Skip to content
Browse files

Um, why didn't I commit these back on Apr 7?

  • Loading branch information...
1 parent 8189b8b commit 0639e763138ba2897d9c833549e7059bb788fc63 @jhannah committed May 5, 2010
Showing with 94,443 additions and 0 deletions.
  1. +91 −0 spekkio/code_test.txt
  2. +91 −0 spekkio/na_data.gb
  3. +94,261 −0 spekkio/na_gi_numbers.txt
View
91 spekkio/code_test.txt
@@ -0,0 +1,91 @@
+LOCUS AY331142 2052 bp mRNA linear ROD 22-JUN-2004
+DEFINITION Mus musculus potassium voltage-gated channel major isoform 1
+ (Kcnq1) mRNA, complete cds.
+ACCESSION AY331142
+VERSION AY331142.1 GI:33090006
+KEYWORDS .
+SOURCE Mus musculus (house mouse)
+ ORGANISM Mus musculus
+ Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
+ Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
+ Sciurognathi; Muroidea; Muridae; Murinae; Mus.
+REFERENCE 1 (bases 1 to 2052)
+ AUTHORS Knollmann,B.C., Casimiro,M.C., Katchman,A.N., Sirenko,S.G.,
+ Schober,T., Rong,Q., Pfeifer,K. and Ebert,S.N.
+ TITLE Isoproterenol exacerbates a long QT phenotype in Kcnq1-deficient
+ neonatal mice: possible roles for human-like Kcnq1 isoform 1 and
+ slow delayed rectifier K+ current
+ JOURNAL J. Pharmacol. Exp. Ther. 310 (1), 311-318 (2004)
+ PUBMED 15004216
+REFERENCE 2 (bases 1 to 2052)
+ AUTHORS Casimiro,M.C.
+ TITLE Direct Submission
+ JOURNAL Submitted (26-JUN-2003) NICHD, NIH, 9000 Rockville Pike, Bethesda,
+ MD 20852, USA
+FEATURES Location/Qualifiers
+ source 1..2052
+ /organism="Mus musculus"
+ /mol_type="mRNA"
+ /strain="129/SvJ"
+ /db_xref="taxon:10090"
+ /chromosome="7"
+ /tissue_type="heart"
+ /dev_stage="neonatal"
+ gene 1..2052
+ /gene="Kcnq1"
+ CDS 21..2027
+ /gene="Kcnq1"
+ /codon_start=1
+ /product="potassium voltage-gated channel major isoform 1"
+ /protein_id="AAP93874.1"
+ /db_xref="GI:33090007"
+ /translation="MDTASSPPSAERKRAGWSRLLGARRGSAVVKKCPFSLELAEGGP
+ EGSTVYAPIAPTGAPGLAPPMSTPVSPAPAPADLGPRPRVSLDPRVSIYSARRPLLAR
+ THIQGRVYNFLERPTGWKCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEI
+ VLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKG
+ QVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSS
+ YFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVF
+ AISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSATWK
+ IYVRKPARSHTLLSPSPKPKKSVMVKKKKFKLDKDNGMSPGEKMFNVPHITYDPPEDR
+ RPDHFSIDGYDSSVRKSPTLLELSTPHFLRTNSFAEDLDLEGETLLTPITHVSQLRDH
+ HRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSI
+ GKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVIITDMLHQLLSMQQGGPT
+ CNSRSQVVASNEGGSINPELFLPSNSLPTYEQLTVPQTGPDEGS"
+ORIGIN
+ 1 gtcaggggtc ctgtctggcc atggacacgg cctcgtcccc gcccagtgct gaaaggaagc
+ 61 gcgcgggttg gagccgcctg ctaggcgccc ggcggggcag cgcggtggtc aagaagtgtc
+ 121 ccttctcact ggagctggcc gaaggtggcc ctgagggcag cacggtctat gcgcccatcg
+ 181 cgccaaccgg agcccccggg ctcgcgcccc ccatgtcgac cccagtgtcg cccgccccgg
+ 241 cccctgcaga cctcggccca cgtccgcggg tgagccttga cccgcgggtc tccatctaca
+ 301 gtgcgcgccg cccgctgctg gcgcgcaccc acatccaggg ccgagtctac aacttcctcg
+ 361 agcgccccac gggttggaag tgtttcgtgt accacttcac cgtcttcctc attgttctgg
+ 421 tctgcctcat cttcagtgtc ctgtccacta ttgagcagta tgccgctctg gccaccggga
+ 481 ccctcttctg gatggagatt gtccttgtgg tgttctttgg gacagaatat gtggtccgcc
+ 541 tctggtctgc aggctgccgc agcaagtacg tgggcatctg gggccggcta cgttttgccc
+ 601 ggaagcccat ttccatcatt gacctcatcg tggttgtagc ctctatggtt gtcctctgcg
+ 661 tgggttccaa aggacaagtg ttcgccacat cagctatcag gggtatccgc ttccttcaga
+ 721 tcctgcggat gctgcatgtc gatcgccagg ggggtacctg gaggctcctg ggctctgtag
+ 781 tcttcattca ccgccaggag ctgatcacca ccctgtacat tggctttctg ggccttatct
+ 841 tctcctccta ctttgtctac ttggctgaga aagatgcggt gaacgagtcc ggccgcatcg
+ 901 agtttggcag ctacgcagat gctctgtggt ggggggtggt cacagtcact accattggct
+ 961 acggggataa ggtacctcag acgtgggttg ggaagaccat cgcctcctgt ttctctgtct
+ 1021 tcgccatatc cttctttgca ctcccagcgg ggatacttgg ctctgggttc gcgctgaagg
+ 1081 tccagcagaa gcagaggcag aagcacttca accggcagat cccagctgca gcctcactca
+ 1141 tccagactgc atggaggtgc tatgccgctg agaaccctga ctcagccact tggaagatct
+ 1201 atgtccggaa gcctgctcgg agtcacacgc ttctgtcccc cagccccaaa cctaaaaagt
+ 1261 ctgtcatggt aaagaagaag aagttcaagc tggataagga taatgggatg agtcctggag
+ 1321 agaagatgtt caatgttcct cacatcactt atgatccccc agaggatagg aggccagacc
+ 1381 atttctccat tgatggctat gacagctcag taaggaagag ccctacactg ctggaattaa
+ 1441 gcacacccca tttcttgaga acaaacagct ttgcagagga cctggacctg gaaggggaga
+ 1501 cactgctgac ccccatcacc catgtgtcac agctgcggga tcaccatcgg gccaccatca
+ 1561 aggtcatcag gcgcatgcag tactttgtag ccaagaagaa attccagcaa gcacggaagc
+ 1621 cctacgacgt gcgagatgtc atcgagcagt actcccaggg ccacctgaac cttatggtgc
+ 1681 gcattaaaga actacagaga aggctggatc agtccattgg gaagccatct ttgttcatcc
+ 1741 ccatctcaga aaagagcaaa gaccgtggca gtaacaccat cggtgcccgt ctgaacaggg
+ 1801 tggaagacaa ggtgacacaa ctggaccaga gactggtgat catcacagac atgctccacc
+ 1861 agctgctgtc catgcaacaa ggtggtccaa cctgcaacag caggtcacaa gttgtagcca
+ 1921 gcaatgaagg tggctccatc aaccctgagc tcttcctacc cagcaacagc ctgcccacct
+ 1981 acgaacaact gactgtgccc caaacaggcc ctgatgaggg ttcctgaagg agctcacaag
+ 2041 ggaggtccag gg
+//
+
View
91 spekkio/na_data.gb
@@ -0,0 +1,91 @@
+LOCUS AY331142 2052 bp mRNA linear ROD 22-JUN-2004
+DEFINITION Mus musculus potassium voltage-gated channel major isoform 1
+ (Kcnq1) mRNA, complete cds.
+ACCESSION AY331142
+VERSION AY331142.1 GI:33090006
+KEYWORDS .
+SOURCE Mus musculus (house mouse)
+ ORGANISM Mus musculus
+ Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
+ Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
+ Sciurognathi; Muroidea; Muridae; Murinae; Mus.
+REFERENCE 1 (bases 1 to 2052)
+ AUTHORS Knollmann,B.C., Casimiro,M.C., Katchman,A.N., Sirenko,S.G.,
+ Schober,T., Rong,Q., Pfeifer,K. and Ebert,S.N.
+ TITLE Isoproterenol exacerbates a long QT phenotype in Kcnq1-deficient
+ neonatal mice: possible roles for human-like Kcnq1 isoform 1 and
+ slow delayed rectifier K+ current
+ JOURNAL J. Pharmacol. Exp. Ther. 310 (1), 311-318 (2004)
+ PUBMED 15004216
+REFERENCE 2 (bases 1 to 2052)
+ AUTHORS Casimiro,M.C.
+ TITLE Direct Submission
+ JOURNAL Submitted (26-JUN-2003) NICHD, NIH, 9000 Rockville Pike, Bethesda,
+ MD 20852, USA
+FEATURES Location/Qualifiers
+ source 1..2052
+ /organism="Mus musculus"
+ /mol_type="mRNA"
+ /strain="129/SvJ"
+ /db_xref="taxon:10090"
+ /chromosome="7"
+ /tissue_type="heart"
+ /dev_stage="neonatal"
+ gene 1..2052
+ /gene="Kcnq1"
+ CDS 21..2027
+ /gene="Kcnq1"
+ /codon_start=1
+ /product="potassium voltage-gated channel major isoform 1"
+ /protein_id="AAP93874.1"
+ /db_xref="GI:33090007"
+ /translation="MDTASSPPSAERKRAGWSRLLGARRGSAVVKKCPFSLELAEGGP
+ EGSTVYAPIAPTGAPGLAPPMSTPVSPAPAPADLGPRPRVSLDPRVSIYSARRPLLAR
+ THIQGRVYNFLERPTGWKCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEI
+ VLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKG
+ QVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSS
+ YFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVF
+ AISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSATWK
+ IYVRKPARSHTLLSPSPKPKKSVMVKKKKFKLDKDNGMSPGEKMFNVPHITYDPPEDR
+ RPDHFSIDGYDSSVRKSPTLLELSTPHFLRTNSFAEDLDLEGETLLTPITHVSQLRDH
+ HRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSI
+ GKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVIITDMLHQLLSMQQGGPT
+ CNSRSQVVASNEGGSINPELFLPSNSLPTYEQLTVPQTGPDEGS"
+ORIGIN
+ 1 gtcaggggtc ctgtctggcc atggacacgg cctcgtcccc gcccagtgct gaaaggaagc
+ 61 gcgcgggttg gagccgcctg ctaggcgccc ggcggggcag cgcggtggtc aagaagtgtc
+ 121 ccttctcact ggagctggcc gaaggtggcc ctgagggcag cacggtctat gcgcccatcg
+ 181 cgccaaccgg agcccccggg ctcgcgcccc ccatgtcgac cccagtgtcg cccgccccgg
+ 241 cccctgcaga cctcggccca cgtccgcggg tgagccttga cccgcgggtc tccatctaca
+ 301 gtgcgcgccg cccgctgctg gcgcgcaccc acatccaggg ccgagtctac aacttcctcg
+ 361 agcgccccac gggttggaag tgtttcgtgt accacttcac cgtcttcctc attgttctgg
+ 421 tctgcctcat cttcagtgtc ctgtccacta ttgagcagta tgccgctctg gccaccggga
+ 481 ccctcttctg gatggagatt gtccttgtgg tgttctttgg gacagaatat gtggtccgcc
+ 541 tctggtctgc aggctgccgc agcaagtacg tgggcatctg gggccggcta cgttttgccc
+ 601 ggaagcccat ttccatcatt gacctcatcg tggttgtagc ctctatggtt gtcctctgcg
+ 661 tgggttccaa aggacaagtg ttcgccacat cagctatcag gggtatccgc ttccttcaga
+ 721 tcctgcggat gctgcatgtc gatcgccagg ggggtacctg gaggctcctg ggctctgtag
+ 781 tcttcattca ccgccaggag ctgatcacca ccctgtacat tggctttctg ggccttatct
+ 841 tctcctccta ctttgtctac ttggctgaga aagatgcggt gaacgagtcc ggccgcatcg
+ 901 agtttggcag ctacgcagat gctctgtggt ggggggtggt cacagtcact accattggct
+ 961 acggggataa ggtacctcag acgtgggttg ggaagaccat cgcctcctgt ttctctgtct
+ 1021 tcgccatatc cttctttgca ctcccagcgg ggatacttgg ctctgggttc gcgctgaagg
+ 1081 tccagcagaa gcagaggcag aagcacttca accggcagat cccagctgca gcctcactca
+ 1141 tccagactgc atggaggtgc tatgccgctg agaaccctga ctcagccact tggaagatct
+ 1201 atgtccggaa gcctgctcgg agtcacacgc ttctgtcccc cagccccaaa cctaaaaagt
+ 1261 ctgtcatggt aaagaagaag aagttcaagc tggataagga taatgggatg agtcctggag
+ 1321 agaagatgtt caatgttcct cacatcactt atgatccccc agaggatagg aggccagacc
+ 1381 atttctccat tgatggctat gacagctcag taaggaagag ccctacactg ctggaattaa
+ 1441 gcacacccca tttcttgaga acaaacagct ttgcagagga cctggacctg gaaggggaga
+ 1501 cactgctgac ccccatcacc catgtgtcac agctgcggga tcaccatcgg gccaccatca
+ 1561 aggtcatcag gcgcatgcag tactttgtag ccaagaagaa attccagcaa gcacggaagc
+ 1621 cctacgacgt gcgagatgtc atcgagcagt actcccaggg ccacctgaac cttatggtgc
+ 1681 gcattaaaga actacagaga aggctggatc agtccattgg gaagccatct ttgttcatcc
+ 1741 ccatctcaga aaagagcaaa gaccgtggca gtaacaccat cggtgcccgt ctgaacaggg
+ 1801 tggaagacaa ggtgacacaa ctggaccaga gactggtgat catcacagac atgctccacc
+ 1861 agctgctgtc catgcaacaa ggtggtccaa cctgcaacag caggtcacaa gttgtagcca
+ 1921 gcaatgaagg tggctccatc aaccctgagc tcttcctacc cagcaacagc ctgcccacct
+ 1981 acgaacaact gactgtgccc caaacaggcc ctgatgaggg ttcctgaagg agctcacaag
+ 2041 ggaggtccag gg
+//
+
View
94,261 spekkio/na_gi_numbers.txt
94,261 additions, 0 deletions not shown because the diff is too large. Please use a local Git client to view these changes.

0 comments on commit 0639e76

Please sign in to comment.
Something went wrong with that request. Please try again.