLLLLNARG+SQF
Sbjct 3 SSDR*NIHLHG*HP*SKVQRRIHCLHLSWSKLIKHSTSLSIPCTKRCYLLLLNARGHSQF 182
Query 764 ICCLSILMCL*RCSFV*ILYDNW*ISFFA 850
ICCLSILMCL* C FV*ILYDNW*I+F +
Sbjct 183 ICCLSILMCL*WCCFV*ILYDNW*IAFLS 269
Score = 82.2 bits (173), Expect(3) = 1e-66
Identities = 33/47 (70%), Positives = 38/47 (80%), Gaps = 0/47 (0%)
Frame = +2/+1
Query 893 NIPPIEKTSWKRSLSRRNILCPFSTFRKVCQVIIQSWWG*SYFFPSY 1033
NIPPIEKTSWKRSLSRRNILC FSTFRKVC+V+I +G + +Y
Sbjct 286 NIPPIEKTSWKRSLSRRNILCAFSTFRKVCKVVISITYGQ*LYLQTY 426
Score = 38.2 bits (77), Expect(3) = 1e-66
Identities = 17/18 (94%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
Frame = +3/+3
Query 1101 IALSADLFLSGIQPAIDV 1154
IALSADLFLSGI PAIDV
Sbjct 405 IALSADLFLSGILPAIDV 458
Score = 158 bits (340), Expect(3) = 1e-61
Identities = 73/87 (83%), Positives = 77/87 (88%), Gaps = 0/87 (0%)
Frame = -2/-2
Query 842 RKFTSYHKEFRQSCTAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKR 663
R+FTS HKEFRQS T IST*VLTDSR*TGC HEH*EVEDSIFL K *KDL*SA**ALTKR
Sbjct 261 RQFTSCHKEFRQSSTTIST*VLTDSR*TGCGHEH*EVEDSIFLYKG*KDL*SA**ALTKR 82
Query 662 GVDSEYRPILLIKDRIYANGCFTCLTI 582
GVDSEY +LLIKD I+ +GCFTCLTI
Sbjct 81 GVDSEYGAVLLIKDVIHGDGCFTCLTI 1
Score = 73.9 bits (155), Expect(3) = 1e-61
Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
Frame = -3/-2
Query 991 DNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRDKSSSISKE 842
DN ADLSKSRE TKNISPG*ASLPAGLLNRRYI L + A + +S KE
Sbjct 384 DNFADLSKSRECTKNISPG*ASLPAGLLNRRYIYLTSMARGRQFTSCHKE 235
Score = 42.3 bits (86), Expect(3) = 1e-61
Identities = 18/19 (94%), Positives = 18/19 (94%), Gaps = 0/19 (0%)
Frame = -3/-1
Query 1156 PTSIAG*IPDRNKSADKAI 1100
PTSIAG IPDRNKSADKAI
Sbjct 460 PTSIAGRIPDRNKSADKAI 404
Score = 154 bits (331), Expect(3) = 1e-60
Identities = 80/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
Frame = +3/+1
Query 582 DRQTGKTSICIDTILNQKYRSVFTVYtslgqsssstlqVFLSLLQKDAIFYFSMLVATAS 761
DRQTGKTSI +D ILNQKY +VFTVYTSLGQSSSSTLQVFLSL+QKDAIFYFSMLVATAS
Sbjct 1 DRQTGKTSISMDNILNQKYSAVFTVYTSLGQSSSSTLQVFLSLVQKDAIFYFSMLVATAS 180
Query 762 SSAVCQYLCAYSGAALSEFFMITGEFPS 845
SSAVCQYLCAYSGAALSEFFM TGE PS
Sbjct 181 SSAVCQYLCAYSGAALSEFFMTTGELPS 264
Score = 79.4 bits (167), Expect(3) = 1e-60
Identities = 35/39 (89%), Positives = 35/39 (89%), Gaps = 0/39 (0%)
Frame = +3/+2
Query 876 ACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLS 992
A R IYLLLRRPAGREAYPGEIFFVHSRLLERSAKLS
Sbjct 269 AMLVR*IYLLLRRPAGREAYPGEIFFVHSRLLERSAKLS 385
Score = 37.3 bits (75), Expect(3) = 1e-60
Identities = 15/18 (83%), Positives = 16/18 (88%), Gaps = 0/18 (0%)
Frame = +2/+2
Query 1100 NSFICRLISIWNSTSYRC 1153
NSFICRLISI S+SYRC
Sbjct 404 NSFICRLISIRYSSSYRC 457
Score = 180 bits (388), Expect(3) = 2e-53
Identities = 82/93 (88%), Positives = 88/93 (94%), Gaps = 0/93 (0%)
Frame = -3/-3
Query 862 SSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRVL 683
S + +EGNSPV+IKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFC RDRKTCRVL
Sbjct 281 SQAWREEGNSPVVIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCTRDRKTCRVL 102
Query 682 DEL*PREV*TVNTDLYF*LRIVSMQMDVLPV*R 584
DEL*PREV*TVNT LYF*LR++SM+MDVLPV*R
Sbjct 101 DEL*PREV*TVNTALYF*LRMLSMEMDVLPV*R 3
Score = 34.5 bits (69), Expect(3) = 2e-53
Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 0/33 (0%)
Frame = -2/-1
Query 986 LGRPF*KSRMDKEYfswisfssswsSQ*EVYFS 888
L RPF*KSRM KEYFSWISFSSSWSSQ*EVY S
Sbjct 379 LCRPF*KSRMHKEYFSWISFSSSWSSQ*EVYLS 281
Score = 32.2 bits (64), Expect(3) = 2e-53
Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
Frame = -2/-3
Query 1151 IYSWLNSR*K*VCR*SY 1101
IYSW N+ *K*VCR*SY
Sbjct 455 IYSWKNT**K*VCR*SY 405
Score = 138 bits (297), Expect(3) = 2e-51
Identities = 62/73 (84%), Positives = 62/73 (84%), Gaps = 0/73 (0%)
Frame = +1/+2
Query 583 IVRQVKHPFA*IRSLIKSIGLYSLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPV 762
IVRQVKHP I SLIKS YSLSTPLLVKAHQALYKSFY YKKMLSSTSQCSW QPV
Sbjct 2 IVRQVKHPSPWITSLIKSTAPYSLSTPLLVKAHQALYKSFYPLYKKMLSSTSQCSWPQPV 181
Query 763 HLLSVNTYVLIAV 801
HLLSVNTYVLI V
Sbjct 182 HLLSVNTYVLIVV 220
Score = 70.7 bits (148), Expect(3) = 2e-51
Identities = 31/35 (88%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
Frame = +1/+3
Query 889 EKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYH 993
+KYTSY*EDQLEEKLIQEKYSL ILDF*KGL S H
Sbjct 282 DKYTSY*EDQLEEKLIQEKYSLCILDF*KGLQSCH 386
Score = 30.9 bits (61), Expect(3) = 2e-51
Identities = 14/18 (77%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
Frame = +1/+1
Query 1099 K*LYLQTYFYLEFNQL*M 1152
+*LYLQTYFY F QL*M
Sbjct 403 Q*LYLQTYFYQVFFQL*M 456
Score = 176 bits (379), Expect(2) = 5e-44
Identities = 76/97 (78%), Positives = 83/97 (85%), Gaps = 0/97 (0%)
Frame = -1/-1
Query 873 VEINHQV*AKKEIHQLS*RIQTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERL 694
V ++H+ +K IHQLS*RIQTK H YKHISIDRQQMNWL PRALRSRR*HLFV+ IERL
Sbjct 292 VYLSHKHGERKAIHQLS*RIQTKQHHYKHISIDRQQMNWLWPRALRSRR*HLFVQGIERL 113
Query 693 VECLMSFDQERCRQ*IQTYTFD*GSYLCKWMFYLSDD 583
VECLMSFDQERCRQ*I+ TFD*G Y +WMFYLSDD
Sbjct 112 VECLMSFDQERCRQ*IRRCTFD*GCYPWRWMFYLSDD 2
Score = 23.5 bits (45), Expect(2) = 5e-44
Identities = 10/12 (83%), Positives = 11/12 (91%), Gaps = 0/12 (0%)
Frame = -1/-2
Query 1137 EFQIEISLQIKL 1102
E+ IEISLQIKL
Sbjct 441 EYLIEISLQIKL 406
Score = 73.5 bits (154), Expect = 8e-13
Identities = 34/47 (72%), Positives = 36/47 (76%), Gaps = 0/47 (0%)
Frame = -1/-3
Query 993 MITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV 853
M T QTFLKVEN QRIFLLDKLLFQLVFSIGGIF+ + E N V
Sbjct 386 MTTLQTFLKVENAQRIFLLDKLLFQLVFSIGGIFISQAWREEGNSPV 246
> zoox2_c20434
Length=423
Score = 169 bits (363), Expect(3) = 3e-63
Identities = 74/87 (85%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
Frame = +2/+1
Query 590 DR*NIHLHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRCYLLLLNARGYSQFIC 769
DR*NIHLH P*SKV* IHCLHLSWSKLIKHSTSLSI TKRCYLLLLNARG+SQFIC
Sbjct 1 DR*NIHLHG*HP*SKV*RRIHCLHLSWSKLIKHSTSLSIPCTKRCYLLLLNARGHSQFIC 180
Query 770 CLSILMCL*RCSFV*ILYDNW*ISFFA 850
CLSILMCL* C FV*ILYDNW*I F +
Sbjct 181 CLSILMCL*WCCFV*ILYDNW*IXFLS 261
Score = 72.1 bits (151), Expect(3) = 3e-63
Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 0/31 (0%)
Frame = +2/+2
Query 893 NIPPIEKTSWKRSLSRRNILCPFSTFRKVCQ 985
NIPPIEKTSWKRSLSRRNILC FSTFRKV Q
Sbjct 278 NIPPIEKTSWKRSLSRRNILCAFSTFRKVLQ 370
Score = 39.1 bits (79), Expect(3) = 3e-63
Identities = 14/16 (87%), Positives = 14/16 (87%), Gaps = 0/16 (0%)
Frame = +2/+2
Query 1076 CHLNY*WSNSFICRLI 1123
CHL Y WSNSFICRLI
Sbjct 374 CHLYYLWSNSFICRLI 421
Score = 178 bits (383), Expect(3) = 5e-62
Identities = 81/91 (89%), Positives = 86/91 (94%), Gaps = 0/91 (0%)
Frame = -3/-1
Query 862 SSSISKEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCRRDRKTCRVL 683
S + +EGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFC RDRKTCRVL
Sbjct 273 SQAWREEGNSPVIIKNSDKAAPL*AHKY*QTADELAVATSIEK*KIASFCTRDRKTCRVL 94
Query 682 DEL*PREV*TVNTDLYF*LRIVSMQMDVLPV 590
DEL*PREV*TVNT LYF*LR++SM+MDVLPV
Sbjct 93 DEL*PREV*TVNTALYF*LRMLSMEMDVLPV 1
Score = 62.0 bits (129), Expect(3) = 5e-62
Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
Frame = -3/-3
Query 976 LSKSREWTKNISPG*ASLPAGLLNRRYISL 887
LSKSRE TKNISPG*ASLPAGLLNRRYI L
Sbjct 361 LSKSRECTKNISPG*ASLPAGLLNRRYIYL 272
Score = 35.9 bits (72), Expect(3) = 5e-62
Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
Frame = -1/-1
Query 1125 EISLQIKLFDHQ*LR*HLC 1069
EISLQIKLFDH+* R* LC
Sbjct 423 EISLQIKLFDHK**R*QLC 367
Score = 157 bits (337), Expect(3) = 7e-57
Identities = 72/84 (85%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
Frame = -2/-3
Query 842 RKFTSYHKEFRQSCTAIST*VLTDSR*TGCSHEH*EVEDSIFL*KR*KDL*SA**ALTKR 663
R FTSYHKEFRQS T IST*VLTDSR*TGC HEH*EVEDSIFL K *KDL*SA**ALTKR
Sbjct 253 RXFTSYHKEFRQSSTTIST*VLTDSR*TGCGHEH*EVEDSIFLYKG*KDL*SA**ALTKR 74
Query 662 GVDSEYRPILLIKDRIYANGCFTC 591
GVDSEY ILLIKD I+ +GCFTC
Sbjct 73 GVDSEYGAILLIKDAIHGDGCFTC 2
Score = 68.0 bits (142), Expect(3) = 7e-57
Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 0/42 (0%)
Frame = -1/-1
Query 978 TFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV 853
TFLKVEN QRIFLLDKLLFQLVFSIGGIF+ + E N V
Sbjct 363 TFLKVENAQRIFLLDKLLFQLVFSIGGIFISQAWREEGNSPV 238
Score = 33.6 bits (67), Expect(3) = 7e-57
Identities = 15/16 (93%), Positives = 15/16 (93%), Gaps = 0/16 (0%)
Frame = -2/-2
Query 1124 K*VCR*SYLTISN*DD 1077
K*VCR*SYLTISN DD
Sbjct 422 K*VCR*SYLTISNRDD 375
Score = 149 bits (321), Expect(3) = 1e-54
Identities = 78/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
Frame = +3/+2
Query 591 TGKTSICIDTILNQKYRSVFTVYtslgqsssstlqVFLSLLQKDAIFYFSMLVATASSSA 770
TGKTSI +D+ILNQKY +VFTVYTSLGQSSSSTLQVFLSL+QKDAIFYFSMLVATASSSA
Sbjct 2 TGKTSISMDSILNQKYSAVFTVYTSLGQSSSSTLQVFLSLVQKDAIFYFSMLVATASSSA 181
Query 771 VCQYLCAYSGAALSEFFMITGEFPS 845
VCQYLCAYSGAALSEFFMITGE PS
Sbjct 182 VCQYLCAYSGAALSEFFMITGELPS 256
Score = 64.8 bits (135), Expect(3) = 1e-54
Identities = 28/30 (93%), Positives = 29/30 (96%), Gaps = 0/30 (0%)
Frame = +1/+1
Query 889 EKYTSY*EDQLEEKLIQEKYSLSILDF*KG 978
+KYTSY*EDQLEEKLIQEKYSL ILDF*KG
Sbjct 274 DKYTSY*EDQLEEKLIQEKYSLCILDF*KG 363
Score = 36.8 bits (74), Expect(3) = 1e-54
Identities = 16/19 (84%), Positives = 18/19 (94%), Gaps = 0/19 (0%)
Frame = +1/+1
Query 1069 AQMSSQLLMVK*LYLQTYF 1125
A++SS LLMVK*LYLQTYF
Sbjct 367 AKLSSLLLMVK*LYLQTYF 423
Score = 173 bits (372), Expect(3) = 1e-50
Identities = 74/94 (78%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
Frame = -1/-2
Query 873 VEINHQV*AKKEIHQLS*RIQTKLHRYKHISIDRQQMNWL*PRALRSRR*HLFVEEIERL 694
V ++H+ +K IHQLS*RIQTK H YKHISIDRQQMNWL PRALRSRR*HLFV+ IERL
Sbjct 284 VYLSHKHGERKXIHQLS*RIQTKQHHYKHISIDRQQMNWLWPRALRSRR*HLFVQGIERL 105
Query 693 VECLMSFDQERCRQ*IQTYTFD*GSYLCKWMFYL 592
VECLMSFDQERCRQ*I+ YTFD*G Y +WMFYL
Sbjct 104 VECLMSFDQERCRQ*IRRYTFD*GCYPWRWMFYL 3
Score = 32.7 bits (65), Expect(3) = 1e-50
Identities = 15/16 (93%), Positives = 15/16 (93%), Gaps = 0/16 (0%)
Frame = -3/-3
Query 1123 NKSADKAI*PSVIEMT 1076
NKSADKAI*P VIEMT
Sbjct 421 NKSADKAI*P*VIEMT 374
Score = 31.8 bits (63), Expect(3) = 1e-50
Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
Frame = -2/-2
Query 977 PF*KSRMDKEYfswisfssswsSQ*EVYFS 888
PF*KSRM KEYFSWISFSSSWSSQ*EVY S
Sbjct 362 PF*KSRMHKEYFSWISFSSSWSSQ*EVYLS 273
Score = 135 bits (289), Expect(2) = 3e-47
Identities = 60/70 (85%), Positives = 60/70 (85%), Gaps = 0/70 (0%)
Frame = +1/+3
Query 592 QVKHPFA*IRSLIKSIGLYSLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLL 771
QVKHP I SLIKSI YSLSTPLLVKAHQALYKSFY YKKMLSSTSQCSW QPVHLL
Sbjct 3 QVKHPSPWIASLIKSIAPYSLSTPLLVKAHQALYKSFYPLYKKMLSSTSQCSWPQPVHLL 182
Query 772 SVNTYVLIAV 801
SVNTYVLI V
Sbjct 183 SVNTYVLIVV 212
Score = 73.0 bits (153), Expect(2) = 3e-47
Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 0/47 (0%)
Frame = +3/+3
Query 876 ACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNLGGGSL 1016
A R IYLLLRRPAGREAYPGEIFFVHSRLLER K+ ++ G +
Sbjct 261 AMLVR*IYLLLRRPAGREAYPGEIFFVHSRLLERYCKVVISITYGQI 401
> zoox2_s68779
Length=485
Score = 221 bits (476), Expect = 3e-57
Identities = 98/112 (87%), Positives = 104/112 (92%), Gaps = 0/112 (0%)
Frame = -3/-2
Query 709 RDRKTCRVLDEL*PREV*TVNTDLYF*LRIVSMQMDVLPV*RSPRINSL*PHPIGILESI 530
RDRKTCRVLDEL*PRE *TVNT LYF*LR++SM+MDVLPV*RSP INSL*PHPIGILESI
Sbjct 337 RDRKTCRVLDEL*PREA*TVNTALYF*LRMLSMEMDVLPV*RSPTINSL*PHPIGILESI 158
Query 529 AITPVCNASVTDCLSIIPGAGDSIAQGQLTSILPELKMRLPTGSRIEAIAES 374
AI PVCNAS TDCLSIIPGAGDSIAQG TSILPELK+ LPTGSR+EAIA+S
Sbjct 157 AIRPVCNASDTDCLSIIPGAGDSIAQGHCTSILPELKITLPTGSRMEAIAQS 2
Score = 207 bits (447), Expect = 3e-53
Identities = 100/113 (88%), Positives = 108/113 (95%), Gaps = 0/113 (0%)
Frame = +3/+3
Query 375 DSAIASILDPVGNLIFNSGRIDVSCPWAIESPAPGIIDRQSVTEALQTGVIAIDSSIPIG 554
D AIASILDPVGN+IFNSGRIDV CPWAIESPAPGIIDRQSV+EALQTG+IAIDSSIPIG
Sbjct 3 DCAIASILDPVGNVIFNSGRIDVQCPWAIESPAPGIIDRQSVSEALQTGLIAIDSSIPIG 182
Query 555 CGQRELILGDRQTGKTSICIDTILNQKYRSVFTVYtslgqsssstlqVFLSLL 713
CGQRELI+GDRQTGKTSI +D+ILNQKY +VFTVY SLGQSSSSTLQVFLSL+
Sbjct 183 CGQRELIVGDRQTGKTSISMDSILNQKYSAVFTVYASLGQSSSSTLQVFLSLV 341
Score = 191 bits (411), Expect = 3e-48
Identities = 94/111 (84%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
Frame = +1/+1
Query 373 ETLQ*LRF*IQWVISFLIQVESM*AALGR*NPLLQV*LTDNLSQKHCKQVL*L*IQVYQ* 552
ET+Q*L F*IQWV+ FLIQVESM +ALG *N LLQV*LT NL QKHCKQVL*L*IQVYQ*
Sbjct 1 ETVQ*LPF*IQWVMLFLIQVESMCSALGL*NLLLQV*LTGNLYQKHCKQVL*L*IQVYQ* 180
Query 553 DVVREN*FLVIVRQVKHPFA*IRSLIKSIGLYSLSTPLLVKAHQALYKSFY 705
DVVREN* LVIVRQVKHP I SLIKSI YSLSTPLLVKAHQALYKSFY
Sbjct 181 DVVREN*LLVIVRQVKHPSPWIASLIKSIAPYSLSTPLLVKAHQALYKSFY 333
Score = 181 bits (390), Expect = 2e-45
Identities = 80/97 (82%), Positives = 81/97 (83%), Gaps = 0/97 (0%)
Frame = +2/+2
Query 428 R*NRCKLPLGDRIPCSRYN*QTICHRSIANRCYSYRFKYTNRMWSERINSW*SSDR*NIH 607
R*NRC +PLG RI CSRYN*Q IC RSIANR YSYRFKYTNRMWSERIN W*SSDR*NIH
Sbjct 56 R*NRCAVPLGYRISCSRYN*QAICIRSIANRSYSYRFKYTNRMWSERINCW*SSDR*NIH 235
Query 608 LHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTK 718
LH P*SKV* IHCL LSWSKLIKHSTSLSI K
Sbjct 236 LHG*HP*SKV*RRIHCLRLSWSKLIKHSTSLSIPCDK 346
Score = 103 bits (220), Expect(2) = 5e-44
Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
Frame = -1/-3
Query 705 IERLVECLMSFDQERCRQ*IQTYTFD*GSYLCKWMFYLSDDHQELILSDHI 553
IERLVECLMSFDQER RQ*I+ YTFD*G Y +WMFYLSDDHQ+LILSDHI
Sbjct 333 IERLVECLMSFDQERRRQ*IRRYTFD*GCYPWRWMFYLSDDHQQLILSDHI 181
Score = 93.6 bits (198), Expect(2) = 5e-44
Identities = 38/48 (79%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
Frame = -2/-1
Query 518 CLQCFCDRLSVNYTWSRGFYRPRAAYIDST*IKNEITHWI*NRSYCRV 375
CLQCF RL VNYTWSR FY PRA +IDST*IKN ITHWI*N SYC V
Sbjct 146 CLQCF*YRLPVNYTWSRRFYSPRALHIDST*IKNNITHWI*NGSYCTV 3
Score = 85.8 bits (181), Expect(2) = 1e-28
Identities = 40/48 (83%), Positives = 42/48 (87%), Gaps = 0/48 (0%)
Frame = -2/-1
Query 710 KR*KDL*SA**ALTKRGVDSEYRPILLIKDRIYANGCFTCLTITKN*F 567
K *KDL*SA**ALTKRGVDSEY ILLIKD I+ +GCFTCLTIT N*F
Sbjct 338 KG*KDL*SA**ALTKRGVDSEYGAILLIKDAIHGDGCFTCLTITNN*F 195
Score = 59.7 bits (124), Expect(2) = 1e-28
Identities = 25/31 (80%), Positives = 26/31 (83%), Gaps = 0/31 (0%)
Frame = -1/-3
Query 498 QIVCQLYLEQGILSPKGSLHRFYLN*K*DYP 406
QI CQLYLEQ IL PKG+ HRFYLN*K* YP
Sbjct 126 QIACQLYLEQEIL*PKGTAHRFYLN*K*HYP 34
> zoox2_c22253
Length=622
Score = 149 bits (320), Expect(3) = 8e-55
Identities = 64/73 (87%), Positives = 64/73 (87%), Gaps = 0/73 (0%)
Frame = +2/+2
Query 506 SIANRCYSYRFKYTNRMWSERINSW*SSDR*NIHLHRYDP*SKV*VCIHCLHLSWSKLIK 685
SIANR YSYRFKYTNRMWSERIN W*SSDR*NIHLH P*SKV* IHCLHLSWSKLIK
Sbjct 362 SIANRSYSYRFKYTNRMWSERINCW*SSDR*NIHLHG*HP*SKV*RXIHCLHLSWSKLIK 541
Query 686 HSTSLSISSTKRC 724
HSTSLSI TKRC
Sbjct 542 HSTSLSIPCTKRC 580
Score = 65.7 bits (137), Expect(3) = 8e-55
Identities = 29/31 (93%), Positives = 30/31 (96%), Gaps = 0/31 (0%)
Frame = +1/+3
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WH 201
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WH
Sbjct 228 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WH 320
Score = 41.8 bits (85), Expect(3) = 8e-55
Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
Frame = +2/+3
Query 203 HLRGFYHTKLLHWS 244
HLRGFYHTKLLHWS
Sbjct 318 HLRGFYHTKLLHWS 359
Score = 143 bits (307), Expect(3) = 7e-51
Identities = 64/73 (87%), Positives = 67/73 (91%), Gaps = 0/73 (0%)
Frame = -3/-1
Query 724 ASFCRRDRKTCRVLDEL*PREV*TVNTDLYF*LRIVSMQMDVLPV*RSPRINSL*PHPIG 545
ASFC RDRKTCRVLDEL*PREV*TVN L F*LR++SM+MDVLPV*RSP INSL*PHPIG
Sbjct 580 ASFCTRDRKTCRVLDEL*PREV*TVNXALXF*LRMLSMEMDVLPV*RSPTINSL*PHPIG 401
Query 544 ILESIAITPVCNA 506
ILESIAI PVCNA
Sbjct 400 ILESIAIRPVCNA 362
Score = 63.8 bits (133), Expect(3) = 7e-51
Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
Frame = -2/-1
Query 200 CH**SF*CDYSTTN*DYNSIN*NVLFN 120
CH**SF*CDYSTTN*DYNSIN*NVLFN
Sbjct 319 CH**SF*CDYSTTN*DYNSIN*NVLFN 239
Score = 36.3 bits (73), Expect(3) = 7e-51
Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
Frame = -2/-2
Query 245 KTNGGALCGKNL*D 204
KTNGGALCGKNL*D
Sbjct 360 KTNGGALCGKNL*D 319
Score = 137 bits (293), Expect(3) = 6e-49
Identities = 64/80 (80%), Positives = 67/80 (83%), Gaps = 0/80 (0%)
Frame = +1/+1
Query 487 TDNLSQKHCKQVL*L*IQVYQ*DVVREN*FLVIVRQVKHPFA*IRSLIKSIGLYSLSTPL 666
+ ++ KHCKQVL*L*IQVYQ*DVVREN* LVIVRQVKHP I SLIKS YSLSTPL
Sbjct 343 SSSIGLKHCKQVL*L*IQVYQ*DVVREN*LLVIVRQVKHPSPWIASLIKSXAPYSLSTPL 522
Query 667 LVKAHQALYKSFYLFYKKML 726
LVKAHQALYKSFY YKKML
Sbjct 523 LVKAHQALYKSFYPLYKKML 582
Score = 62.9 bits (131), Expect(3) = 6e-49
Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
Frame = +3/+2
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMA 200
IEKDILIYGVIISVGCGVVTLEGLLMA
Sbjct 239 IEKDILIYGVIISVGCGVVTLEGLLMA 319
Score = 37.3 bits (75), Expect(3) = 6e-49
Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
Frame = +1/+2
Query 202 SSQRFLPHKAPPLVL 246
+SQRFLPHKAPPLVL
Sbjct 317 ASQRFLPHKAPPLVL 361
Score = 116 bits (247), Expect(3) = 9e-32
Identities = 63/74 (85%), Positives = 70/74 (94%), Gaps = 0/74 (0%)
Frame = +3/+3
Query 507 ALQTGVIAIDSSIPIGCGQRELILGDRQTGKTSICIDTILNQKYRSVFTVYtslgqssss 686
ALQTG+IAIDSSIPIGCGQRELI+GDRQTGKTSI +D+ILNQK + FTVYTSLGQSSSS
Sbjct 363 ALQTGLIAIDSSIPIGCGQRELIVGDRQTGKTSISMDSILNQKXSAXFTVYTSLGQSSSS 542
Query 687 tlqVFLSLLQKDAI 728
TLQVFLSL+QKDA+
Sbjct 543 TLQVFLSLVQKDAV 584
Score = 32.2 bits (64), Expect(3) = 9e-32
Identities = 14/14 (100%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
Frame = +3/+1
Query 204 ISEVFTTQSSSIGL 245
ISEVFTTQSSSIGL
Sbjct 319 ISEVFTTQSSSIGL 360
Score = 30.9 bits (61), Expect(3) = 9e-32
Identities = 29/30 (96%), Positives = 29/30 (96%), Gaps = 0/30 (0%)
Frame = +2/+1
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGI 202
G N*KGHSNLWSYNLSWLWSSHIRRIINGI
Sbjct 232 GHN*KGHSNLWSYNLSWLWSSHIRRIINGI 321
Score = 114 bits (244), Expect(3) = 3e-29
Identities = 47/57 (82%), Positives = 50/57 (87%), Gaps = 0/57 (0%)
Frame = -1/-2
Query 723 HLFVEEIERLVECLMSFDQERCRQ*IQTYTFD*GSYLCKWMFYLSDDHQELILSDHI 553
HLFV+ IERLVECLMSFDQERCRQ*I TFD*G Y +WMFYLSDDHQ+LILSDHI
Sbjct 579 HLFVQGIERLVECLMSFDQERCRQ*IXRXTFD*GCYPWRWMFYLSDDHQQLILSDHI 409
Score = 34.1 bits (68), Expect(3) = 3e-29
Identities = 14/16 (87%), Positives = 14/16 (87%), Gaps = 0/16 (0%)
Frame = -3/-3
Query 241 PMEELCVVKTSEMNAI 194
PMEELCVVKTSEM I
Sbjct 356 PMEELCVVKTSEMPLI 309
Score = 22.1 bits (42), Expect(3) = 3e-29
Identities = 8/9 (88%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
Frame = -3/-2
Query 202 NAINNPSNV 176
+AINNPSNV
Sbjct 321 DAINNPSNV 295
Score = 93.2 bits (197), Expect(2) = 3e-20
Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
Frame = -2/-3
Query 737 EVEDSIFL*KR*KDL*SA**ALTKRGVDSEYRPILLIKDRIYANGCFTCLTITKN*F 567
E+ SIFL K *KDL*SA**ALTKRGVDSEY LLIKD I+ +GCFTCLTIT N*F
Sbjct 593 EIHHSIFLYKG*KDL*SA**ALTKRGVDSEYGAXLLIKDAIHGDGCFTCLTITNN*F 423
Score = 27.2 bits (53), Expect(2) = 3e-20
Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
Frame = -1/-1
Query 243 DQWRSFVW* 217
DQWRSFVW*
Sbjct 358 DQWRSFVW* 332
> zoox2_s66101
Length=321
Score = 185 bits (399), Expect(2) = 6e-53
Identities = 79/87 (90%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
Frame = +3/+1
Query 1008 GSLTSFPVIETLAGDLSGYISTNVISITDGQIALSADLFLSGIQPAIDVGLSVTRVGSAA 1187
GSLT FP++ETLAGD+SGYISTN+ISITDGQIALSADLFLSGI PAIDVGLSVTRVGSA
Sbjct 4 GSLTCFPIVETLAGDVSGYISTNIISITDGQIALSADLFLSGILPAIDVGLSVTRVGSAG 183
Query 1188 QWYGMKYVAASYKLELAQFVELQSFSQ 1268
QWYGMKYVA SYKLELAQFVELQSFSQ
Sbjct 184 QWYGMKYVAGSYKLELAQFVELQSFSQ 264
Score = 41.4 bits (84), Expect(2) = 6e-53
Identities = 16/20 (80%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
Frame = +3/+3
Query 1263 SQFAADLGQESKNKLTRGLR 1322
+ FA+DLGQESKN+LTRGLR
Sbjct 261 TNFASDLGQESKNRLTRGLR 320
Score = 177 bits (380), Expect(2) = 2e-48
Identities = 77/88 (87%), Positives = 80/88 (90%), Gaps = 0/88 (0%)
Frame = -2/-1
Query 1268 L*E*L*FNKLSKL*LIRSCHIFHSIPLSCRTHTCYR*SYIYSWLNSR*K*VCR*SYLTIS 1089
L*E*L*FNKLSKL*LIR+CHIFHSIPL+CRTHTCYR*S IYSW N+ *K*VCR*SYLTIS
Sbjct 264 L*E*L*FNKLSKL*LIRACHIFHSIPLTCRTHTCYR*SNIYSWKNT**K*VCR*SYLTIS 85
Query 1088 N*DDICAYVARKISC*CFNNWERSKTTP 1005
N DDICAYVA ISC*CFNNWE SK TP
Sbjct 84 NRDDICAYVA*NISC*CFNNWETSKATP 1
Score = 35.0 bits (70), Expect(2) = 2e-48
Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
Frame = -3/-3
Query 1315 PLVNLFLLSCPRSAA 1271
PLVNLFLLSCPRS A
Sbjct 313 PLVNLFLLSCPRSDA 269
Score = 176 bits (378), Expect(2) = 7e-48
Identities = 78/87 (89%), Positives = 79/87 (90%), Gaps = 0/87 (0%)
Frame = -3/-2
Query 1267 CENDCNSTN*ASSSLYEAATYFIPYH*AAEPTRVTDNPTSIAG*IPDRNKSADKAI*PSV 1088
CENDCNSTN*ASSSL E ATYFIPYH* AEPTRVTDNPTSIAG IPDRNKSADKAI*PSV
Sbjct 263 CENDCNSTN*ASSSL*EPATYFIPYH*PAEPTRVTDNPTSIAGRIPDRNKSADKAI*PSV 84
Query 1087 IEMTFVLM*PERSPANVSITGKEVRLP 1007
IEM FVLM*PE SPANVS GK+VRLP
Sbjct 83 IEMIFVLM*PETSPANVSTIGKQVRLP 3
Score = 34.1 bits (68), Expect(2) = 7e-48
Identities = 13/15 (86%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
Frame = -1/-1
Query 1314 LLLIYSCFLVLDQLQ 1270
LLLIYSCFL LDQ+Q
Sbjct 312 LLLIYSCFLALDQMQ 268
Score = 144 bits (310), Expect(2) = 5e-35
Identities = 60/76 (78%), Positives = 63/76 (82%), Gaps = 0/76 (0%)
Frame = +2/+3
Query 1007 G*SYFFPSY*NISRRSFWLHKHKCHLNY*WSNSFICRLISIWNSTSYRCRIICNTCGFCS 1186
G* Y FP+ *NISRR F LHKHK HL Y*WSNSFICRLISI S+SYRC IICNTCGFC
Sbjct 3 G*PYLFPNC*NISRRCFRLHKHKYHLYY*WSNSFICRLISIRYSSSYRCWIICNTCGFCR 182
Query 1187 SMVWNEICGSFV*ARA 1234
SMVWNEICG +*ARA
Sbjct 183 SMVWNEICGRLL*ARA 230
Score = 22.1 bits (42), Expect(2) = 5e-35
Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
Frame = +1/+1
Query 1279 I*DKKARIN*QEDYD 1323
I* KKARI+*QE D
Sbjct 277 I*GKKARID*QEALD 321
Score = 134 bits (288), Expect(2) = 9e-34
Identities = 73/89 (82%), Positives = 77/89 (86%), Gaps = 0/89 (0%)
Frame = -1/-3
Query 1272 QIVRMIVIQQIEQALAYTKLPHISFHTIELQNPhvlqiilhl*lVEFQIEISLQIKLFDH 1093
+ VRMIVIQQIEQALAY LPHISFHTI+LQNPHVLQII HL*L E+ IEISLQIKLFDH
Sbjct 268 KFVRMIVIQQIEQALAYKSLPHISFHTIDLQNPHVLQIIQHL*LEEYLIEISLQIKLFDH 89
Query 1092 Q*LR*HLCLCSQKDLLLMFQ*LGKK*DYP 1006
Q* R*+LCLCS K LLLMFQ LG K* YP
Sbjct 88 Q**R*YLCLCSLKHLLLMFQQLGNK*GYP 2
Score = 28.1 bits (55), Expect(2) = 9e-34
Identities = 13/19 (68%), Positives = 15/19 (78%), Gaps = 0/19 (0%)
Frame = -2/-2
Query 1316 SSC*FILAFLS*ISCKL*E 1260
+SC* ILAFL *I CK+ E
Sbjct 314 ASC*SILAFLP*IRCKICE 258
Score = 112 bits (239), Expect = 2e-24
Identities = 52/63 (82%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
Frame = +1/+2
Query 1036 KH*QEIFLAT*AQMSSQLLMVK*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQ 1215
KH*QE+F AT*AQ+SS LLMVK*LYLQTYFY F QL*M DYL*HVWVLQ+NGME*NMWQ
Sbjct 32 KH*QEMFQAT*AQISSLLLMVK*LYLQTYFYQVFFQL*MLDYL*HVWVLQVNGME*NMWQ 211
Query 1216 LRI 1224
I
Sbjct 212 ALI 220
> zoox2_rep_c44965
Length=464
Score = 132 bits (283), Expect(2) = 4e-47
Identities = 58/60 (96%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
Frame = +3/+3
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 299
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGA +
Sbjct 51 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGAFI 230
Score = 75.3 bits (158), Expect(2) = 4e-47
Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
Frame = +3/+1
Query 282 LIGALLLNPENPLGQGSSVRASATLATIILGDSAIASILDPVGN 413
L+ LLLNPENPLGQGS+V A ++LATI LGD AIASILDPVG+
Sbjct 214 LLVPLLLNPENPLGQGSTVHALSSLATITLGDCAIASILDPVGH 345
Score = 133 bits (284), Expect(2) = 2e-46
Identities = 56/57 (98%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
Frame = -2/-1
Query 290 TNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN 120
TNKKIHCVISIKIY KTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN
Sbjct 221 TNKKIHCVISIKIYBKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN 51
Score = 72.5 bits (152), Expect(2) = 2e-46
Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
Frame = -3/-1
Query 409 PTGSRIEAIAESPRMMVASVADARTLEP*PRGFSGLSNK 293
PTGSR+EAIA+SPR+MVAS +A T+EP*PRGFSGLSNK
Sbjct 341 PTGSRMEAIAQSPRVMVASELNAWTVEP*PRGFSGLSNK 225
Score = 126 bits (269), Expect(2) = 4e-45
Identities = 58/61 (95%), Positives = 59/61 (96%), Gaps = 0/61 (0%)
Frame = +1/+1
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*IFLL 288
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL *IFIEMTQ*IFLL
Sbjct 40 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVLX*IFIEMTQ*IFLL 219
Query 289 V 291
V
Sbjct 220 V 222
Score = 74.8 bits (157), Expect(2) = 4e-45
Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
Frame = +2/+3
Query 293 FIA*SGKSSWSRFKCACISYTSHHHPRRLCN 385
FIA*SGKSSWSRF C CI +TSHHHPRRLCN
Sbjct 225 FIA*SGKSSWSRFNCPCIKFTSHHHPRRLCN 317
Score = 108 bits (231), Expect(2) = 2e-36
Identities = 58/60 (96%), Positives = 58/60 (96%), Gaps = 0/60 (0%)
Frame = +2/+2
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNESSYWC 292
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC KSLSR*HNESSYWC
Sbjct 44 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSCXKSLSR*HNESSYWC 223
Score = 62.9 bits (131), Expect(2) = 2e-36
Identities = 29/38 (76%), Positives = 33/38 (86%), Gaps = 0/38 (0%)
Frame = +1/+2
Query 292 LYCLIRKILLVKVQVCVHQLH*PPSS*ETLQ*LRF*IQ 405
LYCLIRKILLVKVQ+ +H +H*PPS *ET+Q* F*IQ
Sbjct 224 LYCLIRKILLVKVQLSMH*VH*PPSP*ETVQ*XPF*IQ 337
Score = 64.3 bits (134), Expect(3) = 1e-33
Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
Frame = -1/-3
Query 294 KHQ*EDSLCHLDKDLLQDQWRSFVW* 217
+HQ*EDSLCHLDKDL QDQWRSFVW*
Sbjct 225 RHQ*EDSLCHLDKDLXQDQWRSFVW* 148
Score = 61.1 bits (127), Expect(3) = 1e-33
Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
Frame = -2/-3
Query 422 KNEITHWI*NRSYCRVS*DDGG*CS*CTHT*TLTKRIFRIKQ* 294
++ +++WI*N YC VS* DGG* +*C +*TLTKRIFRIKQ*
Sbjct 354 EHRMSNWI*NGXYCTVS*GDGG**T*CMDS*TLTKRIFRIKQ* 226
Score = 55.1 bits (114), Expect(3) = 1e-33
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-2
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 172 PMEELCVVKTSEMNAINNPSNV 107
Score = 57.4 bits (119), Expect = 5e-08
Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
Frame = -1/-2
Query 369 G*WWLV*LMHAHLNLDQEDFPD*AIK 292
G*WWLV LMH LNLDQEDFPD*AIK
Sbjct 301 G*WWLVNLMHGQLNLDQEDFPD*AIK 224
> zoox2_rep_c47039
Length=487
Score = 160 bits (343), Expect(2) = 4e-41
Identities = 70/76 (92%), Positives = 72/76 (94%), Gaps = 0/76 (0%)
Frame = +3/+2
Query 1098 QIALSADLFLSGIQPAIDVGLSVTRVGSAAQWYGMKYVAASYKLELAQFVELQSFSQFAA 1277
QIALSADLFLSGI PAIDVGLSVTRVGSA QWYGMKYVA SYKLELAQFVELQSFSQFA+
Sbjct 194 QIALSADLFLSGILPAIDVGLSVTRVGSAGQWYGMKYVAGSYKLELAQFVELQSFSQFAS 373
Query 1278 DLGQESKNKLTRGLRL 1325
DLGQESKN+LTRGL L
Sbjct 374 DLGQESKNRLTRGLDL 421
Score = 27.6 bits (54), Expect(2) = 4e-41
Identities = 12/17 (70%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
Frame = +3/+1
Query 1305 LTRGLRLVEMLKQSNGS 1355
+ + LRLVE LKQSNGS
Sbjct 400 INKRLRLVE*LKQSNGS 450
Score = 155 bits (334), Expect(2) = 5e-40
Identities = 67/72 (93%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
Frame = -3/-2
Query 1315 PLVNLFLLSCPRSAANCENDCNSTN*ASSSLYEAATYFIPYH*AAEPTRVTDNPTSIAG* 1136
PLVNLFLLSCPRS ANCENDCNSTN*ASSSL E ATYFIPYH* AEPTRVTDNPTSIAG
Sbjct 411 PLVNLFLLSCPRSDANCENDCNSTN*ASSSL*EPATYFIPYH*PAEPTRVTDNPTSIAGR 232
Query 1135 IPDRNKSADKAI 1100
IPDRNKSADKAI
Sbjct 231 IPDRNKSADKAI 196
Score = 28.1 bits (55), Expect(2) = 5e-40
Identities = 11/18 (61%), Positives = 14/18 (77%), Gaps = 0/18 (0%)
Frame = -3/-3
Query 1360 IGDPLDCFSISTSRNPLV 1307
+ DPLDCFS STS + L+
Sbjct 455 LADPLDCFSHSTSLSLLL 402
Score = 138 bits (297), Expect(2) = 1e-34
Identities = 64/74 (86%), Positives = 68/74 (91%), Gaps = 0/74 (0%)
Frame = -2/-1
Query 1319 *SSC*FILAFLS*ISCKL*E*L*FNKLSKL*LIRSCHIFHSIPLSCRTHTCYR*SYIYSW 1140
*+SC* ILAFL *I CKL*E*L*FNKLSKL*LIR+CHIFHSIPL+CRTHTCYR*S IYSW
Sbjct 415 *ASC*SILAFLP*IRCKL*E*L*FNKLSKL*LIRACHIFHSIPLTCRTHTCYR*SNIYSW 236
Query 1139 LNSR*K*VCR*SYL 1098
N+ *K*VCR*SYL
Sbjct 235 KNT**K*VCR*SYL 194
Score = 27.2 bits (53), Expect(2) = 1e-34
Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
Frame = -2/-2
Query 1364 TYWRSIGLF*HFYKS 1320
T RSIGLF* FYKS
Sbjct 459 TLGRSIGLF*SFYKS 415
Score = 117 bits (250), Expect(2) = 2e-28
Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 0/72 (0%)
Frame = -1/-3
Query 1314 LLLIYSCFLVLDQLQIVRMIVIQQIEQALAYTKLPHISFHTIELQNPhvlqiilhl*lVE 1135
LLLIYSCFL LDQ+QIVRMIVIQQIEQALAY LPHISFHTI+LQNPHVLQII HL*L E
Sbjct 410 LLLIYSCFLALDQMQIVRMIVIQQIEQALAYKSLPHISFHTIDLQNPHVLQIIQHL*LEE 231
Query 1134 FQIEISLQIKLF 1099
+ IEISLQIKLF
Sbjct 230 YLIEISLQIKLF 195
Score = 27.2 bits (53), Expect(2) = 2e-28
Identities = 10/15 (66%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
Frame = -1/-1
Query 1365 NLLEIHWIVLAFLQV 1321
N +IHWIVL LQV
Sbjct 460 NTWQIHWIVLVILQV 416
Score = 93.2 bits (197), Expect(2) = 7e-21
Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 0/45 (0%)
Frame = +2/+1
Query 1100 NSFICRLISIWNSTSYRCRIICNTCGFCSSMVWNEICGSFV*ARA 1234
NSFICRLISI S+SYRC IICNTCGFC SMVWNEICG +*ARA
Sbjct 196 NSFICRLISIRYSSSYRCWIICNTCGFCRSMVWNEICGRLL*ARA 330
Score = 26.3 bits (51), Expect(2) = 7e-21
Identities = 9/11 (81%), Positives = 9/11 (81%), Gaps = 0/11 (0%)
Frame = +2/+3
Query 1322 TCRNAKTIQWI 1354
TCR KTIQWI
Sbjct 417 TCRMTKTIQWI 449
Score = 79.4 bits (167), Expect(2) = 1e-15
Identities = 35/42 (83%), Positives = 36/42 (85%), Gaps = 0/42 (0%)
Frame = +1/+3
Query 1099 K*LYLQTYFYLEFNQL*M*DYL*HVWVLQLNGME*NMWQLRI 1224
K*LYLQTYFY F QL*M DYL*HVWVLQ+NGME*NMWQ I
Sbjct 195 K*LYLQTYFYQVFFQL*MLDYL*HVWVLQVNGME*NMWQALI 320
Score = 22.6 bits (43), Expect(2) = 1e-15
Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
Frame = +1/+2
Query 1321 DL*KC*NNPMDL 1356
DL* *NNPMDL
Sbjct 416 DL*ND*NNPMDL 451
> zoox2_c20476
Length=420
Score = 85.4 bits (180), Expect(3) = 1e-40
Identities = 38/45 (84%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
Frame = +2/+1
Query 590 DR*NIHLHRYDP*SKV*VCIHCLHLSWSKLIKHSTSLSISSTKRC 724
DR*NIHLH P*SKV* IHCLHLSWSKLIKHSTSLSI TKRC
Sbjct 160 DR*NIHLHG*HP*SKV*RRIHCLHLSWSKLIKHSTSLSIPCTKRC 294
Score = 64.3 bits (134), Expect(3) = 1e-40
Identities = 25/27 (92%), Positives = 25/27 (92%), Gaps = 0/27 (0%)
Frame = +2/+3
Query 494 ICHRSIANRCYSYRFKYTNRMWSERIN 574
IC RSIANR YSYRFKYTNRMWSERIN
Sbjct 75 ICIRSIANRSYSYRFKYTNRMWSERIN 155
Score = 54.7 bits (113), Expect(3) = 1e-40
Identities = 21/24 (87%), Positives = 22/24 (91%), Gaps = 0/24 (0%)
Frame = +3/+1
Query 414 LIFNSGRIDVSCPWAIESPAPGII 485
+IFNSGRIDV CPWAIESPAP II
Sbjct 1 VIFNSGRIDVQCPWAIESPAPVII 72
Score = 92.7 bits (196), Expect(3) = 3e-37
Identities = 40/45 (88%), Positives = 43/45 (95%), Gaps = 0/45 (0%)
Frame = -3/-1
Query 724 ASFCRRDRKTCRVLDEL*PREV*TVNTDLYF*LRIVSMQMDVLPV 590
ASFC RDRKTCRVLDEL*PREV*TVNT LYF*LR++SM+MDVLPV
Sbjct 294 ASFCTRDRKTCRVLDEL*PREV*TVNTALYF*LRMLSMEMDVLPV 160
Score = 53.8 bits (111), Expect(3) = 3e-37
Identities = 23/27 (85%), Positives = 24/27 (88%), Gaps = 0/27 (0%)
Frame = -3/-2
Query 574 INSL*PHPIGILESIAITPVCNASVTD 494
INSL PHPIGILESIAI PVCNAS T+
Sbjct 155 INSLRPHPIGILESIAIRPVCNASDTN 75
Score = 46.0 bits (94), Expect(3) = 3e-37
Identities = 20/30 (66%), Positives = 23/30 (76%), Gaps = 0/30 (0%)
Frame = -3/-2
Query 505 SVTDCLSIIPGAGDSIAQGQLTSILPELKM 416
+ +D II GAGDSIAQG TSILPELK+
Sbjct 92 NASDTNEIITGAGDSIAQGHCTSILPELKI 3
Score = 81.7 bits (172), Expect(3) = 6e-32
Identities = 37/45 (82%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
Frame = +1/+3
Query 592 QVKHPFA*IRSLIKSIGLYSLSTPLLVKAHQALYKSFYLFYKKML 726
QVKHP I SLIKSI YSLSTPLLVKAHQALYKSFY YKKML
Sbjct 162 QVKHPSPWIASLIKSIAPYSLSTPLLVKAHQALYKSFYPLYKKML 296
Score = 56.5 bits (117), Expect(3) = 6e-32
Identities = 23/27 (85%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
Frame = +3/+1
Query 498 VTEALQTGVIAIDSSIPIGCGQRELIL 578
V+EALQTG+IAIDSSIPIGCG+RELI+
Sbjct 79 VSEALQTGLIAIDSSIPIGCGRRELIV 159
Score = 36.3 bits (73), Expect(3) = 6e-32
Identities = 14/19 (73%), Positives = 15/19 (78%), Gaps = 0/19 (0%)
Frame = +2/+3
Query 428 R*NRCKLPLGDRIPCSRYN 484
R*NRC +PLG RI CS YN
Sbjct 15 R*NRCAVPLGYRISCSSYN 71
Score = 91.3 bits (193), Expect(3) = 1e-25
Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 0/45 (0%)
Frame = -1/-2
Query 723 HLFVEEIERLVECLMSFDQERCRQ*IQTYTFD*GSYLCKWMFYLS 589
HLFV+ IERLVECLMSFDQERCRQ*I+ YTFD*G Y +WMFYLS
Sbjct 293 HLFVQGIERLVECLMSFDQERCRQ*IRRYTFD*GCYPWRWMFYLS 159
Score = 44.1 bits (90), Expect(3) = 1e-25
Identities = 17/23 (73%), Positives = 19/23 (82%), Gaps = 0/23 (0%)
Frame = -2/-1
Query 485 NYTWSRGFYRPRAAYIDST*IKN 417
+Y WSR FY PRA +IDST*IKN
Sbjct 72 DYNWSRRFYSPRALHIDST*IKN 4
Score = 21.7 bits (41), Expect(3) = 1e-25
Identities = 8/9 (88%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
Frame = -1/-3
Query 579 QELILSDHI 553
Q+LILSDHI
Sbjct 160 QQLILSDHI 134
Score = 60.6 bits (126), Expect(3) = 2e-23
Identities = 41/58 (70%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
Frame = +3/+2
Query 591 TGKTSICIDTILNQKYRSVFTVYtslgqsssstlqVFLSLLQKDAIFYFSMLVATASS 764
TGKTSI +D+ILNQKY +VFTVYTSLGQSSSSTLQVFLSL+QKDA + TA +
Sbjct 161 TGKTSISMDSILNQKYSAVFTVYTSLGQSSSSTLQVFLSLVQKDAASVVRSQLCTAQT 334
Score = 52.4 bits (108), Expect(3) = 2e-23
Identities = 25/29 (86%), Positives = 26/29 (89%), Gaps = 0/29 (0%)
Frame = +1/+2
Query 493 NLSQKHCKQVL*L*IQVYQ*DVVREN*FL 579
+L QKHCKQVL*L*IQVYQ*DVV EN* L
Sbjct 74 HLYQKHCKQVL*L*IQVYQ*DVVGEN*LL 160
Score = 32.7 bits (65), Expect(3) = 2e-23
Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
Frame = +1/+2
Query 418 FLIQVESM*AALGR*NPLLQV* 483
FLIQVESM +ALG *N LLQ+*
Sbjct 5 FLIQVESMCSALGL*NLLLQL* 70
Score = 78.0 bits (164), Expect(2) = 4e-20
Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 0/45 (0%)
Frame = -2/-3
Query 725 SIFL*KR*KDL*SA**ALTKRGVDSEYRPILLIKDRIYANGCFTC 591
SIFL K *KDL*SA**ALTKRGVDSEY ILLIKD I+ +GCFTC
Sbjct 295 SIFLYKG*KDL*SA**ALTKRGVDSEYGAILLIKDAIHGDGCFTC 161
Score = 39.1 bits (79), Expect(2) = 4e-20
Identities = 19/27 (70%), Positives = 21/27 (77%), Gaps = 0/27 (0%)
Frame = -1/-3
Query 495 IVCQLYLEQGILSPKGSLHRFYLN*K* 415
I +L LEQ IL PKG+ HRFYLN*K*
Sbjct 82 IQMRL*LEQEIL*PKGTAHRFYLN*K* 2
> zoox2_s71662
Length=452
Score = 165 bits (354), Expect = 2e-40
Identities = 72/73 (98%), Positives = 73/73 (100%), Gaps = 0/73 (0%)
Frame = +3/+2
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 299
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL
Sbjct 47 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLVVNLYRDDTMNLLIGALL 226
Query 300 LNPENPLGQGSSV 338
LNPENPLGQGS+V
Sbjct 227 LNPENPLGQGSTV 265
Score = 155 bits (334), Expect = 1e-37
Identities = 68/72 (94%), Positives = 69/72 (95%), Gaps = 0/72 (0%)
Frame = -2/-2
Query 335 T*TLTKRIFRIKQ*STNKKIHCVISIKIYYKTNGGALCGKNL*DECH**SF*CDYSTTN* 156
+*TLTKRIFRIKQ* TNKKIHCVISIKIY K NGGALCGKNL*DECH**SF*CDYSTTN*
Sbjct 262 S*TLTKRIFRIKQ*GTNKKIHCVISIKIYNKANGGALCGKNL*DECH**SF*CDYSTTN* 83
Query 155 DYNSIN*NVLFN 120
DYNSIN*NVLFN
Sbjct 82 DYNSIN*NVLFN 47
Score = 152 bits (327), Expect = 1e-36
Identities = 70/76 (92%), Positives = 72/76 (94%), Gaps = 0/76 (0%)
Frame = +1/+3
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFIEMTQ*IFLL 288
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPL L *IFIEMTQ*IFLL
Sbjct 36 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLALL*IFIEMTQ*IFLL 215
Query 289 VLYCLIRKILLVKVQV 336
V YCLIRKILLVKVQ+
Sbjct 216 VPYCLIRKILLVKVQL 263
Score = 137 bits (293), Expect = 5e-32
Identities = 70/75 (93%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
Frame = +2/+1
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSCSKSLSR*HNESSYWC 292
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHW C KSLSR*HNESSYWC
Sbjct 40 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWPCCKSLSR*HNESSYWC 219
Query 293 FIA*SGKSSWSRFKC 337
IA*SGKSSWSRF C
Sbjct 220 LIA*SGKSSWSRFNC 264
Score = 90.0 bits (190), Expect(2) = 2e-28
Identities = 36/39 (92%), Positives = 37/39 (94%), Gaps = 0/39 (0%)
Frame = -1/-1
Query 333 LNLDQEDFPD*AIKHQ*EDSLCHLDKDLLQDQWRSFVW* 217
LNLDQEDFPD*AI+HQ*EDSLCHLDKDL Q QWRSFVW*
Sbjct 260 LNLDQEDFPD*AIRHQ*EDSLCHLDKDLQQGQWRSFVW* 144
Score = 55.1 bits (114), Expect(2) = 2e-28
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-3
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 168 PMEELCVVKTSEMNAINNPSNV 103
> zoox2_s78781
Length=503
Score = 160 bits (344), Expect = 5e-39
Identities = 67/69 (97%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
Frame = +3/+2
Query 822 MITGEFPSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNL 1001
MITGE PSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNL
Sbjct 140 MITGELPSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRLLERSAKLSYNL 319
Query 1002 GGGSLTSFP 1028
GGGSLT FP
Sbjct 320 GGGSLTCFP 346
Score = 149 bits (321), Expect = 7e-36
Identities = 60/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
Frame = +2/+1
Query 821 YDNW*ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNILCPFSTFRKVCQVIIQS 1000
YDNW*I+F AYT**FIS C+CL*RNIPPIEKTSWKRSLSRRNILC FSTFRKVC+VIIQS
Sbjct 139 YDNW*IAFLAYT**FISPCLCL*RNIPPIEKTSWKRSLSRRNILCAFSTFRKVCKVIIQS 318
Query 1001 WWG*SYFFP 1027
WW * Y FP
Sbjct 319 WWW*PYLFP 345
Score = 144 bits (308), Expect = 5e-34
Identities = 64/69 (92%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
Frame = -3/-3
Query 1027 GKEVRLPPPRLYDNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRDKSSSIS 848
GK+VRLPPPRLYDN ADLSKSRE TKNISPG*ASLPAGLLNRRYISL*A A RDKSSSIS
Sbjct 345 GKQVRLPPPRLYDNFADLSKSRECTKNISPG*ASLPAGLLNRRYISL*AQAWRDKSSSIS 166
Query 847 KEGNSPVII 821
KEGNSPVII
Sbjct 165 KEGNSPVII 139
Score = 138 bits (295), Expect = 3e-32
Identities = 60/69 (86%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
Frame = -1/-1
Query 1026 GKK*DYPHQDCMITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*A 847
G K* Y HQDCMIT QTFLKVEN QRIFLLDKLLFQLVFSIGGIFLYKH H EINHQV*A
Sbjct 344 GNK*GYHHQDCMITLQTFLKVENAQRIFLLDKLLFQLVFSIGGIFLYKHKHGEINHQV*A 165
Query 846 KKEIHQLS* 820
+K IHQLS*
Sbjct 164 RKAIHQLS* 138
Score = 96.8 bits (205), Expect = 7e-20
Identities = 60/69 (86%), Positives = 62/69 (89%), Gaps = 0/69 (0%)
Frame = -2/-2
Query 1025 ERSKTTPTKIV**LGRPF*KSRMDKEYfswisfssswsSQ*EVYFSISTCMSR*IIKYKQ 846
E SK T TKIV**L RPF*KSRM KEYFSWISFSSSWSSQ*EVYFSIST M+R*IIKYKQ
Sbjct 343 ETSKATTTKIV**LCRPF*KSRMHKEYFSWISFSSSWSSQ*EVYFSISTSMAR*IIKYKQ 164
Query 845 RRKFTSYHK 819
R+FTSYHK
Sbjct 163 GRQFTSYHK 137
Score = 95.0 bits (201), Expect = 3e-19
Identities = 43/47 (91%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
Frame = +1/+3
Query 859 MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYHTI 999
MIYL M VLIEKYTSY*EDQLEEKLIQEKYSL ILDF*KGL SYHTI
Sbjct 177 MIYLAMLVLIEKYTSY*EDQLEEKLIQEKYSLCILDF*KGLQSYHTI 317
> zoox2_s52244
Length=487
Score = 153 bits (329), Expect = 6e-37
Identities = 66/68 (97%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
Frame = +3/+3
Query 789 AYSGAALSEFFMITGEFPSLLILDDLSRHACAYREIYLLLRRPAGREAYPGEIFFVHSRL 968
AYSGAALSEFFMITGE PSLLILDDLSRHACAYR IYLLLRRPAGREAYPGEIFFVHSRL
Sbjct 3 AYSGAALSEFFMITGELPSLLILDDLSRHACAYR*IYLLLRRPAGREAYPGEIFFVHSRL 182
Query 969 LERSAKLS 992
LERSAKLS
Sbjct 183 LERSAKLS 206
Score = 140 bits (301), Expect = 4e-33
Identities = 59/69 (85%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
Frame = +2/+2
Query 788 CL*RCSFV*ILYDNW*ISFFAYT**FISTCMCL*RNIPPIEKTSWKRSLSRRNILCPFST 967
CL* C FV*ILYDNW*I+F AYT**FIS C+CL* NIPPIEKTSWKRSLSRRNILC FST
Sbjct 2 CL*WCCFV*ILYDNW*IAFLAYT**FISPCLCL*INIPPIEKTSWKRSLSRRNILCAFST 181
Query 968 FRKVCQVII 994
FRKVC+V+I
Sbjct 182 FRKVCKVVI 208
Score = 137 bits (294), Expect = 4e-32
Identities = 59/69 (85%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
Frame = -1/-2
Query 993 MITWQTFLKVENGQRIFLLDKLLFQLVFSIGGIFLYKHMHVEINHQV*AKKEIHQLS*RI 814
M T QTFLKVEN QRIFLLDKLLFQLVFSIGGIF+YKH H EINHQV*A+K IHQLS*RI
Sbjct 207 MTTLQTFLKVENAQRIFLLDKLLFQLVFSIGGIFIYKHKHGEINHQV*ARKAIHQLS*RI 28
Query 813 QTKLHRYKH 787
QTK H YKH
Sbjct 27 QTKQHHYKH 1
Score = 135 bits (289), Expect = 2e-31
Identities = 63/68 (92%), Positives = 63/68 (92%), Gaps = 0/68 (0%)
Frame = -3/-1
Query 991 DNLADLSKSREWTKNISPG*ASLPAGLLNRRYISL*AHACRDKSSSISKEGNSPVIIKNS 812
DN ADLSKSRE TKNISPG*ASLPAGLLNRRYI L*A A RDKSSSISKEGNSPVIIKNS
Sbjct 205 DNFADLSKSRECTKNISPG*ASLPAGLLNRRYIYL*AQAWRDKSSSISKEGNSPVIIKNS 26
Query 811 DKAAPL*A 788
DKAAPL*A
Sbjct 25 DKAAPL*A 2
Score = 94.1 bits (199), Expect = 5e-19
Identities = 57/66 (86%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
Frame = -2/-3
Query 986 LGRPF*KSRMDKEYfswisfssswsSQ*EVYFSISTCMSR*IIKYKQRRKFTSYHKEFRQ 807
L RPF*KSRM KEYFSWISFSSSWSSQ*EVY SIST M+R*IIKYKQ R+FTSYHKEFRQ
Sbjct 200 LCRPF*KSRMHKEYFSWISFSSSWSSQ*EVYLSISTSMAR*IIKYKQGRQFTSYHKEFRQ 21
Query 806 SCTAIS 789
S T IS
Sbjct 20 SSTTIS 3
Score = 85.4 bits (180), Expect = 2e-16
Identities = 39/45 (86%), Positives = 40/45 (88%), Gaps = 0/45 (0%)
Frame = +1/+1
Query 859 MIYLDMHVLIEKYTSY*EDQLEEKLIQEKYSLSILDF*KGLPSYH 993
MIYL M VLI+KYTSY*EDQLEEKLIQEKYSL ILDF*KGL S H
Sbjct 73 MIYLAMLVLIDKYTSY*EDQLEEKLIQEKYSLCILDF*KGLQSCH 207
> zoox2_c19657
Length=462
Score = 134 bits (287), Expect = 4e-31
Identities = 58/64 (90%), Positives = 62/64 (96%), Gaps = 0/64 (0%)
Frame = +3/+3
Query 1287 QESKNKLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQNLLEALAVEDVRLFLNLYLDI 1466
QESKN+LTRGLRLVEMLKQSNGSPISLMGQVGILSLANQ LLEALAV+DV LFLNLYLDI
Sbjct 3 QESKNRLTRGLRLVEMLKQSNGSPISLMGQVGILSLANQELLEALAVKDVGLFLNLYLDI 182
Query 1467 PAWI 1478
P+W+
Sbjct 183 PSWM 194
Score = 128 bits (275), Expect = 2e-29
Identities = 58/72 (80%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
Frame = -1/-1
Query 1503 VTLVELIIKSMQVYQDRD*ERGVHLQLLKLLEDFD*LMTICQLVPLNLLEIHWIVLAFLQ 1324
V + L SM+VYQDRD*ERG+HL LLKLLE D*LMTICQLVPL+LLEIHWIVLAFLQ
Sbjct 219 VATLGLTTSSMKVYQDRD*ERGLHL*LLKLLEALD*LMTICQLVPLSLLEIHWIVLAFLQ 40
Query 1323 VVILLLIYSCFL 1288
VV LLLIYSCFL
Sbjct 39 VVSLLLIYSCFL 4
Score = 110 bits (235), Expect = 5e-24
Identities = 61/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
Frame = -2/-2
Query 1499 PWWN***NPCRYikieiekEAYIFNC*SF*KILIS**QYANLSH*TYWRSIGLF*HFYKS 1320
P W * +P RYIKIEIEKEAYIFNC*SF*K+LIS**QYANLSH* YWRSIGLF*HFYKS
Sbjct 215 PPWA*LPHP*RYIKIEIEKEAYIFNC*SF*KLLIS**QYANLSH*AYWRSIGLF*HFYKS 36
Query 1319 *SSC*FILAFL 1287
*+SC* ILAFL
Sbjct 35 *ASC*SILAFL 3
Score = 82.2 bits (173), Expect(2) = 4e-20
Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
Frame = +2/+2
Query 1292 KQE*INKRITTCRNAKTIQWISNKFNGTSWHIVI 1393
KQE*INKR+TTCRNAKTIQWISNK NGTSWHIVI
Sbjct 8 KQE*INKRLTTCRNAKTIQWISNKLNGTSWHIVI 109
Score = 35.0 bits (70), Expect(2) = 4e-20
Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 0/27 (0%)
Frame = +2/+2
Query 1433 CTPLSQSLS*YTCMDFIISSTKVTRKI 1513
C PLSQSLS*YT MD ++ T K+
Sbjct 149 CRPLSQSLS*YTFMDEVVKPKVATPKM 229
Score = 94.1 bits (199), Expect = 5e-19
Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
Frame = -3/-3
Query 1402 *LANDNMPTCPIKLIGDPLDCFSISTSRNPLVNLFLLSC 1286
*LANDNMPTCPIKLIGDPLDCFSISTSR PLVNLFLLSC
Sbjct 118 *LANDNMPTCPIKLIGDPLDCFSISTSRKPLVNLFLLSC 2
Score = 77.1 bits (162), Expect(2) = 7e-18
Identities = 33/36 (91%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
Frame = +1/+1
Query 1288 KKARIN*QEDYDL*KC*NNPMDLQ*V*WDKLAYCH* 1395
KKARI+*QE YDL*KC*NNPMDLQ* *WDKLAYCH*
Sbjct 4 KKARID*QEAYDL*KC*NNPMDLQ*A*WDKLAYCH* 111
Score = 32.2 bits (64), Expect(2) = 7e-18
Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
Frame = +1/+1
Query 1432 MYASFSISILIYLHG 1476
M ASFSISILIYLHG
Sbjct 148 M*ASFSISILIYLHG 192
> zoox2_s50104
Length=517
Score = 101 bits (215), Expect = 3e-21
Identities = 44/46 (95%), Positives = 45/46 (97%), Gaps = 0/46 (0%)
Frame = +1/+3
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL 246
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL
Sbjct 36 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL 173
Score = 100 bits (213), Expect = 6e-21
Identities = 42/43 (97%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
Frame = -2/-1
Query 248 YKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN 120
+KTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN
Sbjct 175 HKTNGGALCGKNL*DECH**SF*CDYSTTN*DYNSIN*NVLFN 47
Score = 96.8 bits (205), Expect = 7e-20
Identities = 43/43 (100%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
Frame = +3/+2
Query 120 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLV 248
IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLV
Sbjct 47 IEKDILIYGVIISVGCGVVTLEGLLMAFISEVFTTQSSSIGLV 175
Score = 73.9 bits (155), Expect = 6e-13
Identities = 44/45 (97%), Positives = 44/45 (97%), Gaps = 0/45 (0%)
Frame = +2/+1
Query 113 GVN*KGHsnlwsynlswlwssHIRRIINGIHLRGFYHTKLLHWSC 247
G N*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC
Sbjct 40 GHN*KGHSNLWSYNLSWLWSSHIRRIINGIHLRGFYHTKLLHWSC 174
Score = 55.1 bits (114), Expect = 3e-07
Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
Frame = -3/-2
Query 241 PMEELCVVKTSEMNAINNPSNV 176
PMEELCVVKTSEMNAINNPSNV
Sbjct 168 PMEELCVVKTSEMNAINNPSNV 103
> zoox2_s62985
Length=346
Score = 56.5 bits (117), Expect(2) = 7e-18
Identities = 25/31 (80%), Positives = 26/31 (83%), Gaps = 0/31 (0%)
Frame = +2/-2
Query 626 *SKV*VCIHCLHLSWSKLIKHSTSLSISSTK 718
*SK +CLHLSWSKLIKHSTSLSISSTK
Sbjct 345 *SKYRSVFYCLHLSWSKLIKHSTSLSISSTK 253
Score = 52.8 bits (109), Expect(2) = 7e-18
Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
Frame = +2/-1
Query 716 KRCYLLLLNARGYSQFICCLSI 781
KRCYLLLLNARGYSQFICC ++
Sbjct 256 KRCYLLLLNARGYSQFICCQTV 191
Score = 58.3 bits (121), Expect(2) = 6e-17
Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 0/31 (0%)
Frame = -1/+2
Query 717 FVEEIERLVECLMSFDQERCRQ*IQTYTFD* 625
FVEEIERLVECLMSFDQERCRQ* FD*
Sbjct 254 FVEEIERLVECLMSFDQERCRQ*NTDLYFD* 346
Score = 47.8 bits (98), Expect(2) = 6e-17
Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
Frame = -2/+1
Query 779 LTDSR*TGCSHEH*EVEDSIF 717
L DSR*TGCSHEH*EVEDSIF
Sbjct 193 LFDSR*TGCSHEH*EVEDSIF 255
Score = 55.6 bits (115), Expect(2) = 5e-15
Identities = 22/23 (95%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
Frame = +1/-1
Query 652 LSTPLLVKAHQALYKSFYLFYKK 720
LSTPLLVKAHQALYKSFYLFYK+
Sbjct 319 LSTPLLVKAHQALYKSFYLFYKR 251
Score = 44.1 bits (90), Expect(2) = 5e-15
Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
Frame = +3/-2
Query 717 KDAIFYFSMLVATASSSAVCQ 779
KDAIFYFSMLVATASSSAV Q
Sbjct 255 KDAIFYFSMLVATASSSAVKQ 193
Score = 55.6 bits (115), Expect(2) = 7e-15
Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
Frame = -3/+1
Query 718 FCRRDRKTCRVLDEL*PREV*TV 650
FCRRDRKTCRVLDEL*PREV*TV
Sbjct 253 FCRRDRKTCRVLDEL*PREV*TV 321
Score = 43.7 bits (89), Expect(2) = 7e-15
Identities = 18/18 (100%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
Frame = -1/+3
Query 771 QQMNWL*PRALRSRR*HL 718
QQMNWL*PRALRSRR*HL
Sbjct 201 QQMNWL*PRALRSRR*HL 254
Score = 44.1 bits (90), Expect(2) = 1e-10
Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
Frame = -2/+3
Query 716 L*KR*KDL*SA**ALTKRGVDSEYRPILLI 627
L*KR*KDL*SA**ALTKRGVDS + LI
Sbjct 255 L*KR*KDL*SA**ALTKRGVDSRIQTYTLI 344
Score = 40.9 bits (83), Expect(2) = 1e-10
Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
Frame = -3/+2
Query 772 TADELAVATSIEK*KIASF 716
TADELAVATSIEK*KIASF
Sbjct 200 TADELAVATSIEK*KIASF 256
Score = 60.2 bits (125), Expect = 8e-09
Identities = 27/48 (56%), Positives = 33/48 (68%), Gaps = 0/48 (0%)
Frame = +1/-3
Query 631 KSIGLYSLSTPLLVKAHQALYKSFYLFYKKMLSSTSQCSWLQPVHLLS 774
+SIGLYS L ++ + + F +KMLSSTSQCSWLQPVHLLS
Sbjct 341 QSIGLYSTVYTSLGQSSSSTLQVFLSLLQKMLSSTSQCSWLQPVHLLS 198
> zoox2_c19219
Length=736
Score = 82.2 bits (173), Expect = 2e-15
Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
Frame = +1/+2
Query 109 SWS*LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPHKAPPLVL**IFI 261
+WS LKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLP +L +FI
Sbjct 38 TWSQLKRTF*FMEL*SQLVVE*SH*KDY*WHSSQRFLPLPPQSSLLIQVFI 190