Permalink
Switch branches/tags
Nothing to show
Find file Copy path
Fetching contributors…
Cannot retrieve contributors at this time
4839 lines (4838 sloc) 281 KB
>Toc159_T.oceanica_gnl|BL_ORD_ID|24856 gi|397590707|gb|EJK55129.1| hypothetical protein THAOC_25171 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------FGIRRLVVGGSVRHGGHARGRPLPCPACPTGPDI
SSSASSLLSRTMTSYFDGGPSAPET--SRPK----QQRRLDIAIVGAPNAGKSQLLNSLV
GSK-------VAAVSRKRHTTRSGILGARTFGD-------------TQLVFIDTPGFLHH
SKGAREGV------RNLLSEASAE-----MMNAD----FALLVVDAAKT---IDQDLKRT
LVTLMMLALRSTGREE------------GSRVFSDQRHL------------GRFSVVLNK
VDLV-KPKEKLLATAAEVGSLAESCVRRLLQQHRAPVRVKMGELVDSVLERHEDEEGFAG
VHEEDYETFASVV-PEFLFTSAIDPEDEGA---------DDLLNVLLSRATPSTEFVMDP
SSN-----LEQVEEIIREKI----------------YRCLHREVPHHVQQTNRVFKL---
---KQDQPPDHDVRADMGDLLQIHQDLI--------------------------------
VRTKSHHRLVLGS-GGKTLQRIQTTASKDLRELF-------GCE----------------
--------------------------VDLLLSVKLKKTNQ-GVLLDPEEEGA-RITTLHD
----
>Toc34_T.oceanica_gnl|BL_ORD_ID|24856 gi|397590707|gb|EJK55129.1| hypothetical protein THAOC_25171 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------FGIRRLVVGGSVRHGGHARGRPLPCPACPTGPDI
SSSASSLLSRTMTSYFDGGPSAPET--SRPK----QQRRLDIAIVGAPNAGKSQLLNSLV
GSK-------VAAVSRKRHTTRSGILGARTFGD-------------TQLVFIDTPGFLHH
SKGAREGV------RNLLSEASAE-----MMNAD----FALLVVDAAKT---IDQDLKRT
LVTLMMLALRSTGREE------------GSRVFSDQRHL------------GRFSVVLNK
VDLV-KPKEKLLATAAEVGSLAESCVRRLLQQHRAPVRVKMGELVDSVLERHEDEEGFAG
VHEEDYETFASVV-PEFLFTSAIDPEDEGA---------DDLLNVLLSRATPSTEFVMDP
SSN-----LEQVEEIIREKI----------------YRCLHREVPHHVQQTNRVFKL---
---KQDQPPDHDVRADMGDLLQIHQDLI--------------------------------
VRTKSHHRLVLGS-GGKTLQRIQTTASKDLRELF-------GCE----------------
--------------------------VDLLLSVKLKKTNQ-GVLLDPEEEGA-RITTLHD
----
>Toc159_T.pseudonana_gnl|BL_ORD_ID|10627 gi|224003597|ref|XP_002291470.1| gtp-binding protein [Thalassiosira pseudonana CCMP1335]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------AFFRRALLQGSLAVNNLTHDTWHQTPRAITSLLN
HQQSCSLHSTPITLNNPTSSSAATTQSDKPA----PQKRLDVAIVGAPNAGKSQLLNSLI
GSK-------VAAVSRKRHTTRTGILGARTFDD-------------TQLVFIDTPGFLHH
EMSVKEGV------RKLLGEASSE-----MESAD----FVLLVVDAARK---MEDDLRRT
LVTLMFLALRSKGRNE-------------------------------------FAVVLNK
VDLV-SPKEKLLMTAADVGSMAESCIRQFLNQRRSPSKVKFGELVDTVLKNYANEDGFDG
VHDDDIELFATLA-PEFFFTSAIVKDDEGV---------DDVLGLLLERATLSDQWIVDA
GSATGMTPVEQVEEIIREKI----------------YRCLHREVPHSVQQQNRMFQLYKP
NESKTKSTDGSDVDEDI-KILRIRQDLI--------------------------------
VRTKSHQRLVLGS-GGKTLERIRSTALKDLEESF-------DCI----------------
--------------------------VDLDLTVRVTKSNQHEAILDPESVGAVSLTPLEN
----
>Toc34_T.pseudonana_gnl|BL_ORD_ID|10627 gi|224003597|ref|XP_002291470.1| gtp-binding protein [Thalassiosira pseudonana CCMP1335]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------AFFRRALLQGSLAVNNLTHDTWHQTPRAITSLLN
HQQSCSLHSTPITLNNPTSSSAATTQSDKPA----PQKRLDVAIVGAPNAGKSQLLNSLI
GSK-------VAAVSRKRHTTRTGILGARTFDD-------------TQLVFIDTPGFLHH
EMSVKEGV------RKLLGEASSE-----MESAD----FVLLVVDAARK---MEDDLRRT
LVTLMFLALRSKGRNE-------------------------------------FAVVLNK
VDLV-SPKEKLLMTAADVGSMAESCIRQFLNQRRSPSKVKFGELVDTVLKNYANEDGFDG
VHDDDIELFATLA-PEFFFTSAIVKDDEGV---------DDVLGLLLERATLSDQWIVDA
GSATGMTPVEQVEEIIREKI----------------YRCLHREVPHSVQQQNRMFQLYKP
NESKTKSTDGSDVDEDI-KILRIRQDLI--------------------------------
VRTKSHQRLVLGS-GGKTLERIRSTALKDLEESF-------DCI----------------
--------------------------VDLDLTVRVTKSNQHEAILDPESVGAVSLTPLEN
----
>Toc159_F.cylindrus_GMF1_gnl|BL_ORD_ID|11386 jgi|Fracy1|187133|e_gw1.7.947.1
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------F-KNAVLFPQRRARTWLWNNS--NTTTDACRANLSYAIERCCS
SSSSSSSSQSQSQ----SQSQSQST--LQQSPSTIGRKRLDVAIVGAPNAGKSQLVNILT
QSP-------VAAVSRKRHTTRSDILGARTIGN-------------TQIVFKDTPGFMRI
ENAKEERLD-----RDLIATAASE-----MQDVD----FTLLVIDSARA---LSENYRHA
-------------------DDDANPNSNDGR--------------------GKFAIVLNK
VDLV-KPKSTLIDLAMEIGAIADTCLEDHFTEH-------------------GKT--I--
----DFEAMLEHS-PIVFYVSAL--KEDGT---------DDLLDHLINLATPCKEWAVQS
GQSTNMTELEQVQEIIREKI----------------YRTCHREVPHSVQQVNRMFRKIP-
-------------KKG----VIIHQDLV--------------------------------
VFTKSHQKLVLGA-GGRTLERIRESAQTDLRKMF-------KCE----------------
--------------------------VSLHLHVK--KKIGRRGDSGTEYKLG-EASQTIL
----
>Toc34_F.cylindrus_GMF1_gnl|BL_ORD_ID|11386 jgi|Fracy1|187133|e_gw1.7.947.1
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------F-KNAVLFPQRRARTWLWNNS--NTTTDACRANLSYAIERCCS
SSSSSSSSQSQSQ----SQSQSQST--LQQSPSTIGRKRLDVAIVGAPNAGKSQLVNILT
QSP-------VAAVSRKRHTTRSDILGARTIGN-------------TQIVFKDTPGFMRI
ENAKEERLD-----RDLIATAASE-----MQDVD----FTLLVIDSARA---LSENYRHA
-------------------DDDANPNSNDGR--------------------GKFAIVLNK
VDLV-KPKSTLIDLAMEIGAIADTCLEDHFTEH-------------------GKT--I--
----DFEAMLEHS-PIVFYVSAL--KEDGT---------DDLLDHLINLATPCKEWAVQS
GQSTNMTELEQVQEIIREKI----------------YRTCHREVPHSVQQVNRMFRKIP-
-------------KKG----VIIHQDLV--------------------------------
VFTKSHQKLVLGA-GGRTLERIRESAQTDLRKMF-------KCE----------------
--------------------------VSLHLHVK--KKIGRRGDSGTEYKLG-EASQTIL
----
>Toc34_F.cylindrus_GMF1_gnl|BL_ORD_ID|20621 jgi|Fracy1|254023|fgenesh2_pg.52_#_25
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------FKNAVLFPQRRARTWLWNNS----------------------
-----------------------------------NTTTLDVAIVGAPNAGKSQLVNILT
QSP-------VAAVSRKRHTTRSDILGARTIGN-------------TQIVFKDTPGFMRI
ENAKEERLD-----RDLIATAASE-----MQDVD----FTLLVIDSARA---LSENYRHA
FVELK-------------------------------------------------------
---------NLLGMIRD-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_Pn.multiseries_gnl|BL_ORD_ID|138163 jgi|Psemu1|186266|e_gw1.57.139.1
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------RKIAGATV-KEASLVLRRYHRPALGNSSIIGGNTGWLSSQASSRVKFLSS
SSPSSTRRQSPPA----SRPQAAAT--AQNR----TRKRLDVAIVGPPNAGKSQLVNVLT
KSP-------IAAVSRKRHTTRSDLLGARTVGN-------------TQIVFKDTPGFLRI
ENAKEERLD-----RDLIATAASE-----MQDVD----FTLLVLDSART---LSDNYRHA
LVQLMVGAINSGGRIEDCDDDDDNNDRKTTRQSREDINPSSKCDTAIPSDKSKFAIVLNK
VDLV-KPKTDLISLAMDVGTMADTCLLDQFQKQ-------------------GRE--F--
----DFDAQMEQS-PIVFYVSAL--KEDGT---------DDLLEHLLGLATPSREWPVEP
GKATNMTTLEQVQEVIREKI----------------YRSTHKEVPHAVQQVNRLFRRIP-
-------------NKG----VVIHQDLV--------------------------------
VFTKSHQKLVLGSGGGKTLKRIQESARHDLQKLF-------GCD----------------
--------------------------VALQLHVKYRKSKQQRGDSGAQYNLG-EVSQSVY
----
>Toc34_Pn.multiseries_gnl|BL_ORD_ID|138163 jgi|Psemu1|186266|e_gw1.57.139.1
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------RKIAGATV-KEASLVLRRYHRPALGNSSIIGGNTGWLSSQASSRVKFLSS
SSPSSTRRQSPPA----SRPQAAAT--AQNR----TRKRLDVAIVGPPNAGKSQLVNVLT
KSP-------IAAVSRKRHTTRSDLLGARTVGN-------------TQIVFKDTPGFLRI
ENAKEERLD-----RDLIATAASE-----MQDVD----FTLLVLDSART---LSDNYRHA
LVQLMVGAINSGGRIEDCDDDDDNNDRKTTRQSREDINPSSKCDTAIPSDKSKFAIVLNK
VDLV-KPKTDLISLAMDVGTMADTCLLDQFQKQ-------------------GRE--F--
----DFDAQMEQS-PIVFYVSAL--KEDGT---------DDLLEHLLGLATPSREWPVEP
GKATNMTTLEQVQEVIREKI----------------YRSTHKEVPHAVQQVNRLFRRIP-
-------------NKG----VVIHQDLV--------------------------------
VFTKSHQKLVLGSGGGKTLKRIQESARHDLQKLF-------GCD----------------
--------------------------VALQLHVKYRKSKQQRGDSGAQYNLG-EVSQSVY
----
>Toc159_P.tricornutum_gnl|BL_ORD_ID|6794 gi|219112517|ref|XP_002178010.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RPTFIRTALVTFRWSGGPKISRSDRV
RLSSTTIGST-----------------PSLE----DRKRLDVAIVGLPNAGKSQLLNVLT
QST-------VAAVSRKRHTTRDGILGARTVDD-------------TQLYFVDTPGFLRQ
SQAKKEGLN-----RDLVVTASSE-----MENVD----FSLLVVDAARR---MTDDYEET
LVALMLAALRSQGRLE--FDVHSAEEVQSIRTPKGGTNP------------AKFAVVLNK
VDLV-HPKSNLMDLAVNIGTLAEQCIKFDAKES-------------------GKEELF--
----LDSAYLQESLPMFFYISAL--KQRGV---------QDLLEFLLERATPSTSWEVEA
GEATPMTMKERIEEVIREKI----------------YRCLHKEVPHSIRQENRVLQQGK-
-------------DEDGNIVLVIHQDLI--------------------------------
VRSKSHQELVHGG-GGRTLERIRETAARGLEKIF-------FCN----------------
--------------------------VVLHLHVKLPRSKNQRWSI---------------
----
>Toc34_P.tricornutum_gnl|BL_ORD_ID|6794 gi|219112517|ref|XP_002178010.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RPTFIRTALVTFRWSGGPKISRSDRV
RLSSTTIGST-----------------PSLE----DRKRLDVAIVGLPNAGKSQLLNVLT
QST-------VAAVSRKRHTTRDGILGARTVDD-------------TQLYFVDTPGFLRQ
SQAKKEGLN-----RDLVVTASSE-----MENVD----FSLLVVDAARR---MTDDYEET
LVALMLAALRSQGRLE--FDVHSAEEVQSIRTPKGGTNP------------AKFAVVLNK
VDLV-HPKSNLMDLAVNIGTLAEQCIKFDAKES-------------------GKEELF--
----LDSAYLQESLPMFFYISAL--KQRGV---------QDLLEFLLERATPSTSWEVEA
GEATPMTMKERIEEVIREKI----------------YRCLHKEVPHSIRQENRVLQQGK-
-------------DEDGNIVLVIHQDLI--------------------------------
VRSKSHQELVHGG-GGRTLERIRETAARGLEKIF-------FCN----------------
--------------------------VVLHLHVKLPRSKNQRWSI---------------
----
>Toc159_F.cylindrus_GMF1_gnl|BL_ORD_ID|17946 jgi|Fracy1|190835|e_gw1.11.594.1
MNTNTTTITNVNNDDHQQ------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------QHRCGYAGIVGAPNMGKSTLLNSLL
KED-------LCIATRRPQTTRHAILGVLSSPT-------------KQCCLLDTPGVLQG
DGAYQLQ-------ANMMEAVKGA-----LTDSD----MIVVVTDLFST-PIPDDNVFRR
LSETT----------------------------------------------KPVLVVVNK
IDLE-GRAKRPDE------------ATIQRRP----------------------------
--------------IP------------GMFRNGVKSLTNDDVKQLLPIGPPLYDDDFLS
DRSVRFFCSELIREALLESR------------------YLKKELPYCCEVQITDYKE---
-------------PRDD-NITRIEATIF--------------------------------
VERDGQKAIIIGK-NGDVVKQVGIIAREKIERFL------DGEK----------------
--------------------------VFLQLRVKINKDWRKREDQLAKFGY---SN----
----
>Toc34_F.cylindrus_GMF1_gnl|BL_ORD_ID|17946 jgi|Fracy1|190835|e_gw1.11.594.1
MNTNTTTITNVNNDDHQQ------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------QHRCGYAGIVGAPNMGKSTLLNSLL
KED-------LCIATRRPQTTRHAILGVLSSPT-------------KQCCLLDTPGVLQG
DGAYQLQ-------ANMMEAVKGA-----LTDSD----MIVVVTDLFST-PIPDDNVFRR
LSETT----------------------------------------------KPVLVVVNK
IDLE-GRAKRPDE------------ATIQRRP----------------------------
--------------IP------------GMFRNGVKSLTNDDVKQLLPIGPPLYDDDFLS
DRSVRFFCSELIREALLESR------------------YLKKELPYCCEVQITDYKE---
-------------PRDD-NITRIEATIF--------------------------------
VERDGQKAIIIGK-NGDVVKQVGIIAREKIERFL------DGEK----------------
--------------------------VFLQLRVKINKDWRKREDQLAKFGY---SN----
----
>Toc159_P.tricornutum_gnl|BL_ORD_ID|696 gi|219124036|ref|XP_002182319.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MGAPNMGKSTLLNALL
EED-------LCIATARPQTTRHAILGLMSTDK-------------CQVCLVDTPGVIE-
DPAYELQ-------EGMMEAVTGA-----VATSD----VLLVVTDVFST-PIPDDELFLK
VQRTR----------------------------------------------KPVLVAINK
IDLA-KKVNKAAEENRDKTVTVEEAVAFWRAQ----------------------------
--------------LPNALCILPLSASQGINNVGVVAM-RRILTELLPISPPLYDPETLT
DRPERFIASEIVRSALFQ--------------------VLKKELPYCCEVRIREFKE---
-------------PKEEGEVIRIAADVL--------------------------------
VERDSQKVIVIGK-NGAQVKEIGVIAREKLEAFF------R-HQ----------------
--------------------------IFLNLSVKVDKDWRKNTRKLTEYGYMKPKR----
----
>Toc34_P.tricornutum_gnl|BL_ORD_ID|696 gi|219124036|ref|XP_002182319.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MGAPNMGKSTLLNALL
EED-------LCIATARPQTTRHAILGLMSTDK-------------CQVCLVDTPGVIE-
DPAYELQ-------EGMMEAVTGA-----VATSD----VLLVVTDVFST-PIPDDELFLK
VQRTR----------------------------------------------KPVLVAINK
IDLA-KKVNKAAEENRDKTVTVEEAVAFWRAQ----------------------------
--------------LPNALCILPLSASQGINNVGVVAM-RRILTELLPISPPLYDPETLT
DRPERFIASEIVRSALFQ--------------------VLKKELPYCCEVRIREFKE---
-------------PKEEGEVIRIAADVL--------------------------------
VERDSQKVIVIGK-NGAQVKEIGVIAREKLEAFF------R-HQ----------------
--------------------------IFLNLSVKVDKDWRKNTRKLTEYGYMKPKR----
----
>Toc159_T.oceanica_gnl|BL_ORD_ID|14494 gi|397643422|gb|EJK75853.1| hypothetical protein THAOC_02405 [Thalassiosira oceanica]
MK-----------------GSIRMAHVGALMMFA-------TTACRGFRRSS---QSATP
KSTNRHITVLSQYCGIRDEVRRRNLIVGPSLQTVASRRRRATARLGPLHTPLQSTLYDLE
EKESTASTSDEDTVFALSSGSG---VTAVAVIRISGRNAFDALKQLLSPYSLEAGAEPPK
LPTPRMASLRILYDPLS----SSDHLNRM----RDPLDSALVLIFPGPRSFTGEDIVELH
CHGSRAVTSGVLKALSSLDS------VRPADPGEFTQRAYGN-------GKLGLVEVEAL
ADLIVADTSLQRKQALQQFDG-----------------------RLSRLYLGWR------
------------------------------------------------------------
-KELIKGLAHAEA----VIDFGDDEALGEE--DS--------------------------
------------------------------------------------------------
---------------------------------SFDS-SENDGGMSVWADVRPRISSLRE
AMDRHLEDASRGEL---------------------LRDGLRIAIVGRPNAGKSSLLNLLA
GRD-------AAIVSSTPGTTRDVVEVVLDLDG-------------VRCSLLDTAGVREE
IEDGVDEIE-----IEGMKRARLA-----AQEAH----LIVGVVDCSDQ-KRGLEAVQEL
IRADGHSDSARS-SPH-----------------------------------NNLLYVLNK
RDLF-EGEMEPCG-----------------------------------------------
----------VD----SETFAISCTTNQGV---------DIFLAALSKRALAM----ISQ
EGDSSGDLSVV----GTEGA--------------VITRARHRRHVEAASDALQRFEVLSS
QGYMALDMAAEELRLASSELGRVTGAID--------------------------------
VEDVLDVLFADFCIGK--------------------------------------------
------------------------------------------------------------
----
>Toc34_T.oceanica_gnl|BL_ORD_ID|14494 gi|397643422|gb|EJK75853.1| hypothetical protein THAOC_02405 [Thalassiosira oceanica]
MK-----------------GSIRMAHVGALMMFA-------TTACRGFRRSS---QSATP
KSTNRHITVLSQYCGIRDEVRRRNLIVGPSLQTVASRRRRATARLGPLHTPLQSTLYDLE
EKESTASTSDEDTVFALSSGSG---VTAVAVIRISGRNAFDALKQLLSPYSLEAGAEPPK
LPTPRMASLRILYDPLS----SSDHLNRM----RDPLDSALVLIFPGPRSFTGEDIVELH
CHGSRAVTSGVLKALSSLDS------VRPADPGEFTQRAYGN-------GKLGLVEVEAL
ADLIVADTSLQRKQALQQFDG-----------------------RLSRLYLGWR------
------------------------------------------------------------
-KELIKGLAHAEA----VIDFGDDEALGEE--DS--------------------------
------------------------------------------------------------
---------------------------------SFDS-SENDGGMSVWADVRPRISSLRE
AMDRHLEDASRGEL---------------------LRDGLRIAIVGRPNAGKSSLLNLLA
GRD-------AAIVSSTPGTTRDVVEVVLDLDG-------------VRCSLLDTAGVREE
IEDGVDEIE-----IEGMKRARLA-----AQEAH----LIVGVVDCSDQ-KRGLEAVQEL
IRADGHSDSARS-SPH-----------------------------------NNLLYVLNK
RDLF-EGEMEPCG-----------------------------------------------
----------VD----SETFAISCTTNQGV---------DIFLAALSKRALAM----ISQ
EGDSSGDLSVV----GTEGA--------------VITRARHRRHVEAASDALQRFEVLSS
QGYMALDMAAEELRLASSELGRVTGAID--------------------------------
VEDVLDVLFADFCIGK--------------------------------------------
------------------------------------------------------------
----
>Toc159_T.pseudonana_gnl|BL_ORD_ID|7596 gi|224013676|ref|XP_002296502.1| predicted protein [Thalassiosira pseudonana CCMP1335]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
LPNARMASLRTLYDPTADAKGTSDDEEEMQQQKRDPLDSALVLTFEGPNSFTGEDIVELH
CHGSRAVVHGVLSALSSLSSRAIPLQLRPADPGEFTQRAYAH-------GKLGLVEVEAL
ADLIVADTSLQRKQALQQFDG-----------------------RLSRLYGGWR------
------------------------------------------------------------
-EELIKGLAHAEA----VIDFGDDEALDAH--DE--------------------------
------------------------------------------------------------
---------------------------------FDDGLNANDGGMSIWGTIAPRIRSLRQ
AMNRHLADASRGEL---------------------LRDGLRIAIVGRPNAGKSSLLNLLA
GRD-------AAIVSSSPGTTRDVVEVMLDLGG-------------VRCTLLDTAGVREE
KEEGVNEIE-----VEGMKRARRA-----ARDAH----IIVGVVDATDL-SRGLEAVDEL
IRVESESDESSSLLNR-----------------------------------DNVLYVLNK
LDLV-EGNENSINSKEQ-------------------------------------------
----------SN----SPKFGISCTTSEGV---------DDFLSSLTQQALSL----VSG
DRD--------------EGA--------------VITRARHRRHVEAASDALERFEELSG
QGYMALDMAAEELRLASSELGRVTGAID--------------------------------
VEDVLDVLFADFCIGK--------------------------------------------
------------------------------------------------------------
----
>Toc34_T.pseudonana_gnl|BL_ORD_ID|7596 gi|224013676|ref|XP_002296502.1| predicted protein [Thalassiosira pseudonana CCMP1335]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
LPNARMASLRTLYDPTADAKGTSDDEEEMQQQKRDPLDSALVLTFEGPNSFTGEDIVELH
CHGSRAVVHGVLSALSSLSSRAIPLQLRPADPGEFTQRAYAH-------GKLGLVEVEAL
ADLIVADTSLQRKQALQQFDG-----------------------RLSRLYGGWR------
------------------------------------------------------------
-EELIKGLAHAEA----VIDFGDDEALDAH--DE--------------------------
------------------------------------------------------------
---------------------------------FDDGLNANDGGMSIWGTIAPRIRSLRQ
AMNRHLADASRGEL---------------------LRDGLRIAIVGRPNAGKSSLLNLLA
GRD-------AAIVSSSPGTTRDVVEVMLDLGG-------------VRCTLLDTAGVREE
KEEGVNEIE-----VEGMKRARRA-----ARDAH----IIVGVVDATDL-SRGLEAVDEL
IRVESESDESSSLLNR-----------------------------------DNVLYVLNK
LDLV-EGNENSINSKEQ-------------------------------------------
----------SN----SPKFGISCTTSEGV---------DDFLSSLTQQALSL----VSG
DRD--------------EGA--------------VITRARHRRHVEAASDALERFEELSG
QGYMALDMAAEELRLASSELGRVTGAID--------------------------------
VEDVLDVLFADFCIGK--------------------------------------------
------------------------------------------------------------
----
>Toc159_P.tricornutum_gnl|BL_ORD_ID|9918 gi|219114453|ref|XP_002176397.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
MRMTTQRCYSTQHSRHFSFQSIRIPHVLLAMVVSAWFGSQPTRTVRAFPLTQWRCHSVRR
NTNCRHVSHLS---------FQRN--------TVFKEHTRTKRVLIPSTTRRYSSVNDVD
MTTTVATTSSQDTIFALSSGAATGQATAVAVIRLSGPQA-GVILQRLTP------GRP--
LPKPRTAALRKLHD--------LDDPKVV-------LDQALVLYFSGPNSFTGDDVVELQ
VHGSRAVVTAVLETLGTA--------ARLAEPGEFTQRAWLA-------GKLDALQVEAL
ADLLTADTATQRQQALAQLDG-----------------------QLSAVYDTWR------
------------------------------------------------------------
-DMLVAGLAHAEA----VIDFGDDERLDDALLDE--------------------------
------------------------------------------------------------
---------------------------------EDQQLAQD----NVWGGVVGNMEVLER
SMRRQLQDARRGEL---------------------VRQGLQIAIVGPPNAGKSSLFNILA
DRD-------AAIVSPTAGTTRDVLELSLNLGG-------------VKCVLQDTAGVRTF
TDDA---IE-----MEGIARATRA-----AAQAD----LVLAMVDSSDV-ESGLEILTTI
L-------QNSPNLDR-----------------------------------QHVLLLLNK
SDLR-EEKHQTIEVPGK-------------------------------------------
----------DVVELIGGQYEISCATQNGV---------DTFLESLTRICVAR----VSN
TDASDRDKTSIVDRETSEGT--------------LITRARHRQHVQAAVEALERFQTLSQ
QGTMSVDLAAEELRLAASELGRITGAVD--------------------------------
VEDVLDKLFADFCIGK--------------------------------------------
------------------------------------------------------------
----
>Toc34_P.tricornutum_gnl|BL_ORD_ID|9918 gi|219114453|ref|XP_002176397.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
MRMTTQRCYSTQHSRHFSFQSIRIPHVLLAMVVSAWFGSQPTRTVRAFPLTQWRCHSVRR
NTNCRHVSHLS---------FQRN--------TVFKEHTRTKRVLIPSTTRRYSSVNDVD
MTTTVATTSSQDTIFALSSGAATGQATAVAVIRLSGPQA-GVILQRLTP------GRP--
LPKPRTAALRKLHD--------LDDPKVV-------LDQALVLYFSGPNSFTGDDVVELQ
VHGSRAVVTAVLETLGTA--------ARLAEPGEFTQRAWLA-------GKLDALQVEAL
ADLLTADTATQRQQALAQLDG-----------------------QLSAVYDTWR------
------------------------------------------------------------
-DMLVAGLAHAEA----VIDFGDDERLDDALLDE--------------------------
------------------------------------------------------------
---------------------------------EDQQLAQD----NVWGGVVGNMEVLER
SMRRQLQDARRGEL---------------------VRQGLQIAIVGPPNAGKSSLFNILA
DRD-------AAIVSPTAGTTRDVLELSLNLGG-------------VKCVLQDTAGVRTF
TDDA---IE-----MEGIARATRA-----AAQAD----LVLAMVDSSDV-ESGLEILTTI
L-------QNSPNLDR-----------------------------------QHVLLLLNK
SDLR-EEKHQTIEVPGK-------------------------------------------
----------DVVELIGGQYEISCATQNGV---------DTFLESLTRICVAR----VSN
TDASDRDKTSIVDRETSEGT--------------LITRARHRQHVQAAVEALERFQTLSQ
QGTMSVDLAAEELRLAASELGRITGAVD--------------------------------
VEDVLDKLFADFCIGK--------------------------------------------
------------------------------------------------------------
----
>Toc159_F.cylindrus_GMF2_gnl|BL_ORD_ID|3483 jgi|Fracy1|196010|e_gw1.26.139.1
M-----------------------PTPIS-------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------TQPIRRYRSLKKEPLVAILGRPNVGKSAFVNRI
C--------GTQNGGAIVADEEGITRDRTYRDANFLGENFQV-------VDTGGLVFADD
ESTLFAREI------------------------------------R--------------
------------------------------------------------------------
-EQAMVAIDESSG----VVLVVDGKIGMTAMDQQ-IAEFLRKDVLSR----------NLP
VILAVNKCESETVGALNA-------------------AEFWNLGL---------------
----------GEPIPVSALHGV-----------------------GTAEVLERLFEEIKQ
KQSAALPGFGTKDALAAFD--------EL-E----RPEEINVAIVGRPNVGKSSLLNALF
GDQ-------RAIVSKMAGTTRDSIDAVMER-PGDNEGDLP-----TIYRFVDTAGIRRR
AKV----EYGPE--FFMVNRALRA-----IRRAD----VVLLVMDATAG--VTEQDRILA
QKIADDG--------------------------------------------RACAIICNK
WDAV-VDKDSSTYDKSV------------------KYIRAEMPQIRW-------------
--------------APILFISAE--TGQRV---------GKIYNVVD----------DAI
GAHRKRISTSVLNEVLRDAILWQPPPA--------RRNGAQAKIYYCNQVSTR-------
-----------------------PPTIV--------------------------------
VFCNDPKL------VNDNYKRYLDRKFRESLDGF------EATP----------------
--------------------------VRWIFRGRRARDIMRAKDMNGNPGDGGKGVSYPF
PHAD
>Toc34_F.cylindrus_GMF2_gnl|BL_ORD_ID|3483 jgi|Fracy1|196010|e_gw1.26.139.1
M-----------------------PTPIS-------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------TQPIRRYRSLKKEPLVAILGRPNVGKSAFVNRI
C--------GTQNGGAIVADEEGITRDRTYRDANFLGENFQV-------VDTGGLVFADD
ESTLFAREI------------------------------------R--------------
------------------------------------------------------------
-EQAMVAIDESSG----VVLVVDGKIGMTAMDQQ-IAEFLRKDVLSR----------NLP
VILAVNKCESETVGALNA-------------------AEFWNLGL---------------
----------GEPIPVSALHGV-----------------------GTAEVLERLFEEIKQ
KQSAALPGFGTKDALAAFD--------EL-E----RPEEINVAIVGRPNVGKSSLLNALF
GDQ-------RAIVSKMAGTTRDSIDAVMER-PGDNEGDLP-----TIYRFVDTAGIRRR
AKV----EYGPE--FFMVNRALRA-----IRRAD----VVLLVMDATAG--VTEQDRILA
QKIADDG--------------------------------------------RACAIICNK
WDAV-VDKDSSTYDKSV------------------KYIRAEMPQIRW-------------
--------------APILFISAE--TGQRV---------GKIYNVVD----------DAI
GAHRKRISTSVLNEVLRDAILWQPPPA--------RRNGAQAKIYYCNQVSTR-------
-----------------------PPTIV--------------------------------
VFCNDPKL------VNDNYKRYLDRKFRESLDGF------EATP----------------
--------------------------VRWIFRGRRARDIMRAKDMNGNPGDGGKGVSYPF
PHAD
>Toc159_P.tricornutum_gnl|BL_ORD_ID|7302 gi|219109543|ref|XP_002176526.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
MKSVLCGVTLACGGIWQANSFTFRPLPVTRPVIGLLATLDRVNEKSTVEPS---------
------------------------------------------------------------
------------------------------------------------------------
----------------------SGDPQLQPIRRLRQNKKEPLIAIVGRPNVGKSALVNRI
A--------GSQSGGAIVADESGITRDRTYRPAEFLGERFMI-------VDTGGLVFDDD
ESTLFAKEI------------------------------------R--------------
------------------------------------------------------------
-EQAMVAIEESAA----VIMVVDGQTGLTGMDLM-IAEFLRKEV-------------DIP
VHVAVNKCESEKTGAMSA-------------------ADFWGLGL---------------
----------GEPFPVSALHGV-----------------------GTAEIMETIFDSIAE
KKT--------------FD--------AE-D----RPEEINIAIIGRPNVGKSSLLNSIF
GDT-------RAIVSEMAGTTRDSIDAVMERPPPPGSDDLS-----TIYRFVDTAGIRRK
GKV----DFGPE--FFMVNRALRA-----IRRAD----VVLLILDATSG--VAEQDRVLA
QKIADDG--------------------------------------------RACVIVCNK
WDAV-VDKDSTTYDKSV------------------QYFREELPMIRW-------------
--------------APILFISAA--TGQRV---------GKIYSAID----------GAI
EAHRKRISTAILNEVLRDAILWQPPPT--------RRNGSQAKIYYCNQVSTR-------
-----------------------PPTVV--------------------------------
VFCNDPKL------VNDNYRRYLDRKFRESLDGF------EATP----------------
--------------------------IRWIFRGRRVRDVMRNRSMNGDPGDGGTGVSFPF
PHAD
>Toc34_P.tricornutum_gnl|BL_ORD_ID|7302 gi|219109543|ref|XP_002176526.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
MKSVLCGVTLACGGIWQANSFTFRPLPVTRPVIGLLATLDRVNEKSTVEPS---------
------------------------------------------------------------
------------------------------------------------------------
----------------------SGDPQLQPIRRLRQNKKEPLIAIVGRPNVGKSALVNRI
A--------GSQSGGAIVADESGITRDRTYRPAEFLGERFMI-------VDTGGLVFDDD
ESTLFAKEI------------------------------------R--------------
------------------------------------------------------------
-EQAMVAIEESAA----VIMVVDGQTGLTGMDLM-IAEFLRKEV-------------DIP
VHVAVNKCESEKTGAMSA-------------------ADFWGLGL---------------
----------GEPFPVSALHGV-----------------------GTAEIMETIFDSIAE
KKT--------------FD--------AE-D----RPEEINIAIIGRPNVGKSSLLNSIF
GDT-------RAIVSEMAGTTRDSIDAVMERPPPPGSDDLS-----TIYRFVDTAGIRRK
GKV----DFGPE--FFMVNRALRA-----IRRAD----VVLLILDATSG--VAEQDRVLA
QKIADDG--------------------------------------------RACVIVCNK
WDAV-VDKDSTTYDKSV------------------QYFREELPMIRW-------------
--------------APILFISAA--TGQRV---------GKIYSAID----------GAI
EAHRKRISTAILNEVLRDAILWQPPPT--------RRNGSQAKIYYCNQVSTR-------
-----------------------PPTVV--------------------------------
VFCNDPKL------VNDNYRRYLDRKFRESLDGF------EATP----------------
--------------------------IRWIFRGRRVRDVMRNRSMNGDPGDGGTGVSFPF
PHAD
>Toc159_T.pseudonana_gnl|BL_ORD_ID|5653 gi|223994975|ref|XP_002287171.1| predicted protein [Thalassiosira pseudonana CCMP1335]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------PLIAVVGRPNVGKSALVNRL
A--------GTQSGGAIVADEEGITRDRTYRNAEFLGEAFQL-------VDTGGLVFDDN
DA-LFAKEI------------------------------------R--------------
------------------------------------------------------------
-EQAMIAIEESAG----VILVVDGQMGPTSMDEQ-LAIFLRKEVL-K----------KMP
VILAVNKCESDKNGAYLA-------------------SQFWNLGL---------------
----------GEPFAVSALHGV-----------------------GTAEVMEKMFDDIA-
-KP--------------LD--------GEDD----TDEEINVAIIGRPNVGKSSLINTIF
GSN-------RAIVSDVAGTTRDSIDAIMER-PSSDPEGLP-----TIYRFVDTAGIRRK
GKI----EFGPE--FFMVNRALRA-----IRRAD----VVLLVLDATAG--VTEQDRVLA
QKISDDG--------------------------------------------RACVILCNK
WDAV-IDKDSSTYDQSV------------------KYFREELPQIRW-------------
--------------APILFVSAA--TGQRV---------GKIYEAVD----------SAV
NAHRRRISTSVLNEVLRDATLWQPPPA--------RRNGAQAKIYYGSQVSTR-------
-----------------------PPTIV--------------------------------
VFVNDPNL------INDNYKRYLDRKMRESLDGF------ESTP----------------
--------------------------IRWMFRGRRVRDVTRNM-----------------
----
>Toc159_F.cylindrus_GMF2_gnl|BL_ORD_ID|13890 jgi|Fracy1|147902|gw1.4.359.1
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SNFTVSILGPPNAGKSTLFNRL
QCKERNRAKHTSKGNAIVSSIAGTTRDRRECWGRIGGTEFTL-------MDTAGI--DGD
RIQALAGKSKSEKHA--LERA-----------------------MM--------------
------------------------------------------------------------
-EQTLEAAKKSDL----VLLLWDARIGVSQDLLI-TARWLRKLGKHS------------N
VSLIANKLEGDSWAHDEDSIVMENLRDVLRLGL---------------------------
----------GNAIPISALQGD------------------------GLADIAILIEKLKT
EKEAKYNQENYSTDTTTAN-EISENNSGKDG----DQKPLQIAIIGRQNVGKSTLVNRLL
KSD-------RVLTGSTPGLTRDAIAVEWDWDG-------------QLVQLVDTAGIRKL
TKRMQMDDDSIE--DQSVADALRA-----MKVAE----VAVLVLDAKEL-FIQRQELAIC
NAVLNEG--------------------------------------------RALVIAANK
MDLIEMSSTYTSRDFAN---------------SVREQIESRIPILRN-------------
--------------IPIVPMSCI--SGKGI---------EHVLPAAL----------DAR
NRWARTISTGLLNRWLAEVVTGLQPPY---------VAGVRAKLKYIIQTKGR-------
-----------------------PPTFI--------------------------------
IFSNVKS-------FPEPYLRYLTRQFQDSFELYGMPVRL--------------------
------------------------------------------------------------
----
>Toc34_F.cylindrus_GMF2_gnl|BL_ORD_ID|13890 jgi|Fracy1|147902|gw1.4.359.1
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SNFTVSILGPPNAGKSTLFNRL
QCKERNRAKHTSKGNAIVSSIAGTTRDRRECWGRIGGTEFTL-------MDTAGI--DGD
RIQALAGKSKSEKHA--LERA-----------------------MM--------------
------------------------------------------------------------
-EQTLEAAKKSDL----VLLLWDARIGVSQDLLI-TARWLRKLGKHS------------N
VSLIANKLEGDSWAHDEDSIVMENLRDVLRLGL---------------------------
----------GNAIPISALQGD------------------------GLADIAILIEKLKT
EKEAKYNQENYSTDTTTAN-EISENNSGKDG----DQKPLQIAIIGRQNVGKSTLVNRLL
KSD-------RVLTGSTPGLTRDAIAVEWDWDG-------------QLVQLVDTAGIRKL
TKRMQMDDDSIE--DQSVADALRA-----MKVAE----VAVLVLDAKEL-FIQRQELAIC
NAVLNEG--------------------------------------------RALVIAANK
MDLIEMSSTYTSRDFAN---------------SVREQIESRIPILRN-------------
--------------IPIVPMSCI--SGKGI---------EHVLPAAL----------DAR
NRWARTISTGLLNRWLAEVVTGLQPPY---------VAGVRAKLKYIIQTKGR-------
-----------------------PPTFI--------------------------------
IFSNVKS-------FPEPYLRYLTRQFQDSFELYGMPVRL--------------------
------------------------------------------------------------
----
>Toc159_P.tricornutum_gnl|BL_ORD_ID|5109 gi|219124383|ref|XP_002182484.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SRIVVSILGPPNAGKSTLFNRL
LDKAANRA-----GTAIVSNVPGTTRDRRECVGRIGGTLFRL-------VDTAGV--DGE
RLELLAQSRRNQNGEGILMKF-----------------------MM--------------
------------------------------------------------------------
-GQTLEAARQADL----VFLMFDARVGVTADLLE-TARWLRKISQREQDPAAQTALPDRQ
IFLLANKLEGDFWNFD-GSIVLDHLTEATRLGF---------------------------
----------GEAIPISAHHGE------------------------GLADIAVLIEQAAV
AKRQSLGILDDDTD-------LASNDSD-------KDKPLQLAILGRQNVGKSTLVNALL
KQD-------RVIVGATPGLTRDAIAVEWTWKN-------------RPVQIVDTAGIRKR
SQRNH--EDAIE--DLSVEDALRA-----MKVAD----VAVLVLDAEAR-KLQRQELAIA
DAVLKEG--------------------------------------------RALVVAANK
MDLI-VERGYSKKDFAE---------------DVRAQLEARYPILRK-------------
--------------TPIVPMSSL--TGDSV---------HKLMPVVF----------RAR
ERWSRKISTGELNRWIAEVMDGKPPPP---------VSGRKARIKYVMQTKGR-------
-----------------------PPTFL--------------------------------
LFCNVAS-------LPENYLRFLTRNFQDTFEMFGMEVRM--------------------
------------------------------------------------------------
----
>Toc34_P.tricornutum_gnl|BL_ORD_ID|5109 gi|219124383|ref|XP_002182484.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SRIVVSILGPPNAGKSTLFNRL
LDKAANRA-----GTAIVSNVPGTTRDRRECVGRIGGTLFRL-------VDTAGV--DGE
RLELLAQSRRNQNGEGILMKF-----------------------MM--------------
------------------------------------------------------------
-GQTLEAARQADL----VFLMFDARVGVTADLLE-TARWLRKISQREQDPAAQTALPDRQ
IFLLANKLEGDFWNFD-GSIVLDHLTEATRLGF---------------------------
----------GEAIPISAHHGE------------------------GLADIAVLIEQAAV
AKRQSLGILDDDTD-------LASNDSD-------KDKPLQLAILGRQNVGKSTLVNALL
KQD-------RVIVGATPGLTRDAIAVEWTWKN-------------RPVQIVDTAGIRKR
SQRNH--EDAIE--DLSVEDALRA-----MKVAD----VAVLVLDAEAR-KLQRQELAIA
DAVLKEG--------------------------------------------RALVVAANK
MDLI-VERGYSKKDFAE---------------DVRAQLEARYPILRK-------------
--------------TPIVPMSSL--TGDSV---------HKLMPVVF----------RAR
ERWSRKISTGELNRWIAEVMDGKPPPP---------VSGRKARIKYVMQTKGR-------
-----------------------PPTFL--------------------------------
LFCNVAS-------LPENYLRFLTRNFQDTFEMFGMEVRM--------------------
------------------------------------------------------------
----
>Toc159_F.cylindrus_GMF1_gnl|BL_ORD_ID|25599 jgi|Fracy1|214794|estExt_Genewise1Plus.C_700009
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------SEDIVAEFS
SKAGGGYNRPGVQWYPGHIAK-----------------------AE--------------
------------------------------------------------------------
-RQLSETLKAVDV----VVEVRDARACKATSHPR-----------------VGEWCAGRP
RIVVLTHLDMIPKAAANSWRKAYEKFGAEDMDDAPIN-----------------------
----------RQVLFVNAKQGQ-----------------GIHALHRAIFKAGSHVQERRE
RRGL-------------------------------NPRALRVGIIGYPNVGKSALINKIL
GRK-------RAKTANTPGVTRSLQWIR-------------------EFELLDSPGIIPA
KMVDQS--------DALLLAACNC-----IGQAA----YDNQAVAAYLY-EWLKAVYLMD
KQALTAPNWRDKCIDRYGFDPLEKVQRDEDDIVQDEYLTGEDMLFKVADD-------LCR
GDAE-DAARKMLQDFRQ-------------------------------------------
---------------------------------------GRMGPISLQMAPESEEDG---
---------------------------GMLSVSVGDGTILGRQSMRGSENGGFDAEYQQQ
IQDE----RARIALETAKERGLELPPIV--------------------------------
-----DDPERA-------KEEAEADVGKGMFDGW--------------------------
------------------------------------------------------------
----
>Toc34_F.cylindrus_GMF1_gnl|BL_ORD_ID|25599 jgi|Fracy1|214794|estExt_Genewise1Plus.C_700009
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------SEDIVAEFS
SKAGGGYNRPGVQWYPGHIAK-----------------------AE--------------
------------------------------------------------------------
-RQLSETLKAVDV----VVEVRDARACKATSHPR-----------------VGEWCAGRP
RIVVLTHLDMIPKAAANSWRKAYEKFGAEDMDDAPIN-----------------------
----------RQVLFVNAKQGQ-----------------GIHALHRAIFKAGSHVQERRE
RRGL-------------------------------NPRALRVGIIGYPNVGKSALINKIL
GRK-------RAKTANTPGVTRSLQWIR-------------------EFELLDSPGIIPA
KMVDQS--------DALLLAACNC-----IGQAA----YDNQAVAAYLY-EWLKAVYLMD
KQALTAPNWRDKCIDRYGFDPLEKVQRDEDDIVQDEYLTGEDMLFKVADD-------LCR
GDAE-DAARKMLQDFRQ-------------------------------------------
---------------------------------------GRMGPISLQMAPESEEDG---
---------------------------GMLSVSVGDGTILGRQSMRGSENGGFDAEYQQQ
IQDE----RARIALETAKERGLELPPIV--------------------------------
-----DDPERA-------KEEAEADVGKGMFDGW--------------------------
------------------------------------------------------------
----
>Toc159_T.oceanica_gnl|BL_ORD_ID|10226 gi|397601583|gb|EJK57948.1| hypothetical protein THAOC_21972 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------EDPN
SFSLSGYQRPKVNWYPGHIAK-----------------------AE--------------
------------------------------------------------------------
-RQLAETLKSVDV----VIEVRDSRAPKATAHPS-----------------VGKWAAGRP
RVVVLTRVDTVTTRSRETWRQAYERLGADRWQEKLAGDERNRNAQFETERRKYVDGEDGD
SVKLRGADGVEEVLFVDAKRGQ-----------------GTHAITRAVYRAGRHVNERRK
RRGL-------------------------------NDRSLRVGIIGFPNVGKSALINRLL
GRK-------RAKTANTPGITRSLQWMRVAADKSTSASGSGSANAKKGFELLDSPGIIPS
DMLDQN--------DALLLAACNS-----VGVGA-------KIAARWGS-ESTDGSARSW
LDFAAKNADRMPSGE--------------------------DMLFIVADN-------TCK
GDPE-NAARKILQDFRN-------------------------------------------
---------------------------------------GRMGPVSLQLAPESETDE---
---------------------------GQVHVENMRSDGLDVRIVASPTNLKRATEEHEK
RQKEEIQQRAKAAMVAAKQKGLDLPPVV--------------------------------
ESIDVDDTEQVAAGGGADSKPSESEIGKGLFDGW--------------------------
------------------------------------------------------------
----
>Toc34_T.oceanica_gnl|BL_ORD_ID|10226 gi|397601583|gb|EJK57948.1| hypothetical protein THAOC_21972 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------EDPN
SFSLSGYQRPKVNWYPGHIAK-----------------------AE--------------
------------------------------------------------------------
-RQLAETLKSVDV----VIEVRDSRAPKATAHPS-----------------VGKWAAGRP
RVVVLTRVDTVTTRSRETWRQAYERLGADRWQEKLAGDERNRNAQFETERRKYVDGEDGD
SVKLRGADGVEEVLFVDAKRGQ-----------------GTHAITRAVYRAGRHVNERRK
RRGL-------------------------------NDRSLRVGIIGFPNVGKSALINRLL
GRK-------RAKTANTPGITRSLQWMRVAADKSTSASGSGSANAKKGFELLDSPGIIPS
DMLDQN--------DALLLAACNS-----VGVGA-------KIAARWGS-ESTDGSARSW
LDFAAKNADRMPSGE--------------------------DMLFIVADN-------TCK
GDPE-NAARKILQDFRN-------------------------------------------
---------------------------------------GRMGPVSLQLAPESETDE---
---------------------------GQVHVENMRSDGLDVRIVASPTNLKRATEEHEK
RQKEEIQQRAKAAMVAAKQKGLDLPPVV--------------------------------
ESIDVDDTEQVAAGGGADSKPSESEIGKGLFDGW--------------------------
------------------------------------------------------------
----
>Toc159_T.pseudonana_gnl|BL_ORD_ID|2716 gi|223994459|ref|XP_002286913.1| predicted protein [Thalassiosira pseudonana CCMP1335]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------PKVNWYPGHIAK-----------------------AE--------------
------------------------------------------------------------
-RQLSETLKSVDV----VIEVRDSRAPKATAHPS-----------------VGKWTAGRP
RVVVLTRMDTVTSRSRDSWREAYERLGADRWEDSLV------------------------
----------EEILFVDAKRGQ-----------------GTHAISRAVYKAGRHVNERRK
RRGL-------------------------------NDRPLRVGIIGFPNVGKSALINRLL
GKK-------RARTANTPGITRSLQWIR------------------SGFELLDSPGIIPS
DMLDQS--------DALLLAACNS-----IGVGA----YDNQAVAAYLC-ERIQSLVIME
KDYIAAPLWRNRCIERYGFDPL-------------------DMLFIVADN-------TCK
GDPE-NAARKILQDFRM-------------------------------------------
---------------------------------------GRMGPISLQL-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc34_T.pseudonana_gnl|BL_ORD_ID|2716 gi|223994459|ref|XP_002286913.1| predicted protein [Thalassiosira pseudonana CCMP1335]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------PKVNWYPGHIAK-----------------------AE--------------
------------------------------------------------------------
-RQLSETLKSVDV----VIEVRDSRAPKATAHPS-----------------VGKWTAGRP
RVVVLTRMDTVTSRSRDSWREAYERLGADRWEDSLV------------------------
----------EEILFVDAKRGQ-----------------GTHAISRAVYKAGRHVNERRK
RRGL-------------------------------NDRPLRVGIIGFPNVGKSALINRLL
GKK-------RARTANTPGITRSLQWIR------------------SGFELLDSPGIIPS
DMLDQS--------DALLLAACNS-----IGVGA----YDNQAVAAYLC-ERIQSLVIME
KDYIAAPLWRNRCIERYGFDPL-------------------DMLFIVADN-------TCK
GDPE-NAARKILQDFRM-------------------------------------------
---------------------------------------GRMGPISLQL-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_P.tricornutum_gnl|BL_ORD_ID|9646 gi|219116036|ref|XP_002178813.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------PRSQGTSRKGKPGKKDRDAGMGKSLQRAQVQRYRPRADGKSRRGDGGMHMQA
GVDSIGLEEAQQDQLKTRSVLEMQDLDDFLLQADMANREFVS-------EKEGLVVVDQT
GQAYRPPAVQWADQKSSFLFT-----------------------ELSVPRRPAWDDTTTA
VELDMNERKSFLEWRRA-----------------IAIKEEELARTSSLAAATPFEKNLEV
WRQLWRVLERSAC----LLQLVDARNPMFY-----LSDDLRDYASTL----------GKP
MMVLVNKSDYLSPSQRASWREYLMEKGWDPVFFSAVKEQQKLDAMA--------------
---------NRKRIQVQLGTGH------------DNSLDHLGEETDVSIDAHDQIEEPED
ERGVSVPLSRERLMETMLSFARQHNCQPDPR----YDNRIQFGMVGFPNVGKSSVINVLF
GSSKHEHGVVRVAVASQPGKTKHFQTLMLPDA--------------EEMMLCDCPGLVFP
SFVSNT--------ADLIAAGVYP-----IAQMRDHWPVTNLICQRIPR-EVINAHYGIV
LPKPSQLEMNERGLTK------------------LPPPSGEEFLGTFCIARGMLAASSGV
PDYT-RAARTIIKDYAD-------------------------------------------
---------------------------------------GKLLYCHPPPS----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc34_P.tricornutum_gnl|BL_ORD_ID|9646 gi|219116036|ref|XP_002178813.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------PRSQGTSRKGKPGKKDRDAGMGKSLQRAQVQRYRPRADGKSRRGDGGMHMQA
GVDSIGLEEAQQDQLKTRSVLEMQDLDDFLLQADMANREFVS-------EKEGLVVVDQT
GQAYRPPAVQWADQKSSFLFT-----------------------ELSVPRRPAWDDTTTA
VELDMNERKSFLEWRRA-----------------IAIKEEELARTSSLAAATPFEKNLEV
WRQLWRVLERSAC----LLQLVDARNPMFY-----LSDDLRDYASTL----------GKP
MMVLVNKSDYLSPSQRASWREYLMEKGWDPVFFSAVKEQQKLDAMA--------------
---------NRKRIQVQLGTGH------------DNSLDHLGEETDVSIDAHDQIEEPED
ERGVSVPLSRERLMETMLSFARQHNCQPDPR----YDNRIQFGMVGFPNVGKSSVINVLF
GSSKHEHGVVRVAVASQPGKTKHFQTLMLPDA--------------EEMMLCDCPGLVFP
SFVSNT--------ADLIAAGVYP-----IAQMRDHWPVTNLICQRIPR-EVINAHYGIV
LPKPSQLEMNERGLTK------------------LPPPSGEEFLGTFCIARGMLAASSGV
PDYT-RAARTIIKDYAD-------------------------------------------
---------------------------------------GKLLYCHPPPS----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_F.cylindrus_GMF1_gnl|BL_ORD_ID|22594 jgi|Fracy1|214636|estExt_Genewise1Plus.C_650061
M-----------------------------------------------------------
------------------------------------------------------------
------------------AP------KYQNKTKRRENAIPRTGASSKI--GKGRDNAKGG
HRSAETIKRLNLYKS-RAIRNKKGTIIGGDFMMGDRAGDRDITGETGRIAPDRRWFGNTR
VVDPKQLDTFRQEMTEKVADPYSVVLKRKKLPMGLLREAAEREA-----PPSQALLGQEP
FSQVFGSKSRRKKVKLDQLML-----------------------ARSDVDPNKDEDED--
-----GAPI-------------------------KKGG-----RAEVKADLFNKGQSKRI
WGEFFKVVDCSDV----VLHIIDARNVPGTRCNM-------------IERHIRDNASHKH
LVFVLNKIDLVPNWVAKRWMGELAKD----------------------------------
----------RPTIAFHASMTH-------------------------AFGKGALISLLRQ
FGKLHG-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SQK-------SCKVAPIPGETKIWQYITLF----------------KRISLIDCPGVVVD
TAGDTETESV----LKGVVRAERL-----ETPED----FIQPIVDMVKR-EHIAGQYKFT
KE------------------------------ESNKWTTPTELLETIATK-AGRLLKGGE
PCLR-SASITMINDFQR-------------------------------------------
---------------------------------------GRLPHFVAPPELKEDDVEENQ
GNMGGSTAVIEGVKPEAQEL-----------DKI----GEENTKSDGTVDGESDQKEG--
------------KETGSSGVVADEPVAIAEGEWDD-------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc34_F.cylindrus_GMF1_gnl|BL_ORD_ID|22594 jgi|Fracy1|214636|estExt_Genewise1Plus.C_650061
M-----------------------------------------------------------
------------------------------------------------------------
------------------AP------KYQNKTKRRENAIPRTGASSKI--GKGRDNAKGG
HRSAETIKRLNLYKS-RAIRNKKGTIIGGDFMMGDRAGDRDITGETGRIAPDRRWFGNTR
VVDPKQLDTFRQEMTEKVADPYSVVLKRKKLPMGLLREAAEREA-----PPSQALLGQEP
FSQVFGSKSRRKKVKLDQLML-----------------------ARSDVDPNKDEDED--
-----GAPI-------------------------KKGG-----RAEVKADLFNKGQSKRI
WGEFFKVVDCSDV----VLHIIDARNVPGTRCNM-------------IERHIRDNASHKH
LVFVLNKIDLVPNWVAKRWMGELAKD----------------------------------
----------RPTIAFHASMTH-------------------------AFGKGALISLLRQ
FGKLHG-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SQK-------SCKVAPIPGETKIWQYITLF----------------KRISLIDCPGVVVD
TAGDTETESV----LKGVVRAERL-----ETPED----FIQPIVDMVKR-EHIAGQYKFT
KE------------------------------ESNKWTTPTELLETIATK-AGRLLKGGE
PCLR-SASITMINDFQR-------------------------------------------
---------------------------------------GRLPHFVAPPELKEDDVEENQ
GNMGGSTAVIEGVKPEAQEL-----------DKI----GEENTKSDGTVDGESDQKEG--
------------KETGSSGVVADEPVAIAEGEWDD-------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_P.tricornutum_gnl|BL_ORD_ID|6857 gi|219112187|ref|XP_002177845.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
M-----------------------------------------------------------
------------------------------------------------------------
------------------AKTGWKSGISNTSSAGKTNRTPKGNASSKLTQGRRRDKQPGS
ERSAETIQRLKMYSNGKAIRNKAGKIVAGTFMMQDRAGDRKIEASTGRIQPDRRWFGNTR
VVGATELDRFRQEMTEKVADPYSVVLKRKKLPMGLLQDAAEYKAG----NQKAALLEQEP
FDQAFGKNSRRKRVKLDQLFV-----------------------QRAAESADSKEDIKTG
E----GEAI-------------------------RSEGEGIDWRHEKKDDLFLKGQSKRI
WGEFFKVVDCSDV----VLHIIDARNVPGTRCTM-------------IERHIAKNASHKH
LVFVLNKIDLVPNWVAKRWMGELAAV----------------------------------
----------RPTIAFHASLTN-------------------------AFGKGALISLLRQ
FGKLHE-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SKK-------SCKVAPIPGETKIWQYVTLF----------------KRISLIDCPGVVVD
TAGDTEEDSV----LKGVVRAERL-----ENPED----FIDAIMGKVKR-EHIAAQYKLP
KD------------------------------GEETWSSSGELMEMIARR-SGRLLKGGD
PCIR-TAALMIINDFQR-------------------------------------------
---------------------------------------GRLPHFIPPPELKVEEDQ---
----KTVATEQAIQIEEQNL-----------DDVVVVEKEMEQDEEGVETKTNDHAAI--
------------ADTET--VIDTSSILIGDGKWDE-------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc34_P.tricornutum_gnl|BL_ORD_ID|6857 gi|219112187|ref|XP_002177845.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
M-----------------------------------------------------------
------------------------------------------------------------
------------------AKTGWKSGISNTSSAGKTNRTPKGNASSKLTQGRRRDKQPGS
ERSAETIQRLKMYSNGKAIRNKAGKIVAGTFMMQDRAGDRKIEASTGRIQPDRRWFGNTR
VVGATELDRFRQEMTEKVADPYSVVLKRKKLPMGLLQDAAEYKAG----NQKAALLEQEP
FDQAFGKNSRRKRVKLDQLFV-----------------------QRAAESADSKEDIKTG
E----GEAI-------------------------RSEGEGIDWRHEKKDDLFLKGQSKRI
WGEFFKVVDCSDV----VLHIIDARNVPGTRCTM-------------IERHIAKNASHKH
LVFVLNKIDLVPNWVAKRWMGELAAV----------------------------------
----------RPTIAFHASLTN-------------------------AFGKGALISLLRQ
FGKLHE-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SKK-------SCKVAPIPGETKIWQYVTLF----------------KRISLIDCPGVVVD
TAGDTEEDSV----LKGVVRAERL-----ENPED----FIDAIMGKVKR-EHIAAQYKLP
KD------------------------------GEETWSSSGELMEMIARR-SGRLLKGGD
PCIR-TAALMIINDFQR-------------------------------------------
---------------------------------------GRLPHFIPPPELKVEEDQ---
----KTVATEQAIQIEEQNL-----------DDVVVVEKEMEQDEEGVETKTNDHAAI--
------------ADTET--VIDTSSILIGDGKWDE-------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_T.oceanica_gnl|BL_ORD_ID|1577 gi|397642458|gb|EJK75246.1| hypothetical protein THAOC_03037 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
------------------VKTGYKF-TKQQPNKGSRNMLKNSAASSRPNRTAPKRGDNGN
MRSNQTIARLKMYNNGKAIRNKEGKVVGGQFMMGDRAGDTKITAATGRIAPDRRWFGNTR
VVNPTELDRFREEMTSSMADPYSVVVKRKQLPMGLLRDAAELE-KAGRNNS--GLLANEP
FEHTFGGKSRRKRVKMEQYMVGRTSKIDDVEDKDEEDDQKPYRGGEAETVNDMPSDDKSG
YAALLAAAQKSQDTYSKVNNRVGIVPWGKDSNLTKTSGEGVDWVHSKKDDLFLKGQSKRI
WGEFYKVVDCSDV----ILHVIDARNVPGTRCTM-------------IEKHIAKNAPHKH
LVFVLNKIDLVPNWVAKRWIGELAQI----------------------------------
----------RPTIAFHASMTH-------------------------AFGKGALISLLRQ
FGKLNS-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SKK-------SCKVAPIPGETKIWQYITLF----------------RNIYLIDCPGVVVD
TAGDSETDSV----LKGVVRSERL-----ETPED----YVDAIQDAVKR-EHIAAMYGLP
RS------------------------------GEDTWKSSEELCEKIAIK-CGRLRKGGE
PCLR-SAAIMIINDFQR-------------------------------------------
---------------------------------------GRLPHYVAPPELKEEDSGEGA
AAV-ADTANIEGVELAAQNL-----------DEVTRDRAEDSAEGQRSDTKEETSEKIEK
KDGIAEDAGDVEADEDA--GSDDDEVVIGDGDWE--------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc34_T.oceanica_gnl|BL_ORD_ID|1577 gi|397642458|gb|EJK75246.1| hypothetical protein THAOC_03037 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
------------------VKTGYKF-TKQQPNKGSRNMLKNSAASSRPNRTAPKRGDNGN
MRSNQTIARLKMYNNGKAIRNKEGKVVGGQFMMGDRAGDTKITAATGRIAPDRRWFGNTR
VVNPTELDRFREEMTSSMADPYSVVVKRKQLPMGLLRDAAELE-KAGRNNS--GLLANEP
FEHTFGGKSRRKRVKMEQYMVGRTSKIDDVEDKDEEDDQKPYRGGEAETVNDMPSDDKSG
YAALLAAAQKSQDTYSKVNNRVGIVPWGKDSNLTKTSGEGVDWVHSKKDDLFLKGQSKRI
WGEFYKVVDCSDV----ILHVIDARNVPGTRCTM-------------IEKHIAKNAPHKH
LVFVLNKIDLVPNWVAKRWIGELAQI----------------------------------
----------RPTIAFHASMTH-------------------------AFGKGALISLLRQ
FGKLNS-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SKK-------SCKVAPIPGETKIWQYITLF----------------RNIYLIDCPGVVVD
TAGDSETDSV----LKGVVRSERL-----ETPED----YVDAIQDAVKR-EHIAAMYGLP
RS------------------------------GEDTWKSSEELCEKIAIK-CGRLRKGGE
PCLR-SAAIMIINDFQR-------------------------------------------
---------------------------------------GRLPHYVAPPELKEEDSGEGA
AAV-ADTANIEGVELAAQNL-----------DEVTRDRAEDSAEGQRSDTKEETSEKIEK
KDGIAEDAGDVEADEDA--GSDDDEVVIGDGDWE--------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_T.pseudonana_gnl|BL_ORD_ID|4381 gi|224003191|ref|XP_002291267.1| predicted protein [Thalassiosira pseudonana CCMP1335]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------KADSN
MRSSATIARLKMYNNGKAIRNKEGKVVGGQFMMADRAGDSKITAATGRIAPDRRWFGNTR
VVAPTELDAFREEMTQSMADPYSVVIKRKQLPMGLLKDAAELQAKHGGTNSSAGLLLNEP
FEHAFGTKSRRKRVKVEQFMV-----------------------GNAETLANLPDDDATG
YKSLLAAAQ-------------------------KTSGEGVDWRTEKKDDLFLKGQSKRI
WGEFYKVLDCSDV----ILHIIDARNVPGTRCTM-------------IEKHIAKNAPHKH
LVFVLNKIDLVPNWVAKRWIGELAQI----------------------------------
----------RPTIAFHASMTH-------------------------AFGKGALISLLRQ
FGKLAS-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SKK-------SCKVAPVPGETKIWQYITLF----------------RNIYLIDCPGVVVD
TAGDTEIDSV----LKGDVRAERL-----ECPED----FIDAIQAAVKR-EHIAAMYGVP
KS------------------------------GDDTWSTSIELLEKISIK-CGRLKKGGE
PCLR-SSAITLINDFQR-------------------------------------------
---------------------------------------GRLPHYVAPPE----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc34_T.pseudonana_gnl|BL_ORD_ID|4381 gi|224003191|ref|XP_002291267.1| predicted protein [Thalassiosira pseudonana CCMP1335]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------KADSN
MRSSATIARLKMYNNGKAIRNKEGKVVGGQFMMADRAGDSKITAATGRIAPDRRWFGNTR
VVAPTELDAFREEMTQSMADPYSVVIKRKQLPMGLLKDAAELQAKHGGTNSSAGLLLNEP
FEHAFGTKSRRKRVKVEQFMV-----------------------GNAETLANLPDDDATG
YKSLLAAAQ-------------------------KTSGEGVDWRTEKKDDLFLKGQSKRI
WGEFYKVLDCSDV----ILHIIDARNVPGTRCTM-------------IEKHIAKNAPHKH
LVFVLNKIDLVPNWVAKRWIGELAQI----------------------------------
----------RPTIAFHASMTH-------------------------AFGKGALISLLRQ
FGKLAS-----------------------------DKKQISVGVIGYPNVGKSSVINTLI
SKK-------SCKVAPVPGETKIWQYITLF----------------RNIYLIDCPGVVVD
TAGDTEIDSV----LKGDVRAERL-----ECPED----FIDAIQAAVKR-EHIAAMYGVP
KS------------------------------GDDTWSTSIELLEKISIK-CGRLKKGGE
PCLR-SSAITLINDFQR-------------------------------------------
---------------------------------------GRLPHYVAPPE----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_T.oceanica_gnl|BL_ORD_ID|33149 gi|397569214|gb|EJK46603.1| hypothetical protein THAOC_34725 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------VKKKGKSKRI
TLKDKYKIQRRVVETHRKNRKQAKRDAKAGIVRHDKKKD---------PGIPNSWPFKQE
LLQSIQREKERAENRKLEEKERRVNKNGAANLEELVKQANQKKSEFDAKTGSSSAASDDG
IKIVTTSHGQQSRRAYL-------------------------------------------
------------------------------------------------------------
-RSLKTVIESSDV----ILQVLDARDPLGTRISSGIEASILSHF-------------DKR
MVLVMNKIDLIPKKNVSEWLTYLRRS----------------------------------
----------HPTVALKAGTTQSRSNEGGRSSGVGQTKGENALSSSMAVGVDGLLQLLKN
YARANGEKK--------------------------SKTSITVGIIGYPNVGKSSILNSLK
RFR-------AVGVSSRPGFTTTLQEVVLD----------------KNIRLIDSPGVVFD
DDASRDGA------NAMLRNGVDA-----DSVSD-PLPAIAELLGRCTS-ESLMMTYSVP
A-------------------------------FPPGPEGVLTFLAMVARS-KGRVLKGGI
PDKM-MAARLVMRDWNQ-------------------------------------------
---------------------------------------GKIPYFSTPPVTEVEMGDTSA
GSTHAKIVSKFSEEFDVSKI----------------MAAHDKELMNGLEDVDEMDFVQMT
SSSRPRGEGSADKVVK--------------------------------------------
YLHEGGDQNSDSEMEGDDDAVALNTRMEEAEDFFGE------------------------
------------------------------------------------------------
----
>Toc34_T.oceanica_gnl|BL_ORD_ID|33149 gi|397569214|gb|EJK46603.1| hypothetical protein THAOC_34725 [Thalassiosira oceanica]
M-----------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------VKKKGKSKRI
TLKDKYKIQRRVVETHRKNRKQAKRDAKAGIVRHDKKKD---------PGIPNSWPFKQE
LLQSIQREKERAENRKLEEKERRVNKNGAANLEELVKQANQKKSEFDAKTGSSSAASDDG
IKIVTTSHGQQSRRAYL-------------------------------------------
------------------------------------------------------------
-RSLKTVIESSDV----ILQVLDARDPLGTRISSGIEASILSHF-------------DKR
MVLVMNKIDLIPKKNVSEWLTYLRRS----------------------------------
----------HPTVALKAGTTQSRSNEGGRSSGVGQTKGENALSSSMAVGVDGLLQLLKN
YARANGEKK--------------------------SKTSITVGIIGYPNVGKSSILNSLK
RFR-------AVGVSSRPGFTTTLQEVVLD----------------KNIRLIDSPGVVFD
DDASRDGA------NAMLRNGVDA-----DSVSD-PLPAIAELLGRCTS-ESLMMTYSVP
A-------------------------------FPPGPEGVLTFLAMVARS-KGRVLKGGI
PDKM-MAARLVMRDWNQ-------------------------------------------
---------------------------------------GKIPYFSTPPVTEVEMGDTSA
GSTHAKIVSKFSEEFDVSKI----------------MAAHDKELMNGLEDVDEMDFVQMT
SSSRPRGEGSADKVVK--------------------------------------------
YLHEGGDQNSDSEMEGDDDAVALNTRMEEAEDFFGE------------------------
------------------------------------------------------------
----
>Toc159_F.cylindrus_GMF2_gnl|BL_ORD_ID|13155 jgi|Fracy1|162596|gw1.1.2020.1
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------EVAFLGRSNVGKSSLINAIM
RKN-------LCITSKSPGRTQLPYYYGNPSGQ-------------PQGFIVDLPGYGFA
KKPMSITEDWQKDTQDLLLHRRHE-----AKVLK----RLFLLMDARRGVQGPNEHDRIV
MRWLEDAE-------------------------------------------IPFTVVLTK
ADRV-S------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc34_F.cylindrus_GMF2_gnl|BL_ORD_ID|13155 jgi|Fracy1|162596|gw1.1.2020.1
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------EVAFLGRSNVGKSSLINAIM
RKN-------LCITSKSPGRTQLPYYYGNPSGQ-------------PQGFIVDLPGYGFA
KKPMSITEDWQKDTQDLLLHRRHE-----AKVLK----RLFLLMDARRGVQGPNEHDRIV
MRWLEDAE-------------------------------------------IPFTVVLTK
ADRV-S------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>Toc159_Cyanidioschyzon_merolae_gnl|BL_ORD_ID|3128 _gnl|CMER|CMP284C similar to chloroplast outer membrane protein Toc34
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------DSETPTKNEA
EQRASPDRTGQVTQRPVSLFR-----------------------KN--------------
------------------------------------------------------------
-GTFAYPLEDSDVYEEQVLALEDVPEPTAQAILRLALAAERQ------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------GVPRLRFLVVGAPGVGKSSLINTLL
NEN-------LCSVSAWERGTKNAQVCARQVDS-------------VVIEFIDTPGIAPC
RRSGLEASRRQVQRLRKLLDARGADEHPYLRSFH----AILYVMRLDDT-----------
-----------------------------------------------------------R
PDLVDYHNWKVLMEFFGAEVLRHMMVVFTHGQSLPPDSLSYPEYVRGRR-----------
---------------------------------------DYVYLLIERLTGPLKAVRFPV
FVAENSSKCPVIEETGERKLPDDTPWITQLYDGIRRFVFPLEADLFGMETGPEDTQVLVY
IYDKRRSRADERYPRSPLQALIRNPWFLRAVQFCGAMLLRSYMIRQEHERFNPKPHHPEP
IIRDANNAFAVASRRANDHRLFTPSIDEDEESFFRMNGNDDFVSRLRNRPGEVDLDELDV
ERIESPDGRFVEYWYTEKDNPEMVRMYRLEIRDDPNEERESRQDRIPISKDQH-------
----
>Toc34_C.merolae gi|449018483|dbj|BAM81885.1| similar to chloroplast outer membrane protein Toc34 [Cyanidioschyzon merolae strain 10D]
M-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------DSETPTKNEA
EQRASPDRTGQVTQRPVSLFR-----------------------KN--------------
------------------------------------------------------------
-GTFAYPLEDSDVYEEQVLALEDVPEPTAQAILRLALAAERQ------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------GVPRLRFLVVGAPGVGKSSLINTLL
NEN-------LCSVSAWERGTKNAQVCARQVDS-------------VVIEFIDTPGIAPC
RRSGLEASRRQVQRLRKLLDARGADEHPYLRSFH----AILYVMRLDDT-----------
-----------------------------------------------------------R
PDLVDYHNWKVLMEFFGAEVLRHMMVVFTHGQSLPPDSLSYPEYVRGRR-----------
---------------------------------------DYVYLLIERLTGPLKAVRFPV
FVAENSSKCPVIEETGERKLPDDTPWITQLYDGIRRFVFPLEADLFGMETGPEDTQVLVY
IYDKRRSRADERYPRSPLQALIRNPWFLRAVQFCGAMLLRSYMIRQEHERFNPKPHHPEP
IIRDANNAFAVASRRANDHRLFTPSIDEDEESFFRMNGNDDFVSRLRNRPGEVDLDELDV
ERIESPDGRFVEYWYTEKDNPEMVRMYRLEIRDDPNEERESRQDRIPISKDQH-------
----
>pwToc34
VLALAECSGDRQRTGASRCCCWEREAWARVATVNSLLGERAAVVSSFQATGLGVHMHTRT
LPGGFALNLIDTPSLLDQDSVSTSRLEQIGSAIKGVKIDAVLFLDRLDVYSTDTLDEQVV
DGVTAYFGEDMWDHAVLGLTRATSSAPPLSTDFGEWVVERSLQLQSLIAKARAQYAPRRR
RGEAPPLTPAGCRESQECPRKLRGSGSSPATAPGSPTCMPRWRSAATGAGQAWLHDAARR
>crToc34
MAQPPRPAEEYDDDVQEDEDELKEGELDDDESHEAASEGGEAAAGDEEAEDDEQDEEDGD
EDSQPWAGLNRLPERDDMLDILNELRAEGRKQLTVLLLGKSSVGKSSLINSLLGEAVVRV
QAFKLQADTDITTTVVRQVAVGNSEVDGFRLKLIDTCGLEDPEAGDTVNLGALSKIAEDV
RGVGIDVVLYCDRLDLYRVDPLDKAIIDAISSTFGRGIWRRTVVALTHANLVQTPPGTDY
DSFVNGRVRLIRGAVRGPLFFRPSLPVALVENSETCPVSSESGFRVLPDGEPWLVALVSQ
LVDMAAARRRPYKYHPRLSSKPSHRFRWLLPVAIAAEVLFYRRFLHPRLDDNQRRVEREE
ERVWALRGQQRRALGLHRPHRPDKDAAWRLEQMYDDD
>olToc34
MSEEEYSEDEDYVSSEGEGVEGTEEGGEGQPAQAAAPVLGPKEWVGLSSMPAATQSALLE
TLGKLRERNVNEMTVIFIGKQGVGKSSTVNTLLNERVAPSSPFQPENVRPLLAGRVAAGF
TLNVLDTPGLLEGDSVSARGLMALRAALNGRKVDAFVFTDRLDTWRVDNADKAIFTSLAE
NFGAELWERTVLGFSHAQTTPTDGRPYEEFVNARVEQYRKAIRSTLNMPNLALPFALIEN
GSRCKTNGNGEKVVNDRPWLSDMVSTMVEMACSKDGYEYDHGKAGKKLDPNNKHKIWILP
LFLFQAFVLRPLVIGQIRRDIKKADEKKQRAAAAKH
>ppToc34-2
MATVSEKEWTGFQGLPAATQIILHTLLAKLRKQKVDKITIVLLGKGGVGKSSIVNSLFSE
RVAAVSAFRSETLRPRQYSRSKDGFKLTVIDTPGFVEAGRVDAALNSIRRYLLGKTINVV
LYVDRLDGPREDKVDVKISRAISQAFGPQIWPHVIVVFTHAEIHLEDVTYSEFVSRRSAA
LRNIILKESRFKTVNTKVPFVLVENCSRCSENGEHEKILPDGTVWLPVLFEALVDLVLGS
KKPILIDEKMIGIPKGNPLGSIWMPLVLLAQFVLIWRPIRKAIDRDLVEEAQRHSP
>ppToc34-1
MAATPAREWTGLQQFPVATQTALHNILGTLRQQNKESLTVLVVGKGGVGKSSTVNSIVGE
RVTIVSAFQSETLRPLQCARSRAGFTLNIIDTPGLVEGGCINDQALDIIKRFLLSKTIDV
VLYVDRLDGYRVDNLDRQVIRGLARSFGPNFWRLAVIVLTHAQFSPSDGVNYTEFVEKRS
AALQAAIRQEAGLKKDEKEVPYALVENSGRCNTNDGGEKILPNGTVWLPALVERIVEVAT
GTTDSVFVDKKLIDGPNANEWGKWWIPVLAVAQYFLVVMPIRKAIEKDLAEEKNQRPQWE
IRAEEFRRNTSLYDDDQVDEQAISQALEQDDGLSGQPSSFVDEDDDDDEF
>ppToc34-3
MAATQAREWTGLLQFPVATQTALHNILGKLRQQKKESLTVLVVGKGGVGKSSTVNSIIGE
RVTVVSAFQSETLRPLQCARTRAGFTLNVIDTPGLIEGGCINDQALDIIKRFLLNKTIDV
VLYVDRLDGYRVDNLDKQVIRALARSFGPNFWRIAIIALTHAQLSPPDGVDYTEFVNNRS
AALRAAIRQEAGFKKSEGEISYMLVENSGRCNTNSEGEKVLPNGSVWLPALVDRIAEVAT
GATPSIHVDQKLIDGPNANGKGKWWIPLIILAQYFLIVRPIRSAIEKDLIEEEKQRPQWQ
IRAEEFVRPIASLYEDDQVDEQAIRQALKQGALNDQMDSFVEDDEDDDEY
>peToc34
IVGERVAIVSAFQSEAMRPLICSRSRAGFTLNIIDTPGLIEGGFVNDHALDLIKRFLINK
TIDILLYVDRLDGYRVDDLDMQVTKAISKSFGQQIWRRGLVVLTHAQLSPPDELRYADFV
DRRSAILQAVVRKAAGFKKSETQIPVVLVENSGRCNTNSGGEKVLSDGTVWLPYLVEKIV
EVATNGSKPILIDKKLIEGPDANQWGKRWIPLFLAFQYFFIVKPIRRGIQKDIQREKSER
PAWEIYDETGDKTI
>laToc34
MTSPITREWAGFNTFPPETQTKLLELLGRLKEKNVNKLTILVMGKCGVGKSSTVNSIIGE
RAVVINPFQSEGLRPVMVSRSRTEFTLNIIDTPGIIEGGCINNQALELIKHFLLNKTIDI
LLYVDRLDTYRVDELDKMVVRAITNSFGKEIWNRALIVLTHAQLSPPDGLPYDEFVSKRS
EALLKVVHQGARLKKGDLASSIPSVSRCNKNDSGEKGPNGTA
>brToc33
MGSLVREWVGFQQFPAATQEKLIEFFTKLKQKDMNSLTLVVMGKGGVGKSSTVNSLIGEQ
VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVL
LYVDRLDVYRVDELDKQVVQAITQTFGKEIWCKTLLVLTHAQFSPPDDLSYETFSSKRSD
SLLRTIRAGSKMGETTVGFCNGCVCGETVED
>thToc33
LDLIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVQAITQTFGKEIWCKTLLVLTHAQFS
PPDELSYETFSSKRSDSLLTTIRAGAKMRKQQFEDSAIAVVYAENSGRCSKNEKEEKALP
NGEAWIPNLVKSITDVATNQKKAIHVDNKMVDGSQSDDKGKKLIPLIIGAQYFIVKMIQG
AIRNDIKISGKPV
>ovToc33
MGSLVREWVGFQQFPAATQEKLIGFFGKLKQKDMNSLTVLVLGKGGVGKSSTANSLIGEQ
VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVF
LYVDRLDVYRVDELDKQVVQAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSD
SLFKTIRAGSKMRKQQFEDSAIEVVYAENSGRCSKNEKEEKALPNGEAWIPSLVKAITYV
ATNQRKAIHVDKKMVDGSYSDDRGKKLIPLIIGAQWFIVKMIQGAIRNDIKTSGKPL
>ovToc33like
MGSLVREWVGFQQFPAATQEKLIGFFGKLKQKDMNSLTVLVLGKGGVGKSSTANSLIGEQ
VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVL
LYVDRLDVYRVDELDRQVVQAITQTFGKEIWCKTLLVLTHAQFSPPDELSYGTFSSKRSD
SFLKTIRTGSKMRKQQFEDSAIEVVYAENSGRCSKNEKEEKALPNGEAWIPGLVKAITDV
ATNQRKAIHVDKKMVDGSYSDDRGKKLIPLIMAAQYFIVEMIQGAIRNDIKTSGKPL
>atToc33
MGSLVREWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQ
VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVL
LYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSD
SLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDV
ATNQRKAIHVDKKMVDGSYSDDKGKKLIPLIIGAQYLIVKMIQGAIRNDIKTSGKPL
>rrToc33
MGSLVREWVGFQQFPAATQEKLIEFFSKLKQKDMNSLTVVVMGKGGVGKSSTVNSLIGEQ
VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPDLVEAGYVNHQALELIKGFLVNRTIDVF
LYVDRLDVYRVDELDKQVVQAITQTFGKEIWCKTLLVLTHAQFSPPDDLSYETFSSKRSD
SLLKTIRAGSKMRKQQFEDSAIEVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDV
ATIQKKAIHV
>bnToc33
MGSLVREWVGFQQFPAATQEKLIEFFAKLKQKDMNSLTVVVMGKGGVGKSSTVNSLIGEQ
VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVL
LYVDRLDVYRVDELDKQVVQAITQTFGKEIWCKTLLVLTHAQFSPPDDLSYETFSSKRSD
SLLKTIRAGSKMGKQQFEDSAIEVVYAENSGRCSKNDKEEKALPNGEAWIPNLVKAITDV
ATNQKKAIHVDKKMVDGSYSDDKGKKLIPLIIAAQYFVVKMIQGAIRSDIKTSGKPL
>boToc33
MGSIVREWVGFQQFPAATQEKLIEFFAKLKQKDMNSLTVVVMGKGGVGKSSTVNSLIGEQ
VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVL
LYVDRLDVYRVDELDKQVVQAITQTFGKEIWCKTLLVLTHAQFSPPDDLSYETFSSKRSD
SLLKTIRAGSKMGKQQFEDSAIEVVYAENSGRCSKNDK
>grToc34
MGTPLPREWLGLQQFPAATQTKLFELLGKLKQENVNTLTIVVMGKGGVGKSSTINSLIGE
QVVRVTAFQSEGLRPVMVSRSWAGFTLNVIDTPGLVEAGYVNHQALELIKGFLLNKTIDV
LLYVDRLDVYRVDNLDKQIIRAITNSFGKEIWRKSLLVLTHAQLCPPDGLNYDVFSSKRS
EGVLKAIRMGARIRKMDLEDSVIPVVLVENTGRCNKNDIDEKILPNGEAWVPNFGKSH
>ptToc34-2
---------------------------------GNKMTILVMGKGGVGKSSTVNSLLGER
VVNVSSFQSEGLRPVMVSRDRAGFTLNIIDTPGLVEGGYVNYQSLELIKRFLLNKTINVL
LYVDRLDAYRVDDLDKQIISAITDSFGKEIWNKSLLVLTHAQLCPPDDLSYDVFCGRRSE
AVLKTIRMGAQIKR-DFEDSAIP-GLVENSGGCNKSENDEKILPNGDAWIPTLVK-IVGV
ATNGKKSLLDQ
>ptToc34-3
MGSVLREWIGFQQFPTATQSKLVELFAKLKEEGVDKLTILVMGKGGVGKSSTVNSLFGER
AVNVSSFQSEGFRPVMVSRNRAGFTLNIIDTPGLVEGGYVSYQALDMIKRFLLNKTIHVL
LYVDRLDAYRVDDLDKQIIGAISDSFGKEIWSKSLLVLTHAQLCPPDDLSYDVFCARRSE
AVLKTIRMGARIRKRDFEDSAIPVGLVENSGRCNKNENDEKILPSGDAWIPSLVKEIILV
ATNGKKALVVDEKLVNGSESNDRGKIFIPLILGIQWLLVKWIQREIKKDIAKGGKYL
>ptToc34-1
MGSVLREWIGFQQFPTATQSKLVELFAKLKEEGVDKLTILVMGKGGVGKSSTVNSLFGER
AVNVSSFQSEGFRPVMVSRNRAGFTLNIIDTPGLVEGGYVSYQALDMIKRFLLNKTIHVL
LYVDRLDAYRVDDLDKQIIGAISDSFGKEIWSKSLLVLTHAQLSPPDDLSYDVFCARRSE
AVLKTIRMGARIRKRDFEDSAIPVGLVENSGRCNKNENDEKILPNGDAWIPSLVKEIILV
ATNGKKLLLMRSWLVGLSQMTGGKIFIPLILGI
>hvToc34
MAAPIPREWVGLQQFPAATQTKLHELLGKLKEENVSTLTILVMGKGGVGKSSTVNSIVGE
RVANVSAFQSEGLRPMMCSRTRAGFTLNIIDTPGLIEGGYINEQAVEIIKRFLLEKTIDV
LLYVDRLDTYRMDTLDEQVIRAITSSLGKAIWRRTLVVLTHAQLSPPDGIDYNDFLARRS
ESLVRYIRSGAGIGKREYADFPLPIALAEDSGKGRTNENGAILDGNSWDSKLE
>asToc34
SAFQSEGLRPMMCSRTRAGFTLNIIDTPGLIEGGYINEQAVEIIKRFLLEKTIDVLLYVD
RLDTYRMDTLDEQVIRAITTSFGKAIWRRTLVVLTHAQLSPPDGLDYNDFLTRRSESLLR
YIRSGAGIGKRESADYPLPLALVENSGRCKTNENGAKILPDGTPWIPNLMKEITMVVSNG
SKPIHVDQKLIDGPNPNNRWKKYIPLILAVQYFFVVKGIRRAIHSDIANGKLDDWEQRYR
DLVGSGNPVDQKVSSSRNPRPEAGQ
>osToc34
MSAAPIPREWVGLQQFPAATQTKLHELLGKLKEENVSTLTILVMGKGGVGKSSTVNSIVG
ERVATVSAFQSEGLRPMMCSRTRAGFTLNIIDTPGLIEGGYINEQAVEIIKRFLLGKTID
VLLYVDRLDAYRMDTLDDQVIRAVTNSFGKAIWRRTLVVLTHAQLSPPDGLDYNDFFTKR
SESLLRYIRAGAGVSKRELGDFPLPIALVENSGRCKTNENGEKVLPDGTPWIPNLMKEIT
TVVSNGSKSIHVDQKLIDGPNPNNRWKMFIPLILMVEYFLVVKGIRRAIHADISNGKLDD
WEQRYRDLVGSKDPVDQKGSSSGNRKA
>soToc34
MASPIPREWVGLQQFPAATQTKLHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGE
RVTTVSAFQSEGLRPMMCSRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDV
LLYVDRLDAYRMDTLDEQVIRAITNSFGKDIWRRSLVVLTHAQLSPPDGIDYNDFFTRRS
KALLPYIRSGAGIQPTRIWGFPPCQ
>zmToc34-1
MASPIPREWVGLQQFPPATQTELHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGE
RIATVSAFQSEGLRPMMWSRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDV
LLYVDRLDAYRMDTLDGQVIRAITNSFGKDIWRRSLVVLTHAQLSPPDGIEYNDFFTRRS
EALLRYIHSGAGIKKREYGDFPLPIALVENSGRCKTNEHGEKILPDGTPWVPKLMKEITV
VISNGSKPIHVDQKLIDGPNPNNRWKMFIPIILAVEYFLVVKGIRRAIHADIANGKVDDW
EQRYRDLVGSRDPVEQKGSTTRNRKA
>sbToc34
MASPIPREWAGLQQFPAATQTKLHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGE
RVTTVSAFQSEGLRPTMCSRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDV
LLYVDRLDAYRMDTLDEQVIRAITNSFGKDIWRRSLVVLTHAQLSPPDGIDYNDFFTRRS
EALLRYIRSGAGINKREYGDFPLPIALVENSGRCKANEHGEKILPDGTPWVPNLM
>zmToc34-2
MASPIPREWVGLQQFPAATQTKLHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGE
RVASVSAFQSEGLRPMMCSRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDV
LLYVDRLDAYRMDTLDEQVIRAITNSFGKDIWRRSLVVLTHAQLSPPDGIDYNDFFTRRS
EALLRYIHSGAGINKREYGDFPLPIALVENSGRCKTNEHGEKILPDGTLWVPNLMKEITV
VISNGSSPIHVDQKLIDGPNPNNRRKLFIPLILAVEYFLVVKGIRRAIHADIANGKVDDW
EQRYRDLVGSRDLVEQKGSTSRNRKA
>lsToc34
GERAVTVSAFQSEALRPTMVSRERSGFTLNIIDTPGIVEGGYVNDQALEIIKRFLLNKTI
DVLLYVDRLDAYRVDTLDGQIVKAISNSFGQQIWRKAIVVLTHAQLSPPDCLSYDEFLAK
RSEALLKVVYRGARFRKLDIENFPIPIGLVENSSRCNKNEKDEKILPNGSAWIPSIVETI
TEVSLTESKSILVDQKLIDGPNPNRGKLFIPFIIAFQYFFV
>atToc34
MAALQTLREWIGIQQFPPATQSKLLEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIG
EKAAAVSTFQSEGLRPTLVSRTRSGFTLNIIDTPGLIEGGYVNDQAINIIKRFLLNMTID
VLLYVDRLDVYRVDDLDRQVVGAITDAFGKEIWKKSALVLTHAQFSPPDGLNYNHFVSKR
SNALLKVIQTGAQLKKQDLQGFSIPVILVENSGRCHKNESDEKILPCGTSWIPNLFNKIT
EISFNGNKAIHVDKKLVEGPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKLA
WELRDSGLASRRS
>tsToc34
PTRPEDVSSLTVLVRGKGGVGKSSTVNSVIGEKAAAVSTFQSEGLRPSLVSRSRSGFTLN
IIDTPGLIEGGYVNDGAVNLIKGFLLNKTIDVLLYVDRLDVYRVDDLDRQVVTAITDAFG
KEIWKKSALVLSHAQFSPPDGLYDLFVSRRSDSSVICAGAQLKKQDLQGSSIPVILVENS
GRC
>rrToc34
MAALQMSREWIGIQQFPPATQSKLLEILGKFEEEDVSSLTVLVMGKGGVGKSSTVNSVIG
ERAAAVSTFQSEGLRPSLVSRSRSGFTLNIIDTPGLIEGGYVNDQAVNLIKGFLPNKTID
VLLYVDRLDVYRVDDLDKQVVTAITDAFGKEIWKKSALVLSHAQFSPPDGLNYDLFVSRR
SDALLKLIYASAQLK
>brToc34
MAALQMSREWIGIQQFPPATQSKLIEILNKFKEEDVSSLTVLVMGKGGVGKSSTVNSVIG
EKAAAVSTFQSEGLRPSLVSRSRSGFTLNIIDTPGLIEGGYVNDQAVNLIK
>bnToc34
MAALQMSREWIGIQQFPPATQSKLLEILGKFKEEDVSSLTVLVMGKGGVGKSSTVNSVIG
EKAAAVSTFQSEGLRPSLVSRSRSGFTLNIIDTPGLIEGGYVNDQAVNLIKRFLLNMTID
VLLYVDRLDVYRVDDLDKQVVTAITDAFGKEIWKKSALVLSHAQFSPPDGLNYDLFVSRR
SDALLKLI
>boToc34
MAALQVSREWIGIQQFPPATQSKLLEILGKFKEEDVSSLTVLVMGKGGVGKSSTVNSVIG
EKAAAVSTFQSEGLRPSLVSRSRSGFTLNIIDTPGLIEGGYVNGQAVNLIKRFLLNMTID
VLLYVDRLDVYRVDDLDKQVVTAITDAFGKEIWKKSALVLSHAQFSPRDG
>acToc34
MSFLTREWVGIQQFPAATQTKLHEILGKLKQENVNTMTILVMGKGGVGKSSTVNSILGER
VATVSAFQSEGLRPIMCSRTRAGFTLNVIDTPGIVEGGYVNEQALEIIKRFLLDKTIDVL
LYVDRLDSYRVDNLDKQVVKAITDFLGKEIWQRGVVVLTHAQLSPPDGLNYDDYLEKRSD
ALLKYVRLGAGIKKKELQGKGIPVALVENSGRCKTNEDGEKILPNGTAWIPNLVQQSQT
>amToc34
MAAQLIKEWSAIQQFPAATQEKLVDLLGKLKNQDVNTLTILVMGKGGVGKSSTINSIIGE
RVVTVSAFQSETPRPVMVSRSRSGFTLNVIDTPGLVEGGYVNDQVLETIKSFLGRFLMNK
TIDVLLYVDRLDAYRVDNLDKQIVKAITESFGKEIWHKAVVVLTHAQLSPPDALSYEEFF
SRRSDSLLKFVCQGAGINKKDLKNFDIPVALVEN
>mtToc34-1
MASQQQQVREWSGINTFAPATQTKLLELLGKLKQEDVNSLTILVMGKGGVGKSSTVNSII
GERVVAISPFQSEGPRPVMVSRARAGFTLNIIDTPGLIEGGYINDMALDIIKRFLLDKTI
DVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDALAYDEFFSK
RSESLLQIIKSGASLKKDDAQASAIPVVLIENSGRCNKNETDEKVLPNGIAWIPHLVHTI
TEIALNKSESIFVDKNLIEGPNPNQRGKLWIPVLFALEFLLIMKPIEGLIKNDVANEKKP
SWETRDVGVKKETREVGQKDMRKERRGGAVRR
>pcToc34
MASQIIREWSGINTFAPATQTKLLELLGKLKQENVNSLTILVMGKGGVGKSSTVNSIIGE
RVVSISPLQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALDIIKRFLLNKTIDV
LLYVDRLDVYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYEDFFSQRS
EALLRVLRSGAKIKKEVFQAASMP
>psToc34
MASQQQTVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSII
GERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTI
DVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSK
RSEALLQVVRSGASLKKDAQASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTIT
EVALNKSESIFVDKNLIDGPNPNQRGKLWIPLIFALQYLFLAKPIEALIRRDIATETKPA
WETRDVGDRK
>stToc34-1
MASQVIREWVGFQQFPSATQSKLIELIRKLKQESVSTLTILVMGKGGVGKSSTVNSILGE
RAVAVSAFQSETPRPVMVSRSWAEFTLNIIDTPGLVEGGYVNDQALDLIKRFLLNKTIDV
LLYVDRLDTYRVDNLDRQIVKAITDSFGKEIWHRGLVVLTHAQVSPPDGLSYDEFTSRRS
EALSKIVRLGARIRKQEVKASSVPIVCVENSGRCNKNELDEKILPNGTAWIPNLLQTITE
VVASESKGILVDQKLIEGPNPNNKGKLLIPLIAAFQYFFVVKRIQKWIKNDIARETRPSW
A
>leToc34-1
MASQVIREWVGFQQFPSATQSKLIELIRKLKQESVSTVTILVMGKGGVGKSSTVNSILGE
RAVAVSAFQSETPRPVMVSRSWAEFTLNIIDTPGLVEGGYVNDQALDLIKRFLLNKTIDV
LLYVDRLDTYRVDNLDRQIVKAITDSFGKGIWRRGLVVLTHAQVSPPDGLSYDEFTSRRS
EALLKIVRLGARMKKQEIKAASIPLVCVENSGRCNKNELDEKILPNGTAWIPSILQTITE
VVVSQSKGILIDQKLIEGPNPNNKGKLLIPLIATFQYFFVVKRIQTWIKNDISRENRPSW
A
>vvtoc34
MASQLIREWTGIQQFPPVTQTKLIELLGKLKQENVSTLTILVMGKGGVGKSSTVNSIIGE
RAVAVSAFQSEGPRPVMVSRSRAGFTLNIIDTPGLVEGGYVNDQALEIIKRFLLNKTIDV
LLYVDRLDAYRVDNLDRQVVKAITDSFGKEIWRRGVVVLTHAQLSPPDGLNYEDFFSKRS
EALMKVVRSGARLRKQDIQDSGIPVVLVENSGRCHKNESDEKILPNGTAWIPNLVKTITD
AVSNGSKGILVDKKLIEGPNPNERGKLLIPFILAFQYFFIVKRIQRAIKSDMAKERKAPW
ESREANRYEP
>stToc34-2
MASQIIREWAGIQQFPAATQSKLLELLGKLKQENVSTLTILVMGKGGVGKSSTVNSIIWE
RAVAVSAFQSETPRPVMVSRSRAGFTLNIIDTPGLVEGGYVNDQALDLIKKFLLNKTIDV
LLYVDRLDAYRVDNLDKQIVKAITDSFGKEIWRRGIVVLTHAQLSPPDGLTYDEFTSRRS
EALLKIVRMGARIRKQDIQAASIPVVLVENSGRCNKNESDEKILPSGTAWIPNLVQTITD
AVLSGSKGILVDQKLIEGPNPNNRGKVLIPFILAFQYFFVVKRIQKSIKNDIARESRPAW
A
>leToc34-2
MASQIIREWAGIQQFPAATQSKLLELLGKLKQENVSTLTILVMGKGGVGKSSTVNSIIGE
RAVAVSAFQSETPRPVMVSRSRAGFTLNIIDTPGLVEGGYVNDQALDLIKKFLLNKTIDV
LLYVDRLDAYRVDNLDKQIVKAITDIFGKEMWCRGIVVLTHAQLSPPDGLTYEEFTSRRS
EALLKIVRMGARIRKQDIQAASIPVVLVENSGRCNKNESDEKILPSGIAWIPNLVQTITD
AVLSGSKGILVDQKLIEGPNPNNRGKVLIPFILAFQYFFVVKRIQRSIKNDIARETRPSW
A
>cmToc34
MDSETPTKNEAEQRASPDRTGQVTQRPVSLFRKNGTFAYPLEDSDVYEEQVLALEDVPEP
TAQAILRLALAAERQGVPRLRFLVVGAPGVGKSSLINTLLNENLCSVSAWERGTKNAQVC
ARQVDSVVIEFIDTPGIAPCRRSGLEASRRQVQRLRKLLDARGADEHPYLRSFHAILYVM
RLDDTRPDLVDYHNWKVLMEFFGAEVLRHMMVVFTHGQSLPPDSLSYPEYVRGRRDYVYL
LIERLTGPLKAVRFPVFVAENSSKCPVIEETGERKLPDDTPWITQLYDGIRRFVFPLEAD
LFGMETGPEDTQVLVYIYDKRRSRADERYPRSPLQALIRNPWFLRAVQFCGAMLLRSYMI
RQEHERFNPKPHHPEPIIRDANNAFAVASRRANDHRLFTPSIDEDEESFFRMNGNDDFVS
RLRNRPGEVDLDELDVERIESPDGRFVEYWYTEKDNPEMVRMYRLEIRDDPNEERESRQD
RIPISKDQH
>otToc34
MSDEEYSEDEYVSSEGEGAEGRDVEPQAQQAAPVLGPKEWVGLSSMPAATQQALLETLGK
LRERNVNEMTVIFIGKQGVGKSSTVNTLLNERVAPSSPFQPENARPLLAGRVAAGFTLNV
LDTPGLLDGDSISARGLMALRAALNGRKVDAFIFTDRLDTWRVDNSDRAIFTALAENFGA
ELWERTVLGFSHAQTTPPDGKPYEEFVNARVEQYRKAIRQTLGMPNLTLPFALIENGSRC
KANAAGEKVVNERPWLTDMVGTMVEMACAKESYEYDHKKAGKKLDPNNKYKIWMLPLFLF
QAFVLRPLMIGQIRRDIRKSDEDKKKKSARPAPKK
>Amborella_trichopoda_gnl|BL_ORD_ID|8412 evm_15.model.AmTr_v1.0_scaffold00041.111 EVM_15_evm_15.TU.AmTr_v1.0_scaffold00041.111 AmTr_v1.0_scaffold00041:2858431-2865733(+)
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------MAENGVKVEDIHVSNREDVVVKE
FQLKPGEAKDSEGDEVFEEAMEAQPDDGQSRSLEPHGVAENGEREKKDDASEGNGDDKTK
GDDRFDVKDNKRAEVDEVFGENGEKENEDDGFEESHENRERFYEAIGLSKEE--------
------------------------------------------------------------
NNVEERSESKEGSKPSLENGHIGQADIVSSDTTLYENHANNEPVVEEADGGKLAAEITEP
LAKSAIQDALKVDVNQDGIPELKNGDADFDLNEAEGTDFVIGSNNDPGTLGPSLIDVNVK
EKGSPSTEMDIDIDEVDYKCEDVNMDNMIIDEASLLPESEAPAKNAHEFSLLASYETSDI
QEDTQALLIEDAGDIPRGDTQVALDMETADWSGILPENEGHEQSTHESPPLVSHETSDIQ
EETQGSQAEDIGDVTVPNLNSASVTSQSMGTGEGDSISAIDNDDAQESHIPEPTIVIPVE
LESNKAEAQDGPITNKLLGKGSSSSTKWDQLGSSSSSSSSDDDNNEHDSIQSMAASRISA
PSQSTTTSTLPPPPARPAGLGSSGSLLEPAPRTQQQSRVNGSAP-LRQSQL----VEEVA
NGETDENSETREKLQMIRVKFLRLAHRLGQTPHNSVVAQVLYRLGLAEQLRRRR--DTNR
AGAF--SFDTASAMAEQLE-AAGQ--EPLDFSCTIMVLGKSGVGKSATINSIFDE-VKFS
TDAFEL----GTKKVQDIVGTVQGIKVRVIDTPGLLPS-FADQRQNEKTLQSVKRFIKKT
PPD---------IVLYLDRLDMQSRDYGDLPLLRTITEIFGPAIWFNAIVVLTHAGSAPP
DGPNGSPLSYEMFVAQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPQLL------LLSFASKILA------EANTLLKLQD-V-----PNE
RPF----------------SGR-SRVPPLP---------------FLLSSLLQSRPQLRL
PEEQY-S-DEDAF-DEDI-DES--SHSD----DG-SDYDNLPPFKRLTQNHLAKFSKEQK
KAYYEELDYREKLFIKKQLKEEKKRRKIL---KK-MASSV-EDWS-SEYN-ES-TEE-ES
SSAESVPVTIPDVTLPASFD-SDNPTHRYNCLD-L-PNQWLVRPVLEVHGWDRDVGYEGL
NVERLFVVKNK-----IPISVSGQITKDKKETNLQMECTGSLK-HG---EGKSTSL----
GFDAQTV-GKEVAYTLRSDTRFANF--RY-NKTAAGLSVALFGDA-------ITAGVKLE
DKLLVK---------KWFTVVMTGGAMVGRGDVAY---------GGSLEATLRDKDYPLG
RFLSTLGLSVM-DWHGDLAIGCNLQTQFPVGRWFNMIARGNLN-NRGAGQYQVSTDAFFG
EKTEDAMVRSPDLVQRGHG-----------------------------------------
------------------------------------------------------------
-I
>atToc120_gi|332642323|gb|AEE75844.1| translocase of chloroplast 120 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MGDGAEIVTRLYGDEKK
LAEDGRISELVGSDEVKDNEEEVFEEAIGSQEGLKPESLKTDVLQEDFPLASNDEVCDLE
ETSRNERGVENLKVNYSEIGESHGEVNEQCITTKEADSDLVTLKMNDYDHGEVADADISY
GKMASSLDVVENSEKATSNLATEDVNLENGNTHSSSENGVVSPDENKELVAEVISVSACS
VETGSNGIDDEKWEEEIDVSAGMVTEQRNGKTGAEFNSVKIVSGDKSLNDSIEVAAGTLS
PLEKSSSEEKGETESQNSNGGHDIQSNKEIVKQQDSSVNIGPEIKESQHMERESEVLSSV
SPTESRSDTAALPPARPAGLGRAAPLLEPAPRVTQQPRVNGNVS-HNQPQQ----AEDST
TAETDEHDETREKLQFIRVKFLRLSHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAAQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-LKIS
TDAFQV----GTKKVQDIEGFVQGIKVRVIDTPGLLPS-WSDQHKNEKILKSVRAFIKKS
PPD---------IVLYLDRLDMQSRDSGDMPLLRTITDVFGPSIWFNAIVGLTHAASAPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
GQF----------------ATR-SKAPPLP---------------LLLSSLLQSRPQAKL
PEQQY-D-DEDD--EDDL-DES--SDSE----EE-SEYDELPPFKRLTKAEMTKLSKSQK
KEYLDEMEYREKLFMKRQMKEERKRRKLL---KK-FAAEI-KDMP-NGYS-EN-VEE-ER
SEPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-T-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKDK-----IPVSFSGQVTKDKKDAHVQLELASSVK-HG---EGRSTSL----
GFDMQNA-GKELAYTIRSETRFNKF--RK-NKAAAGLSVTLLGDS-------VSAGLKVE
DKLIAN---------KRFRMVMSGGAMTSRGDVAY---------GGTLEAQFRDKDYPLG
RFLSTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSIRVNS--S
EQLQLAVVALVPLFKKLLT-YYS---------------------------------PEQM
QYGH--------------------------------------------------------
--
>gnl|BL_ORD_ID|26585 Arabidopsis_thaliana AT3G16620.1|PACid:19664532
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MGDGAEIVTRLYGDEKK
LAEDGRISELVGSDEVKDNEEEVFEEAIGSQEGLKPESLKTDVLQEDFPLASNDEVCDLE
ETSRNERGVENLKVNYSEIGESHGEVNEQCITTKEADSDLVTLKMNDYDHGEVADADISY
GKMASSLDVVENSEKATSNLATEDVNLENGNTHSSSENGVVSPDENKELVAEVISVSACS
VETGSNGIDDEKWEEEIDVSAGMVTEQRNGKTGAEFNSVKIVSGDKSLNDSIEVAAGTLS
PLEKSSSEEKGETESQNSNGGHDIQSNKEIVKQQDSSVNIGPEIKESQHMERESEVLSSV
SPTESRSDTAALPPARPAGLGRAAPLLEPAPRVTQQPRVNGNVS-HNQPQQ----AEDST
TAETDEHDETREKLQFIRVKFLRLSHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAAQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-LKIS
TDAFQV----GTKKVQDIEGFVQGIKVRVIDTPGLLPS-WSDQHKNEKILKSVRAFIKKS
PPD---------IVLYLDRLDMQSRDSGDMPLLRTITDVFGPSIWFNAIVGLTHAASAPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
GQF----------------ATR-SKAPPLP---------------LLLSSLLQSRPQAKL
PEQQY-D-DEDD--EDDL-DES--SDSE----EE-SEYDELPPFKRLTKAEMTKLSKSQK
KEYLDEMEYREKLFMKRQMKEERKRRKLL---KK-FAAEI-KDMP-NGYS-EN-VEE-ER
SEPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-T-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKDK-----IPVSFSGQVTKDKKDAHVQLELASSVK-HG---EGRSTSL----
GFDMQNA-GKELAYTIRSETRFNKF--RK-NKAAAGLSVTLLGDS-------VSAGLKVE
DKLIAN---------KRFRMVMSGGAMTSRGDVAY---------GGTLEAQFRDKDYPLG
RFLSTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSIRVNS--S
EQLQLAVVALVPLFKKLLT-YYS---------------------------------PEQM
QYGH--------------------------------------------------------
--
>atToc120_gi|332642323|gb|AEE75844.1| translocase of chloroplast 120 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNVS-HNQPQQ----AEDST
TAETDEHDETREKLQFIRVKFLRLSHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAAQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-LKIS
TDAFQV----GTKKVQDIEGFVQGIKVRVIDTPGLLPS-WSDQHKNEKILKSVRAFIKKS
PPD---------IVLYLDRLDMQSRDSGDMPLLRTITDVFGPSIWFNAIVGLTHAASAPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
GQF----------------ATR-SKAPPLP---------------LLLSSLLQSRPQAKL
PEQQY-D-DEDD--EDDL-DES--SDSE----EE-SEYDELPPFKRLTKAEMTKLSKSQK
KEYLDEMEYREKLFMKRQMKEERKRRKLL---KK-FAAEI-KDMP-NGYS-EN-VEE-ER
SEPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-T-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKDK-----IPVSFSGQVTKDKKDAHVQLELASSVK-HG---EGRSTSL----
GFDMQNA-GKELAYTIRSETRFNKF--RK-NKAAAGLSVTLLGDS-------VSAGLKVE
DKLIAN---------KRFRMVMSGGAMTSRGDVAY---------GGTLEAQFRDKDYPLG
RFLSTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSIRVNS--S
EQLQLAVVALVPLFKKLLT-YYS---------------------------------PEQM
QYGH--------------------------------------------------------
--
>Arabidopsis_lyrata_gnl|BL_ORD_ID|12951 _479127|PACid:16046698
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNVS-HNQPQQ----AEDST
TGETDEHDETREKLQFIRVKFLRLSHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAGQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-LKIS
TDAFQM----GTKRVQDIEGFVQGIKVRVIDTPGLLPS-WSDQHKNEKILKSVRAFIKKN
PPD---------IVLYLDRLDMQSRDSGDMPLLRTITDVFGPSIWFNAIVGLTHAASAPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
EQF----------------AAR-SKAPPLP---------------LLLSSLLQSRPQAKL
PEQQY-D-DEED--EDDL-DES--SDSD----EE-SEYDELPPFKRLTKAEMAKLSKSQK
KEYLDEMEYREKLFMKRQMKEERKRRKLL---KK-FAAEI-KDMP-NGYS-EN-VEE-ER
SEPAAVPVPMPDLSLPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKDK-----IPVSFSGQVTKDKKDANVQLELASSVK-HG---DGRSTSL----
GFDMQNA-GKELAYTVRSETKFNSF--RK-NKAAAGLSVTLLGDS-------VSAGLKVE
DKLIAN---------KRFRMVMSGGAMTSRGDVAY---------GGTLEAQFRDKDYPLG
RFLSTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVTIRVNS--S
EQLQLAVVALVPLFKKLLSYYYS---------------------------------PEQM
QYGH--------------------------------------------------------
--
>Capsella_rubella_gnl|BL_ORD_ID|15190 _v10012861m|PACid:20900913
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNVY-QNQPQQ----AEDST
TAETDEHDETREKLQLIRVKFLRLAHRLGQTPHNVIVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-VAGQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-LKIS
TDAFQM----GTKRVQNVEGFVQGIKVRVIDTPGLLPS-WSDQHKNEKILKSVRAFIKKN
PPD---------IVLYLDRLDMQSRDSGDMPLLRTITDVFGPSIWFNAIVGLTHAASAPP
DGPNGTASSYEMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
GQF----------------AAR-SKAPPLP---------------VLLSSLLQSRPQAKL
PEEQY-D-DEED--EDDL-DES--TDSD----EE-PEYDDLPPFKWLTKAEMAKLSKSQK
KEYLDEMDYREKLFMKRQMKEERKRRKLL---KK-FAAEI-KDMP-NRYS-EN-VEE-ER
SEPASVPVPMPDISLPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKEK-----IPISFSGQVTKDKKDANVQVELASSVK-HG---EGRSTSL----
SLDMQNA-GKDLAYTVRSETRFNNF--RK-NKAAAGLSVTLLGDS-------VSAGLKVE
DKLIAN---------KRFRMVMSGGAMTSRGDVAY---------GGSLEAQFRDKDYPLG
RFLSTLGLSVM-DWHGDLAIGGNVQSQVPIGRSSNLIARANLN-NRGAGQVSVRVNS--S
EQLQLAMVALVPLFKKLLS-YYS---------------------------------PEKM
QY----------------------------------------------------------
--
>atToc132_gi|330251427|gb|AEC06521.1| translocase of chloroplast 132 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MGDGTEFVVRSDRED
KKLAEDRISDEQVVKNELVRSDEVRDDNEDEVFEEAIGSENDEQEEEEDPKRELFESDDL
PLVETLKSSMVEHEVEDFEEAVGDLDETSSNEGGVKDFTAVGESHGAGEAEFDVLATKMN
GDKGEGGGGGSYDKVESSLDVVDTTENATSTNTNGSNLAAEHVGIENGKTHSFLGNGIAS
PKNKEVVAEVIPKDDGIEEPWNDGIEVDNWEERVDGIQTEQEVEEGEGTTENQFEKRTEE
EVVEGEGT----------------------------------------------------
--------SKNLFEKQTEQDVVEGEGTSKDLFENGSVCMDSESEAERNGETGAAYTSNIV
TNASGDNEVSSAVTSSPLEESSSGEKGETEGDSTCLKPEQHLASSPHSYPESTEVHSNSG
SPGVTSREHKPVQSANGGHDVQSPQPNKELEKQQSSRVHVDPEITENSHVETEPEVVSSV
SPTESRSNPAALPPARPAGLGRASPLLEPASRAPQQSRVNGNGS-HNQFQQ----AEDST
TTEADEHDETREKLQLIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAGQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-VKFC
TDAFQM----GTKRVQDVEGLVQGIKVRVIDTPGLLPS-WSDQAKNEKILNSVKAFIKKN
PPD---------IVLYLDRLDMQSRDSGDMPLLRTISDVFGPSIWFNAIVGLTHAASVPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
RPF----------------AAR-SKAPPLP---------------FLLSSLLQSRPQPKL
PEQQY-G-DEED--EDDL-EES--SDSD----EE-SEYDQLPPFKSLTKAQMATLSKSQK
KQYLDEMEYREKLLMKKQMKEERKRRKMF---KK-FAAEI-KDLP-DGYS-EN-VEE-ES
GGPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKEK-----IPISVSGQVTKDKKDANVQLEMASSVK-HG---EGKSTSL----
GFDMQTV-GKELAYTLRSETRFNNF--RR-NKAAAGLSVTHLGDS-------VSAGLKVE
DKFIAS---------KWFRIVMSGGAMTSRGDFAY---------GGTLEAQLRDKDYPLG
RFLTTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSVRVNS--S
EQLQLAMVAIVPLFKKLLS-YYY----------------------------------PQT
QYGQ--------------------------------------------------------
--
>atToc132_gi|330251427|gb|AEC06521.1| translocase of chloroplast 132 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNGS-HNQFQQ----AEDST
TTEADEHDETREKLQLIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAGQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-VKFC
TDAFQM----GTKRVQDVEGLVQGIKVRVIDTPGLLPS-WSDQAKNEKILNSVKAFIKKN
PPD---------IVLYLDRLDMQSRDSGDMPLLRTISDVFGPSIWFNAIVGLTHAASVPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
RPF----------------AAR-SKAPPLP---------------FLLSSLLQSRPQPKL
PEQQY-G-DEED--EDDL-EES--SDSD----EE-SEYDQLPPFKSLTKAQMATLSKSQK
KQYLDEMEYREKLLMKKQMKEERKRRKMF---KK-FAAEI-KDLP-DGYS-EN-VEE-ES
GGPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKEK-----IPISVSGQVTKDKKDANVQLEMASSVK-HG---EGKSTSL----
GFDMQTV-GKELAYTLRSETRFNNF--RR-NKAAAGLSVTHLGDS-------VSAGLKVE
DKFIAS---------KWFRIVMSGGAMTSRGDFAY---------GGTLEAQLRDKDYPLG
RFLTTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSVRVNS--S
EQLQLAMVAIVPLFKKLLS-YYY----------------------------------PQT
QYGQ--------------------------------------------------------
--
>Arabidopsis_lyrata_gnl|BL_ORD_ID|7943 _480549|PACid:16041690
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNGS-HNQSQQ----AEDST
TVETDEHDETREKLQLIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAGQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-VKFC
TDAFQM----GTKRVQDVDGLVQGIKVRVIDTPGLLPS-WSDQAKNEKILNSVKAFIKKN
PPD---------IVLYLDRLDMQSRDSGDMPLLRTISDVFGPSIWFNAIVGLTHAASVPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
RPF----------------AAR-SKAPPLP---------------FLLSSLLQSRPQPKL
PEQQY-G-DEED--EDDL-DES--SDSD----EE-SEYDQLPPFKSLTKAQMATLSKSQK
KQYLDEMEYREKLLMKKQMKEERKRRKMF---KK-FAAEI-KDLP-DGFS-EN-VED-ES
GGPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVKDK-----IPISVSGQVTKDKKDANVQLEMASSVK-HG---EGKSTSL----
GFDMQTV-GKELAYTLRSETRFNNF--RR-NKAAAGLSVTLLGDS-------VSAGLKVE
DKLIAS---------KWFRMVMSGGAMTSRGDFAY---------GGTLEAQLRDKDYPLG
RFLTTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSVRVNS--S
EQLQLAMVAIVPLFKKLLS-YCY----------------------------------PQT
QYGQ--------------------------------------------------------
--
>Capsella_rubella_gnl|BL_ORD_ID|13020 _v10012842m|PACid:20898735
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNVS-HNQSQQ----TEDST
TAEADEHDETREKLQLIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-SAGQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-VKFC
TDAFQM----GTKRVQDVEGFVQGIKVRVIDTPGLLPS-WSDQAKNEKILNSVKAFIKKN
PPD---------IVLYLDRLDMQSRDSGDMPLLRTISDVFGPSIWFNAIVGLTHAASVPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
RPF----------------VAR-SKAPPLP---------------FLLSSLLQSRPQPKL
PEQQY-G-DEED--EDDL-DES--SGSD----EE-SEYDQLPPFKSLTKAQMATLSKSQK
KQYLDEMEYREKLLMKKQMKEERKRRKMF---KK-FAAEI-KDLP-DGYN-EN-VEE-ES
GGPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDIGYEGV
NAERLFVVNEK-----IPISFSGQVTKDKKDANVQLEMASSLK-HG---EGKSTSL----
GFDMQTV-GKELAYTLRSETRFNNF--RR-NKAAAAVSVTLLGDS-------VSAGMKVE
DKLIAN---------KWFRMVMSGGAMTSRGDVAY---------GGSLEAQFRDKDYPLG
RFLTTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSVRVNS--S
EQLQLAMVAIVPLFKKLLS-YYY---------------------------------SPQT
QYGQ--------------------------------------------------------
--
>Thellungiella_halophila_gnl|BL_ORD_ID|22651 _Thhalv10022525m|PACid:20202302
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNVS-HSQPQQ----AEDST
TAETDEHDETREKLQLIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASAMAEQLE-AAGQ--DPLDFSCTIMVLGKSGVGKSATINSIFDE-VKFC
TDAFQM----GTKRVQDVEGFVQGIKVRVIDTPGLLPS-WSDQSKNEKILNSVKAFIKKN
PPD---------IVLYLDRLDMQSRDSGDMPLLRTISDVFGPSIWFNAIVGLTHAASVPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAEDMR-----LMNPISLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-N-----IPG
RPF----------------AAR-TKAPPLP---------------FLLSSLLQSRPQPKL
PEQQY-G-DEED--EDDL-DES--SDSD----EE-SEYDQLPPFKHLTKDQMAKLSKSQK
KQYLDEMEYREKLLMKKQMKEERKRRKMF---KK-FAAEI-KDLPNEPPS-DN-VEE-ES
GGPASVPVPMPDLSLPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDIGYEGV
NAETLFVVNKQ-----IPVSLSGQVTKDKKDANVQLEMASSVK-HG---EGRSTSL----
GFDMQTV-GKELAYTVRGETRFNNF--RR-NKAAAGLSLTLLGDS-------VSAGLKVE
DKLIAN---------KWFRMVMSGGAMTSRGDVAY---------GGSLEAQLRDKDYPLG
RFLTTLGLSVM-DWHGDLAIGGNIQSQIPIGRSSNLVARANLN-NRGAGQVSVRVNS--S
DQLQLAMVAIVPLFKKLLS-YYS----------------------------------QQT
QYGQ--------------------------------------------------------
--
>Thellungiella_halophila_gnl|BL_ORD_ID|3984 _Thhalv10022323m|PACid:20183478
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNVS-HDQHQQ----VEDS-
TAETDEHDETREKLQLIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--SGSR
VGAF--SFDRASAMAEQLE-AAGQ--DPLDFSCTIMVLGKSGVGKSTTINSIFDE-VKMS
TDAFQM----GTKRVQNVEGFVQGIKVRVIDTPGLLPS-WSDQHKNEKILRSVRAFIKKN
PPD---------IVLYLDRLDTQSRDSGDMPLLRTIIDVFGPSIWFNAIVGLTHAASAPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDVR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKSQD-N-----TAG
RPF----------------AAR-SKAPPLP---------------FLLSSLLQSRPQAKL
PEEQY-G-DGED--EDGL-DES--SDSD----EE-SEYDQLPPFKRLTKAEMAKLSKSQK
KQYLDEMDYREKLFMKKQMKEERKRRKML---KK-FAAEI-KDLP-NGHS-EN-VEE-ER
SEPASVPVPMPDLSLPASFD-SDNPTHRYRSLD-S-SNQWLVRAVLETHGWDHDVGYEGV
SAERLFVIKEK-----IPISFSGQVTKDKKDATVQLEMASSVK-HG---KGRSTSL----
GFDMQNV-GKELAYTVRSDTRFKNF--RN-NKAAAGLSVTLLGDS-------VSAGLKVE
DKLIAN---------KWFRMVMSGGAMTSRGDVAY---------GGSLEAQLRDKDYPLG
QCLSTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSIRVNS--S
EQLQLAMVALVPLFKKLL------------------------------------------
------------------------------------------------------------
--
>Brassica_rapa_gnl|BL_ORD_ID|1598 _022170|PACid:22685108
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGNAS-QNQSEQ----AEDPT
PAETDEHDETREKLQLIRVKFLRLSHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGSR
VGAF--SFDRASSMAEQLE-AAGQ--DPLDFSCTVMVLGKSGVGKSATINSIFDE-VKIC
TDAFQM----GTKRVQEVEGFVQGIKVRVIDTPGLLPS-WSDQHKNEKMLKSVKVFIKKN
PPD---------IVLYLDRLDMQSRDSGDTPLLRTITDVFGPSIWFNAIVGLTHAASAPP
DGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQDNN-----TPG
RPF----------------VAR-SKAPPLP---------------LLLSSFLQSRPQAKL
PEEQY-G-DEED--EDDL-DES--SGSD----EE-SEYDQLPPFKRLTKAEMARLSKSQK
KQYLDEMEYREKLFMKRQMKEERKRRKMM---KK-FAAEI-KDMA-EEHS-EN-VEE-ER
SEPASVPVPMPDLSLPASFD-SDNPTHRYRSLD-S-SNQWLVRPVLETQGWDHDVGYEGV
NAERLFVVKEK-----IPISFSGQVTKDKKDANVQLEMAGSVK-HG---EGRSTSL----
----------------------------------------------------------VE
DKLIAN---------KRFRMVMCGGAMTSRGDVAY---------GGSLEAQLRDKDYPLG
RFLSTLGLSVM-DWHGDLAIGGNIQSQVPIGRSSNLIARANLN-NRGAGQVSVRVNS--S
EQLQLAMVALVPLFKKLFS-YYS---------------------------------PQQM
QY----------------------------------------------------------
--
>Aquilegia_coerulea_gnl|BL_ORD_ID|13734 _006_00193.1|PACid:22036769
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGAGP-QRQAQV----LEDPV
NGEAEENDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NAGR
VGAF--SFDRASAMAEQLE-SAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-SKFI
TDAFQM----GTKKVQDVVGTVQGIKVRVIDTPGLLPC-WSDQRQNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQTRDFGDLPLLRTITEIFGPSIWFNAIVVLTHAASAPP
DGPNGISSSYEMFVSQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANTLLKLQD-N-----PPG
KPF----------------ATR-ARVPPLP---------------FLLSSLLQSRPQLKL
PEEQF-G-DEDGL-DEDL-DES--SDSD----DE-SEYDELPPFKRLTKAQLAKLSKLQK
KAYFDELEYREKLFMRKQLREDKRRRKLL---KK-MAVSA-KEVP-TDYT-ES-AED-ES
GGGASVPVPMPDFALPASFD-SDNPSHRYRFLD-T-SNAWLVRPVLETHGWDHDVGYEGI
NVERLFVVKDK-----IPVSFSGQATKDKKESNLQVELATSIK-HN---EGKATSV----
GFDMQTV-GKDMSYTLRSETKFSNF--RH-NKAAAGLSVTLLGDA-------LTAGVKLE
DKLIVN---------KRFRLVLTGGAMTGRGDVAY---------GGSLEATLRDKDYPLG
RMLSTLGLSIM-DWHGDLAIGCNVQSQIPIGRNSNLIARANLN-NRGSGQVSIRVNS--S
EQLQLALVGLLPLFRKALS-LYQ-----------------------------------QT
RYGE--------------------------------------------------------
--
>Citrus_clementina_gnl|BL_ORD_ID|26953 _0.9_001850m|PACid:19278112
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGAIS-HTQTQP----IEDPG
NGEAEEYDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFG
TDAFQM----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-WSDQRQNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQNRDFSDMPLLRTITDIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANTLLKLQD-T-----PPG
KPF----------------SAR-SRAPPLP---------------FLLSSLLQSRPQVKL
PEEQF-G-DEDSL-DDDL-DDS--SESE----DE-SEFDELPPFKRLTKAQVAKLTKAQK
RAYFDELEYREKLFMKKQLKEEKKRRKMM---KK-MAAAA-KDLP-SDNS-EN-VEE-ES
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDVGYEGI
NAERLFVVKNK-----IPISFSGQVTKDKKDANVQMEVVSSLK-HG---EGKATSL----
GFDMQTV-GKDLAYTLRSETRFSNF--RK-NKAMAGLSVTHLGDS-------LSAGVKVE
DKLIVN---------KRFRVVMTGGAMTSRSDVAY---------GGSLEAQLRDADYPLG
RSLTTLGLSVM-DWHGDLAIGCNIQSQVPIGRSTNMIGRANLN-NRGAGQVSIRVNS--S
EQLQLALIGLIPLLKKLLG-YSQ-----------------------------------QM
QLGQ--------------------------------------------------------
--
>Citrus_sinensis_gnl|BL_ORD_ID|12897 _1.1g000825m|PACid:18104583
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGAIS-HTQTQP----IEDPG
NGEAEEYDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFG
TDAFQM----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-WSDQRQNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQNRDFSDMPLLRTITDIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANTLLKLQD-T-----PPG
KPF----------------STR-SRAPPLP---------------FLLSSLLQSRPQVKL
PEEQF-G-DEDSL-DDDL-DDS--SESE----DE-SEFDELPPFKRLTKAQVAKLTKAQK
RAYFDELEYREKLFMKKQLKEEKKRRKMM---KK-MAAAA-KDLP-SDNS-EN-VEE-ES
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDVGYEGI
NAERLFVVKNK-----IPVSFSGQVTKDKKDANVQMEVVSSLK-HG---EGKATSL----
GFDMQTV-GKDLAYTLRSETRFSNF--RK-NKAMAGLSVTHLGDS-------LSAGVKVE
DKLIVN---------KRFRVVMTGGAMTSRSDVAY---------GGSLEAQLRDADYPLG
RSLTTLGLSVM-DWHGDLAIGCNIQSQVPIGRSTNMIGRANLN-NRGAGQVSIRVNS--S
EQLQLALIGLIPLLKKLLG-YSQ-----------------------------------QM
QLGQ--------------------------------------------------------
--
>Populus_trichocarpa_gnl|BL_ORD_ID|22513 _POPTR_0009s13370.1|PACid:18228772
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANGAVS-HTQSQQ----IEDPT
NGESEEFDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--SGGR
VAGF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFG
TDAFQL----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-WSDQRQNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQSRDFGDMPLLRTITDIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHAVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----TPA
KPF----------------ATR-SRAPPLP---------------FLLSSLLQSRPQVKL
PEEQY-G-GEDGL-DDDL-DDS--SDSE----DE-SEYDELPPFKSLTRAQISKLTKAQK
KAYFDELEYREKLFMKKQLKEEKRRQKMM---KK-MAAAA-KDLP-SEYI-EN-AEE-EG
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLD-T-SNQWLVRPVLETHGWDHDVGYEGI
NVERLFVVKDK-----IPLSFSGQVTKDKKDASVQMELASSVK-HG---EGKATSL----
GFDMQTV-GKDLAYTLRSETRFSNF--RK-NKATAGLSVTLLGDV-------LSTGVKVE
DKLIAG---------KRFQMVMSGGAMSGRGDVAY---------GGSLEIQLRDKDYPLG
RSLSTLGLSVM-DWHGDLAIGCNLQSQIPIGRSTNLIGRANLN-NRGAGQISIRLNS--S
EQLQLALIGLIPLLKKLIE-YPQ-----------------------------------QL
QLGQ--------------------------------------------------------
--
>Manihot_esculenta_gnl|BL_ORD_ID|8383 _4.1_000389m|PACid:17968165
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGTMS-HVQSQQ----VEDLA
NGEGDEYDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFG
TDAFQL----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-GSDQRQNEKILNSVKHFIKQT
PPD---------IVLYLDRLDMQSRDFGDMPLLRTITEIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANTLLKLLD-S-----PPG
KPF----------------ATRSSRAPPLP---------------FLLSSLLQSRQQVKL
PEEQL-G-DEDGL-DDDL-EES--SDSE----DE-SEYDDLPPFKSLTKAQVAKLTRAQK
KAYFDELEYREKLFMKKQLKEEKKRQKMM---KK-MAAEA-KDLP-SDYS-EN-VEE-ES
GDAASVPVPMPDLALPASFD-SDNPTHRYRYLD-T-SNQWLVRPVLETHGWDHDVGYEGI
NAERLFVVKDK-----IPLSVSGQVTKDKKDANVQMELASCIK-HG---DGKSTSL----
GFDMQTV-GKDLSYTLRSETKFCNY--RK-NKATAGLSVTLLGDV-------VSAGLKVE
DKLIVN---------KRFRMVLSGGAMTGRGDVAY---------GGSLEAQLRDKDYPLG
RSLSTLGLSVM-DWHGDLAVGCNIQSQLPIGRSTNLIARGNLN-NRGAGQISIRINS--S
EQLQIALVGLLPLLKKLFD-YPQ-----------------------------------QM
QYGQ--------------------------------------------------------
--
>Ricinus_communis_gnl|BL_ORD_ID|9808 _29756.m000509|PACid:16807973
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGTMS-HVQSQQ----VEDPT
NGEGDENDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFG
TDAFQL----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-GSDQRQNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQSRDFGDMPLLRTITEIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----PPG
MPS----------------ATR-SRAPPLP---------------FLLSSLLQSRPQLKL
PEEQF-G-DGDGL-DDDL-EES--SDSE----DD-SDYEDLPPFKSLTKAQVAKLTRAQR
KAYFDELEYREKLFMKKQLKEEKRRRKMM---KK-MAAAA-KDLP-SDYN-EN-LED-ET
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLD-T-SNQWLVRPVLETHGWDHDVGYEGI
NVERLFVVKDK-----IPLSFSGQVTKDKKDANVQMEVASSIK-HG---EGKSTSL----
GFDMQTV-GKDLAYTLRSETRFCNF--RK-NKATAGLSITLLGDA-------LSAGLKVE
DKLIAN---------KRFRMVVSGGAMTGRGDIAY---------GGSLEAQLRDKDYPLG
RSLSTLGLSVM-DWHGDLAVGCNIQSQVPIGRSTNLIARGNLN-NRGAGQISVRVNS--S
EQLQIALVGLLPLLKKLFS-HPQ-----------------------------------QV
QY----------------------------------------------------------
--
>Malus_domestica_gnl|BL_ORD_ID|24019 _0000872008|PACid:22643995
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGTVS-HAQNQQ----IEDPV
NGETEESDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-ASGN--EPLDFACTIMVLGKSGVGKSATINSIFDE-KRFT
TDAFQM----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-WSDQRQNEKTLLNVKRFIKKT
PPD---------IVLYLDRLDMQSRDFSDMPLLRTITDIFGPSIWFNAIVVLTHAGSAPP
EGPNGAASSYDMFVTSRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRI-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----PPG
KPF----------------ATR-TRAPPLP---------------FLLSSLLQSRPQLKL
PEEQF-G-XDDSL-DDDL-DES--SDSD----DE-SEFDELPPFRRLTKAQVEKLSKAQK
KAYFDELEYREKLFMKKQLKEEKKRRKLM---KK-MAAAS-NELP-SDYV-EN-VEE-DS
SGAASVPIPMPDLALPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLEQHGWDHDVGYEGI
NAERLFVVKEK-----IPLSFSGQVTKDKKDANVQMEIATSIK-HG---EGKATSL----
GFDMQTV-GKDLAYTLRSDTRISNF--RK-NKATAGLSVTLLGDA-------VSAGMKVE
DKFIAN---------KRFQLVMTGGAMTARGDVAY---------GGSLEAQLRDKDHPLG
RSLSTLGLSVM-DWHGDLAIGCNIQSQIPVGRHTNLIARANLN-NRGAGQLSLRLNS--S
EQLQLALIGLVPLLRKLFT-FPQ-----------------------------------QL
QYGQ--------------------------------------------------------
--
>Prunus_persica_gnl|BL_ORD_ID|26237 _ppa000337m|PACid:17666894
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGTVS-HVQNQQ----IEDPA
NGEAEESDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-ASGN--EPLDFACTIMVLGKTGVGKSATINSIFDE-VKFN
TDAFQM----GTKKVQDVVGTVQGIRVRVIDTPGLLPS-WSDQRQNEKILLAVNRFIKKT
PPD---------IVLYLDRLDMQSRDFSDMPLLRTITDIFGASIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----PPG
KPF----------------ATR-SRAPPLP---------------FLLSSLLQSRPQLKL
PEEQF-G-DDDSL-DDEL-DES--SDSD----DE-SEYDELPPFKRLTKAQVEKLSKAQK
KAYFDELEYREKLFMKKQLKEEKKRRKLM---KK-LAASA-MELP-NDYG-EN-VEE-ES
SGAASVPVPMPDLALPASFD-SDNPSHRYRYLD-S-SNQWIVRPVLETHGWDHDVGYEGI
NAERLFVVKDK-----IPLSFSGQVTKDKKDANVQMEVASSIK-YG---EGKATSL----
GFDMQTV-GKDLAYTLRSDTRFSNF--KK-NKATAGLSVTLLGDA-------LSAGMKVE
DKFIAN---------KRCQMVMTGGAMTARGDIAY---------GCTLEAQLRDKDYPLG
RSLSTLSLSVM-DWHGDLAIGGNIQSQIPVGRHTNLIARANVN-NRGAGQISVRLNS--S
EQLQIALFGLIPLLRKFFT-YPQ-----------------------------------QL
QYGQ--------------------------------------------------------
--
>Cucumis_sativus_gnl|BL_ORD_ID|31124 _381760.1|PACid:16982243
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGTVS-HVQMQQ----IDDPV
NGDAEENDDTREQLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFS
TDAFQM----GTKKVQDVVGTVQGIRVRVIDTPGLLSS-WSDQRQNEKILLSVKRFIKKT
PPD---------IVLYLDRLDMQTRDFSDMPLLRTITEIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANTLLKLQD-S-----PPG
RPF----------------TPR-SKSPPLP---------------FLLSSLLQSRPQVKL
PEEQF-G-DDDGL-EDDL-DES--SDSE----NE-SEYDELPPFKRLTKAQVAKLSKAQK
KAYFDELEYREKLFMKKQLKEEKRRRKMM---KK-MAAEA-KDQR-SDGS-EN-VEE-DA
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLD-S-SNQWLIRPVLETHGWDHDVGYEGI
NAEKLFVVKDT-----IPISFSGQVTKDKKDANVQIEMTSSIK-HG---ETKASSI----
GFDMQTV-GKDLAYTLRGETTFINF--RK-NKAIAGLSLALLGDA-------LSAGFKVE
DKLIAN---------KRFRLVVTGGAMTGRGDVAY---------GGSLEAQLRDKDYPLG
RSLSTLGLSVM-DWHGDLAIGCNVQSQVPVGRSTNLIARVNLN-NRGAGQVSFRLNS--S
EQLQIAIVGLLPLLRKLLG-CYQ-----------------------------------YW
QDGQ--------------------------------------------------------
--
>Eucalyptus_grandis_gnl|BL_ORD_ID|25605 _G01765.2|PACid:23587326
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGAVS-HAQAQH----IEESA
NGESEDHDETREQLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQI-RGR--NGGR
VGAF--SFDRASAMAEQAE-ASGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFS
TDAFDT----GTKKVQDVVGTVQGIKVRIIDTPGLLPS-LTDQRQNEKILHSIKRFIKKT
PPD---------IVLYLDRLDMQTRDLGDMPLLRTITEIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----PPG
KPF----------------ASR-SRAPPLP---------------FLLSTLLQPRPQPKL
PEEQY-G-DDDGM-DDDL-DES--SDSD----DE-SEYDELPPFKRLTKAQVSKLTRAQK
KAYFDELEYREKLFMKKQLKEERRRRRMM---KK-MAAAA-KDQP-SEYV-EN-AEE-ES
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLD-N-STQWLVRPVLDTHGWDHDVGYEGI
NLERLFVVKDK-----IPISFSGQVSKDKKDANVQMEVASSLK-HG---EGKSTSL----
GFDMQTV-GKDLAYTVRSETRFSNF--RK-NKATAGLSFTLLNDA-------LTAGLKVE
DKLIVN---------KWLRLVMTGGAITARGDVAY---------GGSLDATLRDKDYPLG
RSLFTLGLSVM-DWHGDLAVGGNIQSQLPIGRFTNLIARANLN-NRGAGQVSLRVNS--S
EQLQIALLGLIPLFKRLLE-FPQ-----------------------------------QW
QLGQ--------------------------------------------------------
--
>Glycine_max_gnl|BL_ORD_ID|30484 _11g11250.1|PACid:16283464
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANGAVS-NTQSQQ----MEDSS
SGEAEEYDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFN
TSAFHM----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-WADQRSNEKILHSVKHFIKKT
PPD---------IVLYLDRLDMQSRDFSDMPLLRTITEIFGPSIWFNAIVVLTHAASAPP
EGPNGTASSYDWFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----PPG
KPY----------------VAR-TRAPPLP---------------FLLSTLLQSRPQLKL
PEEQF-G-DEDSL-DDDL-GES--SESD----DE-NEHDDLPPFKPLTKAQVEELSKAHK
KAYFDELEYREKLLMKKQLKEEKKQRKML---KK-RAESA-KDLP-SDHS-EN-VEE-ES
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLDSS-SNQWLVRPVLETHGWDHDVGYEGL
NVERLFVVKEK-----IPLSFSGQVTKDKKDANVQMEISSSVK-HG---KGKATSL----
GFDLQTV-GKDLAYTLRSETRFTNF--RR-NNATAGLSFTLLGDA-------LSSGLKIE
DKLVAS---------KRFKLVVSGGAMTGRGDIAY---------GGSLEAQLRDKDYPLG
RFLTTLGLSVM-DWHGDLAVGCNVQSQIPVGRHTNLVARANLN-NRGAGQISIRLNS--S
EQLQIALIGLIPLLKKLVG-YHQ-----------------------------------QT
QFGQ--------------------------------------------------------
Y-
>Phaseolus_vulgaris_gnl|BL_ORD_ID|24605 _091015439m|PACid:23555468
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANGTVS-NTQSQQ----MEDSS
SGEAEEYDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFN
TSAFNM----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-WSDQRSNEKILLSVKNFIKKT
PPD---------IVLYLDRLDMQSRDFSDMPLLRTITEIFGPSIWFNAIVVLTHAASAPP
EGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRI-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----PPG
KPY----------------IAR--RAPPLP---------------FLLSTLLQSRPQLKL
PQEQF-G-DEDSL-DDDL-DEA--SESD----DE-NEHDDLPPFKPLTKAQVEKLSKAHK
KAYFDELEYREKLLMKKQLKEEKKRRKFM---KK-MAEAA-KDLP-SDYS-EN-VEE-EG
GGAASVPVPMPDLALPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDVGYEGL
NVERLFVVKDR-----VPLSFTGQVTKDKKDANVQMEIAGSVK-HG---EGKATSL----
GFDMQTV-GKDLAYTLRSETRFTNF--RR-NKATAGLSFTLLGDA-------LSGGVKIE
DKLVAS---------KRFRVVISGGAMAGRNDIAY---------GGSLEAQLRDKDYPLG
RFLSTLGLSVM-DWHGDLAVGCNVQSQIPVGRHTNLVARANLN-NRGAGQISIRLNS--S
EQLQIALVALIPLFK--LN-YGQVLVVNERTILYFICHQGRRQVSSTYAMGFVKHVDVRF
QYSK-----RTSHRPNEGDIVADDEISCGRSKPKSLGDDIPSNRLILKFQTLKLVLEFTS
YF
>Medicago_truncatula_gnl|BL_ORD_ID|14583 _Medtr2g130100.1|PACid:17446234
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNYTVS-NTQSQR----MEDNS
SGEPEENDETREKLQMIRVKFLRLANRFGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-SAGQ--EPLDFSCTIMVLGKSGVGKSSTINSIFDE-VKFN
TDAFHM----GTKKVQDVVGMVQGIKVRVIDTPGLLPS-WSDQPHNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQSRDFSDMPLLRTITDIFGPPIWFNAIVVLTHAASAPP
DGPNGTPSSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NTAGQ
RVL---PNGQ-VWKPQLL------LLSFASKILA------EANALLKLQD-N-----PRE
KPY----------------TAR-ARAPPLP---------------FLLSSLLQSRPQLKL
PEDQF-S-DEDSL-NDDL-DEP--SDSG----DE-TDPDDLPPFKPLTKAQIRNLSRAQK
KAYLDEVEYREKLFMKKQLKYEKKQRKMM---KE-MAESV-KDLP-SDYV-EN-VEE-ES
GGAASVPVPMPDMSLPASFD-SDTPTHRYRHLD-S-SNQWLVRPVLETHGWDHDVGYEGL
NVERLFVLKDK-----IPVSFSGQVTKDKKDANVQMEMTSSVK-YG---EGKATSL----
GFDMQTV-GKDLAYTLRSETKFCNF--LR-NKATAGLSFTLLGDA-------LSAGVKVE
DKLIAN---------KRFKLVIAGGAMTGRDDVAY---------GGSLEAQLRDKNYPLG
RSLSTLGLSVM-DWHGDLAVGCNLQSQIPIGRYTNLVARANLN-NRGAGQISIRLNS--S
EQLQIALIGLIPLLKKVIG-YSQ-----------------------------------KL
QFGQ--------------------------------------------------------
DY
>Linum_usitatissimum_gnl|BL_ORD_ID|9835 _10005063|PACid:23149015
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGTMS-NAQSQQ----IDESS
NGEGEEFDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AVGQ--EPLDFSCTIMVIGKSGVGKSATINSIFDE-VKFN
TDAFQS----GTKKVQDVVGTVQGIKVRVIDTPGLLQS-WSEQRHNEKILNSVKRFISKT
PPD---------IVLYLDRLDMQTRDSGDMPLLRTITDIFGPTIWFNAIVVLTHAASAPP
EGPNGTVSSYDMFVTQRSHIVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANALLKLQD-S-----PPG
KPH----------------TPR-SRAPPLP---------------FLLSSLLQSRPQVKL
PEDQY-G-DEDGG-DDDL-DDS--SDSE----DESSEYDELPPFKSLTRNQMSKLTKAQR
KAYHEELEYREKLFMKKQLKEEKRRRKLM---KK-MAAAA-KDMP-AVYR-DN-AEEDET
GGPASVPVPMPDLALPASFD-SDNPTHRYRSLD-N-SNQWFVRPVLDSHGWDHDIGYDGI
NVERLLVIKDK-----FPVSFSGQVTKDKKDANVQMELASSLK-HG---SGKATSM----
GFDMQTV-GKDLAYTIRGETMLANF--KR-SKAAAGVSVTLLGDA-------LSAGAKFE
DKLVVN---------KRFRMVVSGGAMAGRGDVAY---------GGSLEAQLRDKDYPLG
RSLSTLGLSVM-DWHGDLAIGCNVQSQIPIGRTTNLIARANLN-NRGTGQVSLRLNS--S
EQLQIALVGLLPLLQKLFW-IPK-----------------------------------QL
QYGQ--------------------------------------------------------
--
>Populus_trichocarpa_gnl|BL_ORD_ID|20932 _POPTR_0009s13380.1|PACid:18227174
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANGAMS-HMRPQQ----LDDPT
NGESEEHDETHEKLKMIRVKFLRLVHRLGLAPNETVVAQVLYRLGIVEQL-RGR--NRGR
IGTL--SFDPASAMAGQLE-ADGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-AKLP
TNAFQS----GTKMVQDVVGTVQGIKLRVIDTPGLLPS-GSDQRQNEKILLSVKNFIKKT
PPD---------IVLYFDRLDMQSKDFGDLPLLRTVTKIFGPSIWQNAIVVLSHAASAPP
DSPQGTVSSYEMFVTQRSHVVQQTIRQAAGDMW-----LVNPVSLVENHSACRR-NRAGH
RVL---PNGQ-VWKPQLL------LLSFASKILA------EANAILKVQD-G-----PPR
KQF----------------ATR-SRAPPLP---------------YLLSSLLRSRPQVKL
PEEQF-G-DEDGL-DDDL-DES--LDSE----DE-SEYDDLPPFKSLTKAQVAKLTKAQK
NAYFDELEYREKLFMKKQLKEEKRQQRMM---KK-TAVAT-NPLP-GDYS-EN-AEE-ES
EGPASVPVPMPDLSLPASFD-SDNPSHRYRYLD-N-SNQWLVRPVLDTHGWDHDVGYEGI
NVERLFVVKDK-----IPVSFSGQVTKDKKDANVQMELASSIK-HG---EGKSTSL----
GFDMQTL-GKDLGYTLHSETRFINF--RK-NKATAGLSVTLLGDA-------LSAGVKVE
DKLIAN---------KRFQMVMSGGAMTGRGDVAY---------GGSLEAQLRDEDYPLG
RSLSTLGLSVV-DWHGVLAIGCNIQSQVPIGRSTNLIARANLN-NKGAGQLSIRINS--S
EHLQIALAGLIPLLRKLFD-YHE-----------------------------------EM
QLGQ--------------------------------------------------------
--
>Mimulus_guttatus_gnl|BL_ORD_ID|5628 _mgv1a000269m|PACid:17675023
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGAVS-AAQNQL----IEDPT
NGESEEYDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-HGR--SGGR
VAGF--SFDRASAMAEQLE-AAGQ--DPLDFTCTIMVLGKSGVGKSATINSIFDE-VMFG
TDAFQL----GTKKVQDIVGTVQGIRVRVIDTPGLFPS-WSDQRQNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQSRDMGDMPLLRTITDIFGQSIWFNAIVVLTHAASAPP
EGPNGTTTSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPHLL------LLSFASKILA------EANTLLKLAD-S-----PPG
RPF----------------APR-TRSPPLP---------------SLLPSLLQSRPEVKL
PSEQF-GDDDDAV-DDDL-DEC--SDSE----GE-SEYDALPPFRSLTKAQLENLSKQQK
KAYYDELEYREKLFMKKQLKEERKRRKMM---KK-MQEAA-IGLP-ADYG-DN-GEE-EA
SAAASVPVPMPDLALPASFD-SDNPTHRYRSLD-S-SNPWLVRAVLEPNGWDHDIGYDGI
NVERLFVLDSN-----VPVSFSGHISKDKKDASLQMEMATSVK-HG---KGKATTL----
GFDMQPF-GKDYAYTLRSDTRFISN--RV-NKAAAGLSTTVLGDI-------LTGGVKLE
DKLTIG---------KRGQLLVSGGAIYGRGEVAY---------GGSLEATLRDKEHPLG
RFLSTLGISVM-DWHGDLAVGCNSQTQIPIGRHTNLIGRFNLN-NRGSGQLSLKVNS--S
EQLQIVLIGLIPLVQKVLG-YSQ-----------------------------------QV
QYG---------------------------------------------------------
--
>Vitis_vinifera_gnl|BL_ORD_ID|15727 _GSVIVT01024062001|PACid:17832352
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RVNGTTS-QVQAQL----IEDAG
NGEAEENDETREKLQMIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQL-RGR--NGGR
VGAF--SFDRASAMAEQLE-AAGQ--EPLDFSCTIMVLGKTGVGKSATINSIFDE-VKFS
TDAFQV----GTKKVQDVVGTVQGIKVRVIDTPGLLPS-WSDQRQNEKILHSVKRFIKKT
PPD---------IVLYLDRLDMQSRDFGDMPLLRTITEIFGPSIWFNAIVVLTHAASAPP
DGPNGTASSYDMFVTQRSHVVQQAIRQAAGDMR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PN---------------------------------ANTLLKLQD-S-----PPG
KPF----------------TTR-SRSPPLP---------------FLLSSLLQSRPQVRL
PEEQ--------------------------------------------------------
----------------------KERRKMM---KK-MAASS-KDLP-SDYS-EN-AEE-ES
GGAASVPVPMPDWALPASFD-SDNPTHRYRYLD-S-SNQWLVRPVLETHGWDHDVGYEGI
NVERVFAIKDK-----IPVSFSGQVTKDKKDANLQMEIASSVK-HG---EGKATSV----
GFDMQTV-GKDMAYTLRSETRFCNF--RK-NKATAGLSITALGDA-------ITAGLKLE
DKLIVN---------KRIRLVMTGGAMTGRGDVAY---------GGSLEATLRDKDHPLG
RSLSTLGLSIM-DWHGDLAIGCNIQSQIPIGRFTNMIGRVNLN-NRGAGQVSIRLNS--S
EQLQIALIGLVPLLRKLLG-YSQ-----------------------------------QG
QSSCFLIVYAFGMNCKIPGMYQKGLSFFLYLYSWITSAGANETLGSMLLGYVNICNTYES
FS
>Brachypodium_distachyon_gnl|BL_ORD_ID|1693 _2g06810.1|PACid:21804463
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANGPVGVGRDTRQ----DIESA
GDDGDENDEIREKLQMIRVKFLRFANRFGQTPHNMVVSQVLYRLGLAEQI-RSN--TNTG
HGVF--SFDRAQEMAERLE-AAGN--EPLDLSCTILVLGKTGVGKSATINSIFDD-VKLE
TDAFES----STRKVQEVVGMVEGIKVKVIDTPGLSCS-SSDQHYNQKILNSVKRLVSKS
PPD---------IVLYFDRLDMQSRDYGDVPLLQTISKIFGASVWFNAIVVLTHAASAPP
DGPNGIPLSYEMFVTQRSHVVQQAIRQAAGDVR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPQLL------LLCFASKVLA------EANVLLKLED-S-----PTG
KP------------------SN-ARIPPLP---------------FFLSSLLQSRAPVKL
PEEQF-G-DDDDL-E-DV-VDD--CGSD----DG-SDYDDLPPFKRLAKSQLSKLNHAQR
KAYLEELDYREKLFYKKQLREERLRRKMM---KK-MAAEA-RART-DDFSNSN-VDG-DD
STPTNVAVPMPDMVLPSTFD-SDYPSHRYRFLD-T-PSEWLVRPVLETQGWDHDVGYEGL
NIERLFAVKGK-----VPLSVSGQLTKDKKDSSLQMEVASSVK-HS---EGKTTSL----
GLDLQSV-GKDMAYTIRGESRFKNF--RR-NNTAAGISATLLGDS-------VSAGVKIE
DRLIVN---------KQLRLLVSGGAMSGKGDAAY---------GGRLEATLRDKDYPIG
RMLSTLAISVV-DWHGDLAVGCNVQSQIPAGRSSSLIANANLS-NKGTGQVGIRLNS--S
EHLQIALIAFVPIYQNIRK-LLE-----------------------------------KY
---------------------------------------------------------S-E
SA
>Oryza_sativa_gnl|BL_ORD_ID|2601 _LOC_Os10g40110.1|PACid:21885073
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANGPVAVDRETRQ----DVESP
-EDGDENDEIREKLQMIRVKFLRLANRFGQTPNNMVVSQVLYRLGLAEQL-RR----NTG
QGVF--SFDRAQDMAERLE-AAGN--EPLDFSCTILVLGKTGVGKSATINSIFDD-VRLE
TNAFDT----STRKVQEVVGAVEGIKVKVIDTPGLSCS-SSDQHHNQKILNSVKRLISRN
PPD---------IVLYFDRLDMQTRDYGDVPLLQTITRVFGASIWFNAIVVLTHAASAPP
DGLNGIPLSYEMFVTQRSHVVQQAIRQAAGDVR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGH-VWKPQLL------LLCFASKVLA------EANALLKLQD-N-----PAG
KP-------------------R-MRIPPLP---------------FLLSSLLQSRAPLKL
PEEQF-G-DDDDI-EDDL-ADD--SDSD----DG-SDYDDLPPFKRLTKAQLAKLNHAQR
KAYLEELDYREKLFYKKQLKEERMRRKIM---KK-MAAEA-SART-DDFSNSN-LED-DG
SAPTNVAVPMPDMVLPSSFD-SDHPSHRYRFLD-T-PSEWLVRPVLETQGWDHDVGYEGL
NVERLFAVKGK-----VPLSVSGQLSKDKKDCSLQMEVASSLK-HG---EGKTTSL----
GLDLQSV-GKDMAYTLRGESRFKNF--RR-NNTAAGISATLLGDS-------VSAGVKVE
DKLVVN---------KQLRVLVSGGAMSGRGDVAY---------GGRLEATLKDKDYPIG
RMLSTIALSVV-DWHGDLAVGCNIQSQIPAGRASNLIGHANLS-NKGTGQVGIRLNS--S
EHLEIALIALVPIYQNIKK-LLQ-----------------------------------S-
------------------------------------------------------------
--
>Panucum_virgatum_gnl|BL_ORD_ID|54837 _Pavirv00064825m|PACid:23811108
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANGSVSSDIGSQP----STESA
EDDGDENDEVHEKLQMIRVKFLRLAHRFGQTPHNMVVSQVLYRLGLAEQL-RR----TTA
NGSL--SFDRAREMAERLE-AAGN--EPLDFSCTILVLGKTGVGKSATINSIFDD-TSLD
TNAFDS----STRKVQEVVGTVEGITVRVIDTPGLSCS-SLEQHHNQKVLNSVKRLISKN
PPD---------IVLYFDRLDMQNRDNGDIPLLQTITKVFGASVWFNAIVVLTHAASAPP
DGLNGIPLSYEMFVTQRSHVVQQAIRQAAGDIR-----LMNPVSLVENHAACRT-NRAGQ
RVL---PNGQ-VWKPQLL------LLCFASKVLA------EANALLKLQD-S-----PIG
KL------------------SR-TRIPPLP---------------FLVSSLLQSRAPLKL
PEEQF-G-DDDDL-EDDS-TDD--SDSD----DG-SDYDDLPPFKRLTKAQLSKLNNAQR
KAYLEELDYREKLFYRKQLKEERMLRKLM---KK-MAAEA-STRA-NDFYNSN-PED-DS
NTPTNVAVPMPDMVLPSSFD-SDYPSHRYRFLD-T-PSEWLVRPVLETQGWDHDVGYEGL
NVERLFVVKGK-----VPLSISGQLTKDKKDCSMQMEVASSVK-HA---EGKTTSL----
GLDLQSA-GKDMAYTIRGESRFKNF--RR-NSTAAGISATLLGDS-------VSTGVKIE
DKLIVN---------KQLRVLISGGAMSGRGEVAY---------GGRLEATLRDKDYPIG
RMLSTLALSVV-DWHGDLAIGCNVQSQIPAGRASNLVGHANIS-NKGTGQVGIRLNS--T
EHIELALVALVPIFQNIRK-LLQ-----------------------------------NY
---------------------------------------------------------S-E
ST
>Setaria_italica_gnl|BL_ORD_ID|6262 _Si034092m|PACid:19679642
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RFNGSAS------L----ATESA
EDDGDGNDEIHEKLQMIRVKFLRLAHRFGQTPHNMVVSQVLYRLGLAEQL-RR----TTA
NGSF--SFDRAREMAERLE-AAGN--EPLDFSCTILVLGKTGVGKSATINSIFDD-TRLD
TNAFDF----STRKVQEVVGTVEGIRVKVIDTPGLSCS-SLEQHHNQKVLNSVKRLISKN
PPD---------IVLYFDRLDMQSRDNGDVPLLQTITKVFGASVWFNAIVVLTHAASAPP
DGLNGIPLSYEMFVTQRSHVVQQAIRQAAGDIR-----LMNPVSLVENHAACRT-NRAGQ
RVL---PNGQ-VWKPQLL------LLCFASKVLA------EANVLLKLQD-S----NPVG
KL------------------SR-TRIPPLP---------------FLLSSLLQSRAPLKL
PEEQF-G-DDDDL-EDDS-ADD--CDSD----DD-SDYDDLPPFKRLTKAQLSKLNKAQQ
KAYLEELDYREKLFYRKQLKEERMRRKLM---KK-MAAEA-STRA-NDFNNSN-SED-DP
NTPTNVAVPMPDMVLPSSFD-SDNPSHRYRFLD-T-PSEWLVRPVLETQGWDHDVGYEGL
NVERLFAVKGK-----VPLSISGQLTKDKKDCSMQMEVASSVK-HA---EGKTTSL----
GLDLQSV-GKDMAYTIRGESRFKNF--RR-NNTAAGISATLLGDS-------VSAGVKIE
DKLIVN---------KQLRVLVGGGAMSGRGDVAY---------GGRLEATLRDKDYPIG
RMLSTLALSVV-DWHGDLAIGCNIQSQIPAGRASNLVGHANLS-NKGTGQVGIRLNS--S
EHLELALVALVPIFQNIRK-LLQ-----------------------------------NY
---------------------------------------------------------S-E
ST
>Sorghum_bicolor_gnl|BL_ORD_ID|2946 _Sb01g029790.1|PACid:1952668
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RANRPSAVDRGTQE----ATESA
EDDRDENDEIHEKLQMIRVKFLRLADRFGQTSHNMVVSQVLYRLGLAEQL-RR----TTA
NGTF--SIDRAREMAERLE-AAGN--EPLDFSCTILVLGKTGVGKSATINSIFDD-TRLD
TNAFDS----STRKVQEVVGMVEGIKVKVIDTPGLSCS-SLEQHHNQKVLNSVKRIISKN
PPD---------IVLYFDRLDMQSRDNGDVPLLQTITKVFGASVWFNAIVVLTHAASAPP
DGQNGIPLSYEMFVTQRSHVVQQAIRQAAGDVR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPQLL------LLCFASKVLA------EANVLLKLQD-S-----PMS
KL------------------SR-TRIPPLP---------------FLLSSLLQSRAPLKL
PEEQFGG-DDDDL-EDDS-ADD--SDSD----DG-SDYDDLPPFKRLTKAQLAKLNKEQR
KAYLEELDYREKLFYRKQLKEESKRRKLM---KK-MAAEA-SARA-NDFGNSN-LED-DS
NTPTNVSVPMPDMVLPSSFD-SGYPSHRYRFLD-T-PSEWLVRPVLETQGWDHDVGYEGL
NVERLFAVKGK-----VPLSVSGQLTKDKKDCSLQMEAASSIK-HA---EGKTTSL----
GLDLQSV-GKDMAYTIRGESRFKNF--RR-NNTAAGISATLLGDS-------VSAGVKIE
DKLIVN---------KQLRVLISGGAMSGRGDVAY---------GGRLEATMRDKDYPIG
RMLSTIALSVV-DWHGDLAIGCNIQSQIPAGRASNLVGHANLS-NKGTGQFGIRLNS--S
EHLEIALVALVPIFQNIMK-LLQ-----------------------------------NY
---------------------------------------------------------YSE
SG
>Zea_mays_gnl|BL_ORD_ID|19098 _GRMZM5G861756_T01|PACid:20838824
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RASRPAAVDKGTQE----ATESA
EDDRDENDDIHEKLQMIRVKFLRLAGRLGQTSHNMVVSQVLYRLGLAEQL-RR-----TA
NGTF--SIDRAREMAERLE-AAGN--EPLDFSCTILVLGKTGVGKSATINSIFDD-IRLD
TNAFDS----STMKVQ-VVGTVEGIKVKVIDTPGLSCS-SFEQHHNQKVLNSVKRLISRN
PPD---------IVLYFDRLDMQSRDNGDVPLLQTITKVFGASVWFNAIVVLTHAASAPP
DGQNGIPLSYEMFVTQRSHVVQQAIRQAAGDGR-----LMNPVSLVENHSACRT-NRAGQ
RVL---PNGQ-VWKPQLL------LLCFASKVLA------EANVLLKLQD-S-----PIG
KL------------------SH-TRIPPLP---------------FLLSSLLQSRAPLKL
PEEQFGG-DDDDL-EDDL-ADD--SDSD----DG-SDCDDLPPFKRLTKAQLAKLNNEQR
KAYLEELDYREKLFYRKQLKEESKHRKLM---KK-MAAEA-SARG-TDFSNSN-LED-DS
NTPTNVSVPMPDMVLPSSFD-SDYPTHRYRFLD-T-PSEWLIRPVLETQGWDHDVGYEGL
NVERLFAVKGK-----VPLSVSGQLTKDKKDCSLQMEVASSIK-HA---EGKTTSF----
GLDLQSV-GKDMAYTIRGESRFKNF--RR-NNTAAGISATLLGDS-------VSAGLKIE
DKLIVN---------KQLRVLVSSGAMSGRGDVAY---------GGRLEA-IRDKNYPIG
RLLSTIALSVV-DWHGDLAIGCNIQSQIPAGRASNLVGHANLS-NKGTGQVGIRLNS--S
EHLEIALVALVPIFQNIMK-LLQ-----------------------------------NY
---------------------------------------------------------L-E
SG
>Marchathia_polymorpha_gnl|BL_ORD_ID|5297 T20061:6708 (A)
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------KRRREA---KRRMADSP-RGDQ-PQLADEG-ADD-DL
GRSAAVPVPMPDMALPPSFD-SDNPSHRYRYLE-T-ANQWVVRPVLETHGWDHDSGYDGF
SVEKMFVVSEK-----IPASVSGQITKDKKEANLTMECAASVK-HG---EGKVTLA----
GLDLQTI-GKDLAYTLRSETRFSNF--KG-NKTTGGLALTLLGDT-------IAAGMKIE
DRLIVG---------KRLKLVLNGGAITGRGDVAY---------GGSLEATLRDKDYPLS
RTLSTL------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--
>Physcomitrella_patens_gnl|BL_ORD_ID|13071 _Pp1s123_61V6.1|PACid:18049606
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RPNGAPS-TQLTAT----TEENA
NSDTAEGNETREKLQNIRVKFLRLAHRLGQSPQNVVVAQVLYRLGLAESLRGGN--TSNR
AGAF--SFDRANALAEEQE-AANQ-EEELDFACTILVLGKTGVGKSATINSIFDD-RKSV
TSAFKP----STNKVQEIVGTVHGIKVRVIDTPGLLPS-VADQQHNERIMGQVKKHIKKA
SPD---------IVLYFDRLDMQSRDFGDLPLLKTITDLFGAAVWFNAIVVLTHASSAPP
DGPNGVPLSYEMFVAQRSHVVQQTIRQAAGDMR-----LMNPVSLVENHPACRT-NRNGQ
RVL---PNGQ-IWKPQLL------LLCFASKILA------EANSLLKLQETA-----TPG
RPF----------------GQR-SRVPPLP---------------FLLSSLLQSRAQLKL
PDEQL-D-ESDES-DDDE-EE---EDS-----EA-DDYDELPPFRPLSKEELEELTKEQR
QDYMDELADRERLFQKKQYREEMRRRKEM---KK-RQAQM-SKEE-LAQP-DE-ADD-EA
GQPAAVPVPMPDMALPPSFD-SDNPTHRYRYLE-T-ANQWLVRPVLETHGWDHDAGYDGF
NVEKMFVVKNK-----IPASISGQVTKDKKESQVNFEAAASLK-HG---EGKVTLT----
GFDVQTI-GKDLAYTLRAETRFNNF--KR-NKTTAGVTATYLNDT-------IAAGVKLE
DRILIG---------KRVKMVVNGGVLTGKGDKAF---------GGSLEATLRGKEYPLS
RTLSTLGLSVM-DWHGDLAIGGNLQSQFMVGK-TMMVGRANLN-NRGSGQVSIRASS--S
EQLQMVLIGIVPILRSLIN-----------------------------------------
--------------------------------------------------CRFGFGGGQS
SQ
>Physcomitrella_patens_gnl|BL_ORD_ID|251 _Pp1s136_62V6.1|PACid:18036785
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RPNGALS-TQITST----TDESA
SSDAAEGDETREKLQNIRVKFLRLAHRLGQSPQNVVVAQVLYRLGLAESLRGGS--APNR
SGAF--SFDRANALAEEQE-AANQ-EEELDFACTILVLGKTGVGKSSTINSIFDE-RKSV
TSAFKP----STNKVQEVIGTVHGIKVRVIDTPGLLPS-VADQQHNERIMGQVKKYIKKA
SPD---------IVLYFDRLDMQSRDFGDLPLLRTITDLFGAAVWFNAIVVLTHASSAPP
DGPNGVPLSYEMFVAQRSHVVQQTIRQAAGDMR-----LMNPVSLVENHPACRT-NRTGQ
RVL---PNGQ-IWKPQLL------LLCFASKILA------EANSLLKLQETT-----APG
RPF----------------GQR-SRVPPLP---------------FLLSSLLQSRAQLKL
PDEQA-G-ESDES-DDDE-EE---EDS-----DA-DDYDELPPFRPLSKEELEDLTKEQR
EDYMEELADRERMFQKKQYREEIRRRKEA---KK-RQAQM-SKEE-LAEA-EE-AED-EA
GNAAAVPVPMPDMALPPSFD-SDNPTHRYRYLE-T-ANQWLVRPVLETHGWDHDAGYDGF
NVEKMFVVKEK-----IPASVSGQVTKDKKEAQVNFEAAASLR-HG---EGKVTLT----
GFDVQTI-GKDLAYTVRAETRFNNF--KR-NKTTAGVTATYLNDT-------IAAGVKLE
DRVLIG---------KRVKLVVNGGVLTGKGDKAY---------GGSLEATLRGKEYPLS
RTLSTLGLSVM-DWHGDLAIGGNLQSQFMVGK-TMMVGRANLN-NRGSGQVSIRASS--S
EQLQMVLIGIVPILRSLIN-----------------------------------------
--------------------------------------------------CRFGFGG-QS
QQ
>Physcomitrella_patens_gnl|BL_ORD_ID|13091 _Pp1s123_63V6.1|PACid:18049626
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------SSNAASS-TQVAGT----TDVNP
SIEVNEVNETREKLQNIRVKFLRLVHRLGQSPQNVVVAQVLYRLGLAESLRGGS--TRNH
TRAF--DFDRANAIAEEQE-ADNQ-EEELDFACTILVLGKTGVGKSATINSIFDE-HKSV
TNAYNP----STTNVYEVVGTMLGVKVRFVDTPGLLFS-VADQRHNERIMGRVKKYIKKA
SPD---------IVLYFDRMDMQTREFGDVPLLRTITNVFGTAVWFNTIVVLTHASTAPP
DGPNGTPMGYELFVAQRSHSVQQSIRQVAGDMR-----LQNPVSLVENHPACRA-NRNGQ
RVL---PNGQ-IWKPHLM------LLCFASKILA------EANTLLKLQDTA-----APG
RPF----------------GQR-SRVPPLP---------------FLLSSLLQSRAQLKL
PDEQL-D-ESDES-DDDE-ED---EE------EG-DEYDDLPPFRSLSKEELEELSKDQR
QEYAEELAVRERLFQKKQHREQLQRRKEM---KK-RATAM-RKEG-LSHPADE-ADD-EA
GQPAAVPVPMPDMALPPSFD-SDNPTHRYRYLE-T-ANQWLVRPVLETHGWDHDAGYDGF
NVEKMFVVKNK-----IPASISGQVTKDKKESQVNFEAAASLK-HG---EGKVTLT----
GFDVQTI-GKDLAYTLRAETRFNNF--KR-NKTTAGVTATYLNDT-------IAAGVKLE
DRILIG---------KRVKMVVNGGVLTGKGDKAF---------GGSLEATLRGKEYPLS
RTLSTLGLSVM-DWHGDLAIGGNLQSQFMVGK-TMMVGRANLN-NRGSGQVSIRASS--S
EQLQMVLIGIVPILRSLIN-----------------------------------------
--------------------------------------------------CRFGFGGGQS
SQ
>Physcomitrella_patens_gnl|BL_ORD_ID|232 _Pp1s136_59V6.1|PACid:18036766
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------RPNTASS-TQSAAT----SDASI
SSESSEANEIREKLQNIRIKFLRLARRLNQSPQNVVVAQVLYRLGLAESLRGGS--SLNR
TRAF--SFDHANALAEEQE-AAKY--EDLDFACTILVLGKTGVGKSATINSIFDE-CKTV
TSAYYP----STTKVHEVSGTVLGVKVRFIDTPGLLPS-TADQRHNKNIMRQVKKYIKKV
SPD---------IVLYFDRMDMQTRDSGDVPLLRTITDVFGAAVWFNATVVLTHASKAPP
DGSNGTPMSYDYFVAQRSHFVQQTIRQAAGDAR-----LQNPVSLVENHPACRI-NRSGQ
RVL---PNGQ-PWKQQLL------LLCFASKILA------EANTLLKLQEAS-----TPG
KPF----------------GQR-SRVPPLP---------------YLLSSLLQSRAQLKM
PDEQH-G-ESEDS-DDDS-DE---EDEE----EG-DEYDDLPPFRPLSKQELEDLSKEQR
QEYAEELADRERLFQKKQYREQIRRRRER---KK-QASVM-SKEE-PSIPGDG-AED-ES
GQPATVAVPMPDMALPPSFD-SDNPTHRYRYLE-T-ANQWLVRPVLETHGWDHDAGYDGF
NVEKMFVVKEK-----IPASVSGQVTKDKKEAQVNFEAAASLR-HG---EGKVTLT----
GFDVQTI-GKDLAYTVRAETRFNNF--KR-NKTTAGVTATYLNDT-------IAAGVKLE
DRVLIG---------KRVKLVVNGGVLTGKGDKAY---------GGSLEATLRGKEYPLS
RTLSTLGLSVM-DWHGDLAIGGNLQSQFMVGK-TMMVGRANLN-NRGSGQVSIRASS--S
EQLQMVLIGIVPILRSLIN-----------------------------------------
--------------------------------------------------CRFGFGG-QP
QQ
>Selaginella_moellendorffii_gnl|BL_ORD_ID|6113 _170624|PACid:15407391
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------NPSGGSE-TTTAVE----AADTN
GEPNDENVETREKLQMIRVKFLRLAQRLGQSANNAVVAQVLYRLGLAEQLRGGR--SSSR
NSAF--RFERASAIAEEQE-AAGQ--EELDFTCTIMVLGKSGVGKSATINSLFDE-AKTE
TNAFAY----STKKVQEITGTVHGIKLRVIDTPGLLPA-VADQRHNEKIMASVKRFIKKS
PPD---------IVLYFDRLDMQSRDYGDLPLLRTITDTFGAAIWFNAIVVLTHASSAPP
DGPNGLPLSYEMFVAQRSHVVQQTIRQAAGDMR-----LMNPVSLVENHSACRT-NRSGE
RVL---PNGQ-VWKPQLL------LLCFASKILA------EANSLLKLQE-S-----TPG
KPF-----------------MR-SKVPPLP---------------FLLSSLLQSRPPLKH
SDENA-V-GEDDT-DDDI-EDV--EDS-----DE-EDYDELPPFRRLTRDELDQLDKSSR
DEYFEELQMREKLFQKKQWKEEIRRRREM---KK-RAASSDSAEE-YPAPVDD-GYD-DD
NKSAPVPVPLPDMQLPPTFD-SDNPVHRYRYLE-T-ASQWLVRPVMDLHGWDRDSGYDGF
NMERMFTY-GK-----IPASLSGQVTKDKKEANVTLECAASMK-HG---EGKVSQA----
GFDVQTV-GKDFSYTLRSETRFSNF--KK-NKTIAGLAMTMIGDT-------LAYGMKIE
DRLMIG---------RRVKVVMNGGALTGKGDTAY---------GGTVEISLRDKDFPLG
RSLSTCGLSVM-NWHGDMALGGNLQSQFMVGK-TMVVARGNLN-NRGAGQITIRLSS--S
EQLQIALIGVMPLIKALFN-----------------------------------------
--------------------------------------------------SKFGTGQ---
QA
>Amborella_trichopoda_gnl|BL_ORD_ID|8792 evm_15.model.AmTr_v1.0_scaffold00045.239 EVM_15_evm_15.TU.AmTr_v1.0_scaffold00045.239 AmTr_v1.0_scaffold00045:4019320-4023603(-)
MEAQGLPPLSKPKGTLTATSGSSYPIRAPPSLDSDIDENIIEDSNDNSNNSTNALMMGNK
IGNSNVNNGGSSDSGDDIEEDSFLSGEDDFDTASERPFVADPDDETLELEMEDEEFETPF
LGDSGEEKVRAGVVPSGSKNPGVLMPVAQVSGEDEDEGLGEGESEEDDGYSSSVRVPKVA
EVDREKGVSDSLVSDEVTGKRQLGSSPLASETIDEPKTGVPEVENSTVLGPSSQKEVEPG
KTEVSAIGSDEQSQFEDNEKSETSESVGLAPKATVQEVDRTGGSTTSNESNV--------
------------------------------------------------------------
KSDVGDNSVVEVSGLEATEQKTGDGEAEKAVGSSTVSGGVAELEKSPVVESSQPEVSQLE
TGVEEGRSNGVLTGGSDRKLEVEVDSKTGTVDSGEADDKTDVAEVNNEPCENPVTEAKPQ
VITLVSESNEMKAKNEEPSVESSVEAESKNCDAIVRGNASKTGVTLNPDAQEETIDTEPN
HEKGTICPILEAINSENSNASVAEVIHKTKAVDLSLTAREGGFGDTEAEGEKSVSESKLK
SSRSNEHSYSDVDEVEASEASEPLVQNMEEEIKMILLKDYINSEYQNPTLPPNTLAAETA
QQIVNEMEKNSSMYLQKMDDRVVSESDEEVETDEEEQDGKEELFDSAALAALLKAASSGG
TSDNTITISPSDAPRLFSSDPPAGLGSSMPSLRPTPRQNRPNIFTQAEVAA----LGDQD
TTMDEEEKKLHEKIQNIRVKFLRLVHRLGHSSEDVVAAQVLYRLGLAEGIKRGW--HGRR
--GV--GLEAAKQEAKQLE-TDGG--SPLDFSCTILVLGKTGVGKSATINSIFGE-TKAR
TNAFEP----STPTVREINGVLNGVKVKIIDSPGLMPS-VMDQSANKKVLLSIKKFTKRC
PPD---------IVLYVDRLDTQSRDYNDLPLLRSITSTLGASIWFNAIVALTHAACAPP
DGANGAPLSYEVFVAQRSHVVQHSIRQAAGDMR-----LMNPVSLVENHPSCRK-NREGH
KVL---PNGQ-AWRPQLL------VLCYSSKILS------EANALLKLQD-S-----SPG
KLF----------------GLR-IRSPPLP---------------FLLSSLLQSRPHPKL
ATDQ-GG-DNGDS-DIDL-DDI--SDSDQEG-DE-DEYDQLPPFKPLKKAQLAKLSKDQR
KAYFEEFDYRVRLLQRRQWKEELQQIKKA---KK-RASAG--ESIVSEFPNED-----YD
VGPAAVPVPLPDMVLPPSFD-GDNAGYRYRFLE-P-SSHLLSRPVLDTHGWDHDCGYDGV
SLEETLAILNK-----FPAALSVQITKDKREFNIHLDSSVSAK-HG---EHGSSMA----
GFDIQTV-GKQLAYIFRGETRFKNF--YK-NRTGAGFSVTILGDT-------IATGLKIE
DRLPIG---------KRLNLVGSAGGVQAGSDLAC---------GANLEVRLREGDYPIG
QDQATLGLSLM-RWRGDLALGANLQSQFSIGRNTKMAARVGLN-NKMTGQITIRTSS--S
EQVQIALFGIIPLAALLFR-----------------------------------------
----------------------------SLWGGR------------E-SQFG--------
-R
>Sorghum_bicolor_gnl|BL_ORD_ID|25025 _Sb09g004020.1|PACid:1979795
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------ARSNLFSPSELAV----TADPT
EEMTEEEKKLHDKVELIRVKFLRLVYRLGATPEETVAAQVLYRLSLAEGIRHGR--QTNR
--AF--SLDNARRKALLLE-AEGK--EELNFSCNILVLGKTGVGKSATINSIFGE-EKSK
TDAFSS----ATTNVREIIGDVDGVKIRIIDTPGLRPN-VMDQGSNRKILAAVKKYTKKC
PPD---------IVLYVDRLDSLSRDLNDLPLLKTITAVLGSSIWFNAIVALTHAASAPP
EGLNGAPMTYEVLMAQRSHIIQQSIRQAAGDMR-----LMNPVALVENHPSCRK-NREGQ
KVL---PNGQ-SWRHQML------LLCYSSKILS------EANSLLKLQD-P-----NPG
KLF----------------GFR-FRSPPLP---------------FLLSSLLQSRAHPKL
SAEQ-GG-NEGDS-DIEL-DDY--SDVEQDD-DE-EEYDQLPPFKPLTKAQLARLTKEQK
NAYFDEYDYRVKLLQKKQWKDEIRRLKEM---KK-RGKTD--L-DDYGYASIGGEND-QD
PPPENVSVPLPDMVLPPSFD-CDNPTYRYRFLE-P-TSTVLARPVLDAHGWDHDCGYDGV
SVEETLAILSR-----FPANVAVQVTKDKKEFSIHLDSSIAAK-HG---ENASSLA----
GFDIQTV-GRQLAYILRGETKIKNI--KK-NKTTGGFSVTFLGDI-------VATGLKVE
DQLSLG---------KRLSLVASTGAMRAQGDTAY---------GANLEARLKDKDYPIG
QSLSTLGLSLM-KWRRDLALGANLQSQFSIGRGSKMAVRLGLN-NKLSGQITVRTST--S
EQVQIALLGLIPVAASIYR-----------------------------------------
----------------------------SFRPSEPSF-----------------------
AY
>Zea_mays_gnl|BL_ORD_ID|56215 _GRMZM2G351125_T01|PACid:20876031
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------ARSNLFSPSELAV----TADPT
EEMTEEEKKLHDKVELIRVKFLRLVYRLGATPEETVAAQVLYRLSLAEGIRHGR--QTNR
--AF--SLDNARRKALLLE-AEGK--EDLNFSCNILVLGKTGVGKSATINSVFGE-EKSK
TDAFSS----ATTNVREIIGDVDGVKIRIIDTPGLRPN-VMDQGSNRKILAAVKKYTKKC
PPD---------IVLYVDRLDSLSRDLNDLPLLKTITSVLGSSIWFNAIVALTHAASAPP
EGLNGAPMTYEVLMAQRSHIIQQSIRQAAGDMR-----LMNPVALVENHPSCRK-NREGQ
KVL---PNGQ-SWRHQML------LLCYSSKILS------EANSLLKLQD-P-----NPG
KLF----------------GFR-FRSPPLP---------------FLLSSLLQSRAHPKL
SAEQ-GG-NEGDS-DIEL-DDY--SDVEQDD-EE-EEYDQLPPFKPLTKAQLARLTKEQK
NAYFDEYDYRVKLLQKKQWKDEIRRLKEM---KK-RGKTD--L-DDYGYANITGEDD-QD
PPPENVSVPLPDMVLPPSFD-CDNPTYRYRFLE-P-TSTVLARPVLDAHGWDHDCGYDGV
SVEETLAILSR-----FPANVAVQVTKDKKEFSIHLDSSIAAK-HG---ENTSSLA----
GFDIQTV-GRQLAYILRGETKIKNI--KK-NKTTGGFSVTFLGDI-------VATGLKIE
DQLSLG---------KRLSLVASTGAMRAQGDTAY---------GANLEARLKDKDYPIA
QSLSTLGLSLM-KWRRDLALGANLQSQFSIGRGSKMAVRLGLN-NKLSGQITVRTST--S
EQVQIALLGLVPVAASIYR-----------------------------------------
----------------------------SFRPSEPSF-----------------------
AY
>Panucum_virgatum_gnl|BL_ORD_ID|12740 _Pavirv00012228m|PACid:23768588
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------ARSNPFSPSELAV----TTDPT
EEMTEEEKKLHEKVELIRVKFLRLVYRLGATPEETVAAQVLYRLSLAEGIRHGR--QTNR
--AF--SLDNARRKALILE-AEGK--EDLDFSCNILVLGKIGVGKSATINSIFGE-EKTR
TDAFSS----ATSNVREIVGDVDGVKIRIIDTPGLRLN-VMDQGSNRKVLSAVKKFTKKC
PPD---------IVLYVDRLDSLSRDLNDLPLLKTMTAVLGSSIWFNAIVALTHAASAPP
EGLNGAPMTYEVLMAQRSHIIQQSIRQAAGDMR-----LMNPVALVENHPSCRR-NREGQ
KVL---PNGQ-SWRHQML------LLCYSSKILS------EANSLLKLQD-P-----NPG
KLF----------------GFR-FRSPPLP---------------FLLSSLLQSRAHPKL
SAEQ-GG-NEDDS-DIEL-DDY--SDVEQDD-DE-EEYDQLPPFKPLTKAQLVRLTKEQK
NAYFDEYDYRVKLLQKKQWKDEIRRLKEM---KK-RGKTD--LDDDYGYANITGEND-QD
PPPENVSVPLPDMVLPPSFD-CDNPTYRYRFLE-P-TSTVLARPVLDAHGWDHDCGYDGV
SVEETLAILNR-----FPANVAVQVTKDKKEFSIHLDSSIAAK-HG---DNASSLA----
GFDIQTV-GRQLAYILRGETKIKNI--KK-NKTTGGFSVTFLGDI-------VATGLKVE
DQLSLG---------KRLSLVASTGMMKAQGDTAY---------GANLEARLKDKDYPIG
QSLSTLGLSLM-KWRRDLALGANLQSQFPIGRGSKMAVRLGLN-NKLSGQITIRTST--S
EQVQIALLGLVPVAASIYR-----------------------------------------
----------------------------SFWPSEPSF-----------------------
AY
>Setaria_italica_gnl|BL_ORD_ID|4590 _Si004865m|PACid:19677955
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------ARPNPFSPSELAV----TADPT
EEMTEEEKKLHDKVELIRVKFLRLVYRLGATPEETVAAQVLYRLSLAEGIRHGR--QTNR
--AF--SLDNARRKALLLE-AEGK--EDLDFSCNILVLGKVGVGKSATINSIFGE-EKTR
TDAFSS----ATTNVREIVGVVDGVKIRIIDTPGLRSN-VMDQGSNRKVLSAVKKFTKKC
PPD---------IVLYVDRLDSLSRDLNDLPLLKTITAVLGSSIWFNAIVALTHAASAPP
EGLNGAPMTYEVLMAQRSHIIQQSIRQAAGDMR-----LMNPVALVENHPSCRR-NREGQ
KVL---PNGQ-SWRHQML------LLCYSSKILS------EANSLLKLQD-P-----NPG
KLF----------------GFR-FRSPPLP---------------FLLSSLLQSRAHPKL
SAEQ-GG-NEGDS-DIEL-DDY--SDVEQDD-EE-EEYDQLPPFKPLTKAQLLRLTKEQK
NAYFDEYDYRVKLLQKKQWKDEIRRLKEM---KK-RGKTD--LDDDYGYANIAGEND-QD
PPPENVSVPLPDMVLPPSFD-CDNPTYRYRFLE-P-TSTVLARPVLDAHGWDHDCGYDGV
SVEETLAILNR-----FPANVAVQVTKDKKEFSIHLDSSIAAK-HG---DNASSLA----
GFDIQTV-GRQLAYILRGETKIKNI--KK-NKTTGGFSVTFLGDI-------VATGLKVE
DQLSLG---------KRLSLVASTGMMKAQGDTAY---------GANLEARLKDKDYPIG
QSLSTLGLSLM-KWRRDLALGANLQSQFSIGRGSKMAVRLGLN-NKLSGQITVRTST--S
EQVQIALMGLVPVLASIYR-----------------------------------------
----------------------------SFRPSEPSF-----------------------
AY
>Oryza_sativa_gnl|BL_ORD_ID|57949 _LOC_Os05g05950.1|PACid:21940421
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------ARSNLFSPSELAV----TAEPT
EEMTEEEKKLHDKVELIRVKFLRLVYRLGATPEETVAAQVLYRLSLAEGIRHGR--QTNR
--AF--SLDNARKKAMLLE-AEGK--EELNFSCNILVLGKIGVGKSATINSIFGE-EKSK
TDAFSS----ATNSVREIVGNVDGVQIRIIDTPGLRPN-VMDQGSNRKILASVKKYTKRC
PPD---------IVLYVDRLDSLSRDLNDLPLLKTITSVLGSSIWFNAIVALTHAASAPP
EGLNGAPMTYEVLMAQRSHIIQQSIRQAAGDMR-----LMNPVALVENHPSCRR-NREGQ
KVL---PNGQ-SWRHQML------LLCYSSKILS------EANSLLKLQD-P-----NPG
KLF----------------GFR-FRSPPLP---------------FLLSSLLQSRAHPKL
SPDQ-GG-NEGDS-DIDL-DDY--SDIEQDE-DE-EEYDQLPPFKPLTKSQLARLTKEQK
NAYFDEYDYRVKLLQKKQWKDEIRRLKEM---KK-RGKTD--M-DAYGYANIAGEND-LD
PPPENVSVPLPDMVLPPSFD-CDNPTYRYRFLE-P-TSTVLARPVLDAHGWDHDCGYDGV
SVEETLALLNK-----FPANMAVQVTKDKKEFSIHLDSSISAK-LG---EDASSLA----
GFDIQTV-GRQLAYILRGETKFKNI--KK-NKTTGGFSVTFLGDI-------VATGLKVE
DQLSLG---------KRLALVASTGAMRAQGDTAY---------GANLEARLKDKDYPIG
QSLSTLGLSLM-KWRRDLALGANLQSQFSIGRGSKMVVRLGLN-NKLSGQITVRTST--S
EQVQIALLGLIPVAASIYR-----------------------------------------
----------------------------SFRPSEPSF-----------------------
AY
>Brachypodium_distachyon_gnl|BL_ORD_ID|6487 _2g35587.1|PACid:21809257
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------ARSNLFNPSELAM----TAEPN
EEMTEEEKKLHEKVELIRVKFLRLVYKLGATPDETVAAQVLYRLSLAEGIRQGR--QTNR
--AF--SLDNARRKALQLE-AEGK--EDLSFSCNILVLGKIGVGKSATINSIFGE-ERSK
TDAFGA----ATTSVREISGNVDGVQIRIIDTPGLRPN-VMDQGTNRKILASVKKYTKKC
PPD---------IVLYVDRLDSLSRDLNDLPLLKTITAVLGSSIWFNAIVALTHAASAPP
EGLNGAPMTYEVLMAQRSHIVQQSIRQAAGDMR-----LMNPVALVENHPSCRK-NREGQ
KVL---PNGQ-SWRHQML------LLCYSSKILS------EANSLLKLQD-P-----SPG
KLF----------------GFR-FRSPPLP---------------FLLSSLLQSRAHPKL
SPDQ-GG-NEGDS-DIEL-DEY--SDIEQDE-DE-EEYDQLPPFKPLTKAQLARLTKDQK
NAYFDEYDYRVKLLQKKQWKDELRRLKEM---KR-RGKSD--L-DSYGYASIAG-DD-QD
PPPENVSVPLPDMVLPPSFD-CDNPTYRYRFLE-P-TSTVLARPVLDAHGWDHDCGYDGV
SVEESLALLSK-----FPAAVAVQVTKDKKEFSIHLDSSVSAK-LG---EDASSLA----
GFDIQTV-GRQLAYILRGETKFKSI--KK-NKTTGGFSVTFLGDI-------VATGLKVE
DQLSVG---------KRLALVASTGAMRAQGDTAY---------GANLEARLKDKDYPIG
QSLSTLGLSLM-KWRRDLALGANLQSQFSIGRGSKMAVRLGLN-NKLSGQITVRTST--S
EQVQIALLGLVPVIASIYR-----------------------------------------
----------------------------SFRPGEPTF-----------------------
AY
>atToc159_AT4G02510.1|PACid:19644015
MDSKSVTPEPTNPFYASSGQSGKTYASVVAAAAAAAADKEDGGAVSSAKELDSSSEAVSG
NSDKVGADDLSDSEKEKPNLVGDGKVSDEVDGSLKEDSTTPEATPKPEVVSGETIGVDDV
SSLSPKPEAVSDGVGVVEENKKVKEDVEDIKDDGESKIENGSVDVDVKQASTDGESESKV
KDVEEEDVGTKKDDEGESELGGKVDVDDKSDNVIEEEGVELTDKGDVIVNSSPVESVHVD
VAKPGVVVVGDAEGSEELKINADAETLEVANKFDQIGDDDSGEFEPVSDKAIEEVEEKFT
SESDSIADSSKLESVDTSAVEPEVVAAESGSEPKDVEKANGLEKGMTYAEVIKAASAVAD
NGTKEEESVLGGIVDDAEEGVKLNNKGDFVVDSSAIEAVNVDVAKPGVVVVGDVEVSEVL
ETDGNIPDVHNKFDPIGQGEGGEVELESDKATEEGGGKLVSEGDSMVDSSVVDSVDADIN
VAEPGVVVVGAAKEAVIKEDDKDDEVDKTISNIEEPDDLTAAYDGNFELAVKEISEAAKV
EPDEPKVGVEVEELPVSESLKVGSVDAEEDSIPAAESQFEVRKVVEGDSAEEDENKLPVE
DIVSSREFSFGGKEVDQEPSGEGVTRVDGSESEEETEEMIFGSSEAAKQFLAELEKASSG
IEAHSDEANISNNMSDRIDGQIVTDSDEDVDTEDEGEEKMFDTAALAALLKAATGGGSSE
GGNFTITSQDGTKLFSMDRPAGLSSSLRPLKPAAAPRANRSNIFSNSNVTM----ADETE
INLSEEEKQKLEKLQSLRVKFLRLLQRLGHSAEDSIAAQVLYRLALLA----GR--QAGQ
--LF--SLDAAKKKAVESE-AEGN--EELIFSLNILVLGKAGVGKSATINSILGN-QIAS
IDAFGL----STTSVREISGTVNGVKITFIDTPGLKSA-AMDQSTNAKMLSSVKKVMKKC
PPD---------IVLYVDRLDTQTRDLNNLPLLRTITASLGTSIWKNAIVTLTHAASAPP
DGPSGTPLSYDVFVAQCSHIVQQSIGQAVGDLRLMNPSLMNPVSLVENHPLCRK-NREGV
KVL---PNGQ-TWRSQLL------LLCYSLKVLS------ETNSLLRPQE-P----LDHR
KVF----------------GFR-VRSPPLP---------------YLLSWLLQSRAHPKL
PGDQ-GG-DSVDS-DIEI-DDV--SDSEQEDGED-DEYDQLPPFKPLRKTQLAKLSNEQR
KAYFEEYDYRVKLLQKKQWREELKRMKEM---KK-NGKKL-GESE-FGYPGEE-DDP-EN
GAPAAVPVPLPDMVLPPSFD-SDNSAYRYRYLE-P-TSQLLTRPVLDTHGWDHDCGYDGV
NAEHSLALASR-----FPATATVQVTKDKKEFNIHLDSSVSAK-HG---ENGSTMA----
GFDIQNV-GKQLAYVVRGETKFKNL--RK-NKTTVGGSVTFLGEN-------IATGVKLE
DQIALG---------KRLVLVGSTGTMRSQGDSAY---------GANLEVRLREADFPIG
QDQSSFGLSLV-KWRGDLALGANLQSQVSVGRNSKIALRAGLN-NKMSGQITVRTSS--S
DQLQIALTAILPIAMSIYK-----------------------------------------
----------------------------SIRPEA------------TNDKYS--------
MY
>Toc159_AT4G02510.1|PACid:19644015
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRSNIFSNSNVTM----ADETE
INLSEEEKQKLEKLQSLRVKFLRLLQRLGHSAEDSIAAQVLYRLALLA----GR--QAGQ
--LF--SLDAAKKKAVESE-AEGN--EELIFSLNILVLGKAGVGKSATINSILGN-QIAS
IDAFGL----STTSVREISGTVNGVKITFIDTPGLKSA-AMDQSTNAKMLSSVKKVMKKC
PPD---------IVLYVDRLDTQTRDLNNLPLLRTITASLGTSIWKNAIVTLTHAASAPP
DGPSGTPLSYDVFVAQCSHIVQQSIGQAVGDLRLMNPSLMNPVSLVENHPLCRK-NREGV
KVL---PNGQ-TWRSQLL------LLCYSLKVLS------ETNSLLRPQE-P----LDHR
KVF----------------GFR-VRSPPLP---------------YLLSWLLQSRAHPKL
PGDQ-GG-DSVDS-DIEI-DDV--SDSEQEDGED-DEYDQLPPFKPLRKTQLAKLSNEQR
KAYFEEYDYRVKLLQKKQWREELKRMKEM---KK-NGKKL-GESE-FGYPGEE-DDP-EN
GAPAAVPVPLPDMVLPPSFD-SDNSAYRYRYLE-P-TSQLLTRPVLDTHGWDHDCGYDGV
NAEHSLALASR-----FPATATVQVTKDKKEFNIHLDSSVSAK-HG---ENGSTMA----
GFDIQNV-GKQLAYVVRGETKFKNL--RK-NKTTVGGSVTFLGEN-------IATGVKLE
DQIALG---------KRLVLVGSTGTMRSQGDSAY---------GANLEVRLREADFPIG
QDQSSFGLSLV-KWRGDLALGANLQSQVSVGRNSKIALRAGLN-NKMSGQITVRTSS--S
DQLQIALTAILPIAMSIYK-----------------------------------------
----------------------------SIRPEA------------TNDKYS--------
MY
>Arabidopsis_lyrata_gnl|BL_ORD_ID|433 _911963|PACid:16034180
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRSNIFSNPNVTM----ADETE
VNLSEEEKEKLEKLQSLRVKFLRLLQKLGHSAEDSIAAQVLYRLALLA----GR--QTGQ
--FF--SLDAAKKKAVESE-AEGN--EDLNFSLNILVLGKAGVGKSATINSILGN-QKAS
IDAFGL----STTSVREISETVGGVKITFIDTPGLKSA-AMDQSANAKMLSSVKKVMKKC
PPD---------IVLYVDRLDTQTRDLNNMPLLRTITASLGTSIWKNAIVTLTHAASAPP
DGPSGTPLSYDVFVAQCSHIVQQSIGQAVGDLRLMNPSLMNPVSLVENHPLCRK-NREGV
KVL---PNGQ-TWRPQLL------LLCYSLKVLS------EANSLLKPQE-P----LDHR
KVF----------------GFR-VRSPPLP---------------YLLSWLLQSRAHPKL
PGDQ-GG-DSVDS-DIEI-DDV--SDSEQEDGED-DEYDQLPPFKPLRKTQLAKLSKEQR
KAYFEEYDYRVKLLQKKQWREELKRMKEM---KK-NGKKV-GESE-FGYPGEE-DDP-EN
GAPAAVPVPLPDMVLPPSFD-SDNSAYRYRFLE-P-TSQLLTRPVLDTHGWDHDCGYDGV
NAELSLAVASR-----FPATATVQVTKDKKEFNIHLDSSVSAK-HG---ENGSTMA----
GFDIQNV-GKQLAYVVRGETKFKNL--RK-NKTTVGGSVTFLGEN-------IATGVKLE
DQIALG---------KRFVLVGSTGTMRSQGDSAY---------GANLEVRLREADFPIG
QDQSSFGLSLV-KWRGDLALGANLQSQLSVGRNSKIALRAGLN-NKMSGQITVRTSS--S
DQLQIALTAILPIAMSIYK-----------------------------------------
----------------------------SIRPDA------------TNDKYS--------
MY
>Capsella_rubella_gnl|BL_ORD_ID|24114 _v10000033m|PACid:20909923
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRSNIFSNPNVIM----TDETE
VNLSEEEKQKLEKLQSLRVKFLRLLQRLGHSAEDSIAAQVLYRLALLA----GR--QTGQ
--LF--SLDAAKKKAMESE-AEGN--EDLNFSLNILVLGKAGVGKSATINSILGN-QKAS
IDAFGL----STTSVREISETVGGVKITFIDTPGLKSA-AMDQSTNAKMLSSVKKVMKKC
PPD---------LVLYVDRLDTQTRDLNNLPLLRTITASLGSSIWKNAIVTLTHAASAPP
DGPSGTPLSYDVFVAQCSHIVQQSIGQAVGDLRLMNPSLMNPVSLVENHPLCRK-NREGV
KVL---PNGQ-TWRPQLL------LLCYSLKVLS------EANSLLKPQE-P----LDHR
KVF----------------GFR-VRSPPLP---------------YLLSWLLQSRAHPKL
PGDQ-GG-DSVDS-DIEI-DDV--SDTEQEEGED-DEYDQLPPFKPLRKTQLAKLSKEQR
KAYFEEYDYRVKLLQKKQWREELKRMKEM---KK-NGTKV-GESE-FDYPGEE-EDP-EN
GAPAAVPVPLPDMVLPPSFD-SDNSAFRYRFLE-P-TSQLLTRPVLDTHGWDHDCGYDGV
NAEHSLAVANR-----FPATATVQVTKDKKEFNIHLDSSVSAK-HG---ENGSTMA----
GFDIQNV-GKQLAYVVRGETKFKNL--RK-NKTTVGGSVTFLGEN-------IATGVKLE
DQIALG---------KRFVLVGSTGTMRSQGDSAY---------GANLEVRLREADFPIG
QDQSSLGLSLV-KWRGDLALGANLQSQVSVGRQSKIALRAGLN-NKMSGQITVRTSS--S
DQLQIALTAILPIAMSIYK-----------------------------------------
----------------------------SIRPEA------------TNDKYS--------
MY
>Thellungiella_halophila_gnl|BL_ORD_ID|18151 _Thhalv10028361m|PACid:20197753
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRSNIFSNPNVTM----ADEGE
VNLSEEEKQKLEKLQSLRVKFLRLLQRLGHSAEDSIAAQVLYRLALLA----GR--QTGQ
--LF--SLDAAKRKAVESE-AEGN--EDLNFSLNILVLGKAGVGKSATINSILGN-QKAS
IDAFGL----STTSVREISETVGGVKITFIDTPGLKSA-AMDQSTNAKMLSSVKKVMKKC
PPD---------IVLYVDRLDTQTRDLNNLPLLRTITASLGTSIWKNAIVTLTHAASAPP
DGPSGSPLSYDVFVSQCSHIVQQSIGQAVGDLRLMNPSLMNPVSLVENHPLCRK-NREGV
KVL---PNGQ-TWRPQLL------LLCYSLKVLS------EANSLLKPQE-P----LDHR
KIF----------------GFR-TRAPPLP---------------YLLSWLLQSRAHPKL
PADQ-GG-DSVDS-DIEI-DDV--SDSEQEDGED-DEYDQLPPFKPLRKTQLAKLSKEQR
KAYFEEYDYRVKLLQKKQWREELKRMKEM---KK-HGKKV-GESE-FGFLGEE-EDP-EN
GAPAAVPVPLPDMVLPPSFD-SDNSAYRYRFLE-P-TSQLLTRPVLDTHGWDHDCGYDGV
NAEHSLAIASR-----FPATATVQVTKDKKEFNIHLDSSVSAK-HG---DSGSTMA----
GFDIQAV-GKQLAYVVRGETKFKNL--RK-NKTTLGGSVTFLGEN-------VATGVKLE
DQVALG---------ERFVLVGSTGTMRSQGDSAY---------GANLEVRLREADFPIG
QDQHSLGLSLV-KWRGDLALGANLQSQVSVGRHSKIALRAGLN-NKMSGQITVRTSS--S
DQLQIALTAILPIVMSIYK-----------------------------------------
----------------------------SLRPEG------------ANDKYN--------
MY
>Brassica_rapa_gnl|BL_ORD_ID|33005 _036261|PACid:22716515
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------IRPNIFSNPNVTV-----DESE
INLSEEEKQKLEKLQSLRVKFLRLLQRLGQSAEDSIAAQVLYRIALLA----GR--QTGQ
--LF--SLDAAKKKAVEYE-AEGN--EELNFSLNILVLGKAGVGKSATINSILGN-QKAS
TDAFGL----STNSVREISETVGGIKITFIDTPGLKPA-AMDQSANSKMLASVKKVMKRC
PPD---------IVLYVDRLDTQNRDLNNLPLLKTVTASLGASIWKNAIVTLTHAASAPP
DGPSGAPLSYDVFVAQCSHIVQQSIGQAVGDLRLMNPSLMNPVSLVENHPLCRK-NREGV
KVL---PNGQ-TWRPQLL------LLCYSLKVLS------EANSLLKPQE-P----LDQR
KLF----------------GFR-VRSPPLP---------------YLLSSLLQSRAHPKL
PTDQ-GG-DSVDS-DIEI-DDV--SDSEQEDGDE-DEYDQLPPFKPLRKTQLAKLSKEQR
KAYLEEYDYRVKLLQKKQWREELKRMREM---KK-NGKKV-GENE-FGYPGEE-EDP-EN
GAPAAVPVPLPDMVLPPSFD-SDNSAYRYRFLE-P-TSQLLTRPVLDTHGWDHDCGYDGV
NAEYSLAIASR-----FPATATVQTTKDKKEFNIHLDSSVSAK-HG---DSGSTMA----
GFDIQNV-GKQLAYVVRGETKFKNL--KK-NKTTLGGSVTFLGEN-------IATGVKLE
DQIALG---------KRFVLVGSTGTMRSQGDAAY---------GANLEVRLKDADFPIG
QDQHSLGLSLV-KWRGDLALGGNLQSQVSVGRNSKIALRAGLN-NKMSGQITVRTSS--S
DQLQIALTAILPIAMSIYK-----------------------------------------
----------------------------MLRPDG------------ASDKYS--------
MY
>Carica_papaya_gnl|BL_ORD_ID|23760 _evm.model.supercontig_9.215|PACid:16428108
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------VRPSIFAHSNLIP----GGDSE
TNLSEAERKKLEMLQQLRVKFLRLVQRLGHSPEDSIAAQVLYRLALVA----GR--QTSQ
--LF--SLDSAKKEALQLE-AEGK--DDLNFSLNILVLGKTGVGKSATINSIFGE-EKSL
IHAFEP----ATSAVREVTGTVNGVKIRVIDTPGLKSS-ALEQGANRKILSSIKKFTKNF
PPD---------IVLYVDRLDTQTRDLNDLPLLRSIASTLGSPIWRNAIVTLTHAASAPP
DGPSGSPLSYEVFVAQRSHVVQQSIGQAVGDLRLMNPSLMNPVSLVENHPSCRK-NRDGE
KVL---PNGQ-CWRPQLL------LLCYSMKILS------EASSLSKTQD-P----FDHR
KLF----------------GFR-VRSPPLP---------------YLLSWLLQSRTHPKL
SADQ-GG-ENGDS-DIEL-DEM--SDSDQED-VE-DEYDQLPPFKPLRKTQLSKLSKEQR
KAYFEEYDYRGKTWIRKM---ELRLLCQC---H---------------------------
---------YLTWVLPPSFD-GDNPAYRYRFLE-P-TSQFLARPVLDTHGWDHDCGYDGI
NIEHSLSIASR-----FPAAVAVQVTKDKKEFSIHLDSSVAAK-YG---ENGSNMA----
GFDIQNV-GKQLAYIVRGETKFKNF--KK-NKTAAGVSVTFLGEN-------VAAGVKVE
DQIVLG---------KRLVLVGSTGTVRSQGDAAY---------GANLEVRLREADFPIG
QDQSSLGLSLV-KWRGDLALGANLQSQFSIGRNSKIAVRAGLN-NKLSGQITVRTSS--S
DQLQIALLGILPVAMAIYK-----------------------------------------
----------------------------SIRPSV------------S-ENYS--------
MY
>Manihot_esculenta_gnl|BL_ORD_ID|21628 _4.1_000358m|PACid:17981545
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRPSIFSSSSLTN----GGDLN
TSLSEEEKKKLEKLQQIRVKFLRLVHRLGLSPEESVAAQVLYRLALLA----GK--QTNQ
--LF--SLDAAKRTALQLE-AERK--DDLDISLNILVLGKTGVGKSATINSIFGE-EKSP
IHAFEP----ATNSAREITGVAGGVKIRVIDSPGLKSS-GSEQGLNRKVLTSVKKLMKSC
PPD---------VVLYVDRLDTQTRDLNDLPLLRSITSSLGSSIWRNAVVTLTHGASAPP
DGPSGSPLSYEVFVAQRSHVVQQSIGQAVGDLRLMNPSMMNPVSLVENHPSCRK-NRDGQ
KVL---PNGQ-SWRPQLL------LLCFSMKILS------EASSLSKPQD-P----FDHR
KLF----------------GFR-TRAPPLP---------------YLLSWMLQSRSHPKL
SNDQ-GG-DNVDS-DIDL-ADL--SDSDQEE-EG-DEYDQLPPFKPLRKTQLAKLSKEQK
KAYFEEYDYRVKLLQKKQWTEELRRMREI---KK-KGKVV--ADE-YDYNGED-VDP-EN
GAPAAVPVPLPDMVLPPSFD-GDNPAYRYRFLE-Q-TSQFLARPVLDTHGWDHDCGYDGI
NVENNLAVANR-----FPAAVTVQVTKDKKEFSIHLDSSISAK-HG---ENGSSMA----
GFDIQNV-GKQLAYILRGETKLKNF--KA-NKTTAGVSVTFLGQN-------VAGGFKLE
DQIAVG---------KRLMLVGSTGTVRSLGDAAY---------GANLEVRLREADYPIG
QDQSSLGLSLV-KWRGDLALGANLQSQISIGRSSKVAVRAGLN-NKMSGQISVRTSS--S
EQLQLALVGLLPIAMSIYK-----------------------------------------
----------------------------SIRPGV------------S-DNYS--------
MY
>Ricinus_communis_gnl|BL_ORD_ID|20495 _30129.m000375|PACid:16818660
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------GR--QTNQ
--VF--SLDAAKRTALQLE-AEGK--EDLEFSLNILVLGKAGVGKSATINSIFGE-EKSP
IHAFEP----ATNSVKEITGLVDGIKIRVIDCPGLKSS-GSEQGLNRKLLSSVKKFMKKC
PPD---------IVLYVDRLDTQTRDLNDLPLLRSITSSLGSSIWRNAVVTLTHAASAPP
DGPSGSPLSYEVFVAQRSHVVQQSIGQAVGDLRLMNPSLMNPVSLVENHSSCRK-NRDGQ
KVL---PNGQ-TWRPQLL------MLCYSMKILS------EASSLSKPQD-P----FDHR
KLF----------------GFR-SRSPPLP---------------YLLSWLLQSRSHPKL
SSDQ-GV-DNVDS-DVDL-ADL--SDSDDEE-EE-DEYDQLPPFKPLRKNQLAKLSKEQK
KAYFEEYDYRVKLLQKKQWREELRRMREI---RK-KGKAP--VDE-YGYNEED-VDP-EN
GAPAAVPVPLPDMVLPPSFD-GDNPAYRYRFLE-P-TSQFLARPVLDTHGWDHDCGYDGV
NVEHSLAIVNR-----FPATVAVQVTKDKKEFSVHLDSSVSAK-HG---DKGSSMA----
GFDIQNV-GKQLAYIFRGETKFKNF--KM-NKTAAGVSVTFLGQN-------VASGFKLE
DQIALG---------KRLMLVGSTGTVLSQGDSAY---------GANLEVRLREADYPIG
QDQSSLGLSLV-KWRGDLALGANLQSQFSIGRNSKIAVRAGLN-NKMSGQLTVRTSS--S
DQLQIALVGLLPIAMSIYK-----------------------------------------
----------------------------SLRPGV------------S-ESY---------
MY
>Citrus_clementina_gnl|BL_ORD_ID|14207 _0.9_000529m|PACid:19265331
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRTNLFTSSRLAT----GGETE
TNLSEEEKTKLEKLQHLRVKFLRLVHRLGYSPEDSLVGQVLHRLSLIA----GR--QTGQ
--LF--SLDAAKTTALQLE-AEEK--DDLNFTLNILVLGKTGVGKSATINSIFGE-EKTS
IHAFEP----GTTSVKEIVGTVDGVKIRVIDTPGLKSS-GVEQGVNRKVLASIKKFTKKC
APD---------IVLYVDRLDSQTRDLNDLPLLRSITNALGTQIWRSAIVTLTHAASAPP
DGPSGSPLSYEIFVAQRSHVVQQSIGQAVGDLRLMNPSLMNPVSLVENHPACRK-NRDGQ
KVL---PNGQ-TWRPQLL------LLCYSMKILS------EASSLAKPQE-S----FDHR
KLF----------------GFR-VRSPPLP---------------YLLSWLLQSRTHPKL
PTDQ-GG-DNADS-DIEL-ADL--SDSDQEE-EE-DEYDLLPPFKPLRKAQIAKLSKEQK
KAYFEEYDYRVKLLQKKQWREELRRMREM---KK-RGNAA--TED-YGYVGED-VDQ-EN
GSSAAVPVPLPDMVLPQSFD-GDNPAYRYRFLE-P-NSQFLARPVLDGHGWDHDCGYDGV
NVEHSLAIASR-----FPAAVTVQVTKDKKEFNLHLDSSIAAK-LG---ENGSSMA----
GFDIQNV-GKQLAYILRGETKFKNF--KR-NKTAIGASVTFLGEN-------VATGLKLE
DQIALG---------KRLMLVGSTGTIRSQGDSAY---------GANLEMKLREADFPIG
QDQSSLGLSLV-KWRGDLALGANLQSQFSVGRSSKMAIRAGLN-NKLSGQISVRTSS--S
DQLQIALLGILPVAMTIYK-----------------------------------------
----------------------------SIRPGA------------S-ENYS--------
MY
>Citrus_sinensis_gnl|BL_ORD_ID|43636 _1.1g000717m|PACid:18137206
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRTNLFTSSRLAT----GGETE
TNLSEEEKTKLEKLQHLRVKFLRLVHRLGYSPEDSLVGQVLHRLSLIA----GR--QTGQ
--LF--SLDAAKTTALQLE-AEEK--DDLNFTLNILVLGKTGVGKSATINSIFGE-EKTS
IHAFEP----GTTSVKEIVGTVDGVKIRVIDTPGLKSS-GVEQGVNRKVLASIKKFTKKC
APD---------IVLYVDRLDSQTRDLNDLPLLRSITNALGTQIWRSAIVTLTHAASAPP
DGPSGSPLSYEIFVAQRSHVVQQSIGQAVGDLRLMNPSLMNPVSLVENHPACRK-NRDGQ
KVL---PNGQ-TWRPQLL------LLCYSMKILS------EASSLAKPQE-S----FDHR
KLF----------------GFR-VRSPPLP---------------YLLSWLLQSRTHPKL
PTDQ-GG-DNADS-DIEL-ADL--SDSDQEE-EE-DEYDLLPPFKPLRKAQIAKLSKEQK
KAYFEEYDYRVKLLQKKQWREELRRMREM---KK-RGNAA--TED-YGYVGED-VDQ-EN
GSSAAVPVPLPDMVLPQSFD-GDNPAYRYRFLE-P-NSQFLARPVLDGHGWDHDCGYDGV
NVEHSLAIASR-----FPAAVTVQVTKDKKEFNLHLDSSIAAK-LG---ENGSSMA----
GFDIQNV-GKQLAYILRGETKFKNF--KR-NKTAIGASVTFLGEN-------VATGLKLE
DQIALG---------KRLMLVGSTGTIRSQGDSAY---------GANLEMKLREADFPIG
QDQSSLGLSLV-KWRGDLALGANLQSQFSVGRSSKMAIRAGLN-NKLSGQISVRTSS--S
DQLQIALLGILPVAMTIYK-----------------------------------------
----------------------------SIRPGA------------S-ENYS--------
MY
>Eucalyptus_grandis_gnl|BL_ORD_ID|28856 _H01158.1|PACid:23590577
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRSSLFTSN--LT----PAESD
NNLTEEEKKKLEKIQQLRVKFLRLVQRVGYSPEDSLAAQVLYRLALVA----GR--QAGQ
--LF--SLDSAKKTASELE-LEKK--DDLNYSLNILVLGKAGVGKSATINSLLGE-DKAM
IHAFEP----ATTAVKEITGTVHGVKIRVFDTPGLKSS-VMEQNENRRIFSSIKKFTKKC
PPD---------IVLYVDRLDTQTRDLNDLPLLKSITSALGPSIWRSAIVTLTHGASAPP
DGPSGSPLSYDVFVAQRSHVVQQSIGQAVGDLRLMNPSLMNPVSLVENHTSCRK-NRDGE
KVL---PNGQ-TWRPQLL------LLCFSMKILA------EASSLSKPQD-P----FDQR
KLF----------------GFR-VRSPPLP---------------YLLSWLLQSRTHPRL
SSDQ-GL-ENGDS-DVDM-AYS--SDSDEED-EE-DEYDQLPPFKPLRKSQIAKLSKEQR
KAYFEEYDYRVKLLQKKQWREELKRMREI---KK-KGKVS--PDE-YDYMGGD-GDP-ED
GSPAAVPVPLHDMVLPQSFD-SDNPAYRYRFLE-P-TSQFVARPVLDTHGWDHDCGYDGV
NLEHSLAIASQ-----FPGAVALQITKDKKEFNIHLDSSVAAK-HG---DNGSTMA----
GFDIQNI-GKQLAYIVRGDTKFKNF--KK-NKTAAGFSVTFLGEN-------IATGFKVE
DQIALG---------KRVMLVGSAGTVRSNSDAAY---------GANLEVRLREADFPVG
QDQTSMSLSLV-KWRGDLALGANMQSQFSVGRSSKIAVRAGLN-NKLSGQISVRTSS--S
EQLQIALVGILPIVTAIYK-----------------------------------------
----------------------------SLRPGV------------S-ETYS--------
IY
>Aquilegia_coerulea_gnl|BL_ORD_ID|27141 _003_00754.1|PACid:22050234
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SRPNIFTSSELMA----SGETE
NMLTEEEKNKLEKIQLVRVKFLRLIHRLGHTPDDSIAAQVLYRMVLAA----GR--QTGP
--SF--SLETAKKTAMQLE-AEKK--DDLDFSLNILVLGKTGVGKSATINSIFGE-AKAK
IGAFEP----ATTAVKEIIGTVGGVKIRVIDTPGLKSS-VMEQSFNRKVLSSVKKMIKKS
PLD---------ILLYVDRLDTQTRDLNDLPLLKTITSTLGSSIWRSAVVTLTHAASAPP
DGPSGSPLSYEVFVAQRSHIVQQSIGQAVGDLRMMNPSLMNPVSLVENHPSCRK-NREGE
RIL---PNGQ-IWRPQLM------MLCYSLKILS------EVSTLSKPQD-P----FDHR
KLF----------------GFR-VRAPPLP---------------YLLSSLLQSRAHPKL
SDDQ-GG-ENVDS-DIDL-EDL--SDSDQEE-EE-DEYDQLPPFKPLRKSQIAKLSKDQK
KAYFDEYDYRVKLLQKKQWKEELKRMKEM---KT-KGKDQ--TDN-VDYMGE---DA-EQ
EGPAAVPVPLPDMVLPPSFD-GDNPAYRYRFLE-P-TSQLLARPVLDSHGWDHDCGYDGV
SLEENLAIAGK-----FPAGVAVQITKDKKEFNIHLDSSVAAK-HG---ENGSTLA----
GFDIQTI-GKQLGYIIRGETKFKNF--KK-NRTTGGVSVTFLGEN-------VATGLKVE
DQICIG---------KRLTLVGSTGAIRSQGDVAY---------GANLEARLKEKDFPIG
QDQSTLGLSLM-KWRGDLALGANLQSQVSIGRSSKMSIRVGLN-NKLSGQITVRTSS--S
EQLQLALVGILPIAISIYR-----------------------------------------
----------------------------SIWPSA------------G-ESFS--------
PY
>Cucumis_sativus_gnl|BL_ORD_ID|7224 _097220.1|PACid:16958163
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SRPLTFASSNPRV----GDDAE
NKLSEEEKTKLQKLQKIRVNFLRLVQRLGVSPDDSLVAHVLYRFGLVA----GR--STGQ
--LF--SFDNAKNTAIQLE-AEGK--EDLDFSLNILVLGKSGVGKSATINSIFGE-DKTP
INAFGP----GTTTVKEIIGTVEGVKIRVFDSPGLRSS-SSERRINNRILSSIKNVMKKF
PPD---------IVLYVDRLDNQTRDLNDLLLLRSVSSSLGSSIWKNAIITLTHGASAPP
DGPSGSPLGYEVFVAQRSHVLQQTVAQAVGDLRILNPTLMNPVSLVENHPSCRK-NRDGQ
KVL---PNGQ-TWRPQLL------LLCFSIKILA------EVGNLSKAPE-T----FDHR
KIF----------------GLR-GRSPPLP---------------YLLSGLLQSRTHPKL
ASDQ-SG-DNGDS-DIDL-ADM--SDSDQEE-EE-DEYDQLPPFKPLRKSQISKLSKEQR
KAYFEEYDYRVKLLQKKQWKEELKRMRDI---KK-KGQPT--VND-YGYMGED--DQ-EN
SSPAAVQVPLPDMALPPSFD-GDNPAYRFRFLE-P-TSQFLARPVLDTHGWDHDCGYDGV
NLEHSMAIVNR-----FPAAVAVQITKDKKEFNIHLDSSVSAK-HG---ENGSTMA----
GFDIQNI-GRQLAYILRGETKFKNF--RK-NKTAAGVSVTFLGEN-------VCPGLKLE
DQITLG---------KRVVLVGSTGTVRSQNDSAF---------GANLEIRLREADFPIG
QDQSSLGLSLV-KWRGDTALGANFQSHFSVGRSYKMAVRAGIN-NKLSGQITVKTSS--S
DQLQIALIALLPVARAIYN-----------------------------------------
----------------------------ILRPGV------------A-ENYS--------
TY
>Glycine_max_gnl|BL_ORD_ID|12663 _05g29990.1|PACid:16260118
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------TRPSLFTPSISRA----SAISD
SNLSEEEKKKLEKLHEIRVKYLRLVHRLGFTTEESIAAQVLYRMTHVA----GR--QSGQ
--MF--SVESAKETASQLE-AEAR--DNFDFSVNILVLGKAGVGKSATINSIFGE-TKTS
INACGP----ATTAVTEIVGVVDGVKIRIFDTPGLKSS-AFEQNFNTKVLSAVKKLTKKS
PPD---------IVLYVDRLDLQTRDMNDLPMLRSITSVLGSSIWRNVIVTLTHAASAPP
DGPSGAPLSYDVFVAQRSHIVQQTIGQAVGDLRLMNPSLMNPVSLVENHPSCRK-NRDGQ
KVL---PNGQ-SWRPLLL------LLCYSMKILS------EASNVSKTQE-S---PFDQR
RLF----------------GFR-PRSPPLP---------------YLLSWLLQTRTYPKL
PADQGGA-DNGDS-DIEM-ADL--SDSDLDE-DE-DEYDQLPPFKPMKKSQVAKLTKEQQ
KAYFEEYDYRVKLLQKKQWREELRRMREM---KK-KGNTK--END-YGYTEED--DQ-EN
GSPAAVPVPLPDMALPPSFD-SDNPAYRYRFLE-P-TSQLLTRPVLDSHGWDHDCGYDGV
NIEQSLAIINK-----FPAAVTVQVTKDKKDFSMHLDSSVAAK-LG---ENGSAMA----
GFDIQNI-GKQLAYIVRGETKLKNF--KR-NKTSAGVSVTFFGEN-------VSTGLKVE
DQIAVG---------KRVVLVGSTGVVKSQTDSAY---------GANVEVRLREADFPIG
QDQSSLSLSLV-KWRGDLALGANLQSQFSVGRGYKVAVRAGLN-NKLSGQISVRTSS--S
DQLQIALIAILPIAKAIYK-----------------------------------------
----------------------------NFWPGA------------S-ENYS--------
IY
>Phaseolus_vulgaris_gnl|BL_ORD_ID|19945 _091025519m|PACid:23550718
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------TRPNLFSPSINRG----SAVPD
SSMSEEEKKKLSALQDIRVKYLRFVHRLGFTTEESIAAQVLYRMTLVA----GR--QSGQ
--MF--SLESAKETAIRLE-EEGR--DDLDFSVNILVLGKAGVGKSATINSIFGE-TKTC
INSCGP----ATTAVKEIVGVVDGVKIRIFDTPGLKSS-AFEQNFNTKVLSAVKRLTKKC
PPD---------IVLYVDRLDLQTRDMNDLPMLRSITSVLGSSIWRNVIVTLTHGASAPP
DGPSGAPLSYDVFVAQRSHIVQQTIGQAVGDLRLMNPSLMNPVSLVENHPSCRK-NRDGQ
KVL---PNGQ-SWRPLLL------LLCFSMKILS------EAGNASKAQE-S----FDHR
RLF----------------GFR-TRSPPLP---------------YLLSWLLQSRTYPKL
PADQAGA-DNGDS-DTEM-ADL--SDSDLDE-EE-DEYDQLPPFKPMRKSQVAKLTNEQK
KAYIEEYDYRVKLLQKKQWRDELRRMREV---KK-RGNAK--VDD-YGYPEED--DQ-EN
GTPAAVPVPLPDMALPQSFD-SDNPAYRYRFLE-P-TSQLLTRPVLDNHGWDHDCGYDGV
NIEHSLAIINK-----FPAAVTVQITKDKKDFSIHLDSSVAAK-LG---ENGSSMA----
GFDIQNI-GKQLAYIVRGETKFKNF--KR-NKTSGGVSVTFLGEN-------VSTGLKIE
DQIAVG---------KRLVLVGSTGIVKSQTDSAC---------GANLEVRLREADFPIG
QDQSSLSLSLV-KWRGDLALGANLQSQFSLGRSYKMAVRAGLN-NKLSGQISVRTSS--S
DQLQIALVAILPIAKAIYK-----------------------------------------
----------------------------NFWPGA------------S-ENYS--------
IY
>Malus_domestica_gnl|BL_ORD_ID|9170 _0000161765|PACid:22629143
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NNSNLFSSSNVTV----GG-SS
ENLSEEEKAKLEKFQQIRVKFLRLVQRLGVSTEESVPRQVLYRLALVS----GR--QNSQ
--EF--SLEAAKMTALQLE-AEEK--DDLDFSLNILVLGKTGVGKSATINSIFGA-EVTP
INAFGP----GTTAVKEIVGVVDGVKIKVFDTPGLKSA-AMEQGINRKILSSVQRRMKKS
PPD---------IVLYVDRMDSRSRDLSDVPLLRSITNAFGPSIWRSTIVTLTHSSSAPP
DGPSGSPLNYEMFRNQREQIMQQTIGQAVGDLRFMNPSMMSPISLVENHPSCRK--RDNQ
KVL---PNGV-AWRSHLL------LLCYSMKILS------DASNLSKPPE-S----FDHR
KLF----------------GLR-SRSAPLP---------------YLLSWLLQSRPHPKL
ATDQ-GG-ENADS-DIDL-ADL--SDSDQEE-EE-DEYDQLPSFKPLKKAQIAKLSREQR
KAYAEEYDYRFKLLQKKMWKEELRRMKEM---KK-KGKVS--EEE-YGYLGEE--DP-EN
GAPAAVPVALPDMVLPPSFD-GENPAYRYRFLE-P-TSQFTARPVLDAQGWDHDCGYDGV
NLEHTLAIANS-----FPAAVAVQLTKDKKEFNIHLDSSVGAK-HG---EKWSSML----
GFDIQNI-GKQLAYIVRGDTKVKTS--KR-FKNAAGVSVTFLGEN-------VSTGFKLE
QEYAVG---------KRLVLVGTTGTVRSQGDSAY---------GANLEVRLREADFPIG
QDQSSLGLSLV-RWRGDLALGANLQSQFSLGRNYKMAVRAGLN-NKRSGQISXRTSS--S
EQLQLALIAVIPVVKAIYN-----------------------------------------
----------------------------SIWPRA------------S-ENYS--------
IY
>Prunus_persica_gnl|BL_ORD_ID|8703 _ppa000431m|PACid:17649130
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NNSNLFTSSNVTV----GGESE
NNLSDEEKAKLEKFQQIRVQFLRLVQRLGVSTEDSVARQVLYRLALLS----GR--QNSR
--EF--SPDAAKMTALQLE-AEGK--DDLNFSLNILVLGKTGVGKSATINSIFGE-EKTP
IYAFGP----ATTTVKEIVGVVDGVKIRVFDTPGLKSA-AMEQNVNRKILSFVQKFTKKC
PPD---------IVLYVDRLDTQSRDLNDVPLLRSITSAFGPSIWRSTIVTLTHGASAPP
DGPSGSPLNYELFVAQRSQILQQTIGQAVGDLRFMSPSMISPICLVENHPSCRK-NRDGQ
KVL---PNGQ-SWRPQLL------LLSYSMKILS------EATNLSKPQE-S----FDNR
KLF----------------GFR-SRSPPLP---------------YLLNWLLQPRPHPKL
SADQ----ENADS-DIDL-DDL--SDSDQEE-EE-DEYDQLPSFKPLKKAQIAKLSKEQR
KAYTEEYDYRVKLLQKKMWREELRRMKEM---KK-KGKVS--ADD-YGYLGEE--DP-EN
GGPAAVPVPLPDMVLPPSFD-SENPAYRYRLLD-S-TSQLSARAVLDVQGWDHDCGYDGV
NLEQSLAIANS-----FPAAVTVQLTKDKKYFTMHLDSSVAAK-HG---ENGSSMV----
GFDIQNI-GKQFAYIVRGDTKFKNF--KR-NKTGAGVAVTFLGES-------VSTGLKVE
DQIALG---------KRVILVGTAGSVRSQGESVH---------GANLEMRLREADYPIG
QDQSSVGLSLV-KYRGDLALMVNLVSQFSLGRNYKMTVRAGVN-NKLSGQISVRTSS--S
EQLQIALVAVLPIVRAICN-----------------------------------------
----------------------------TIWPGA------------S-ENYS--------
IY
>Linum_usitatissimum_gnl|BL_ORD_ID|8566 _10006048|PACid:23147746
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRSNLFGPPREEP-------SD
ESLSDEQKKKLEDMQQMMIKYLRLVFRLGYSPDESIVSQVLYRMAMIA----GK--KSGQ
--IF--NVDSAKRIALQLE-TERKDDDDVSFSLNILVLGKSGVGKSSTVNAIFGE-EKSV
IDAFEP----ATGSVKEINGVADGIKIRIIDSPGLKSS-GSEQGTNRRILNSIKRYMKRC
PPD---------IVLYVDRLDTQTRDLNDLPLLKSITSHLGSSIWRNAIVTLTHAASAPS
DGPSGAPLSYDVFVAQRSHVLQQSIGQAVGDLRLMNPSLMNPVSLVENHSSCRR-NRDGE
KVL---PNGQ-SWRLQLL------LLCSSMKILS------ESTALSKPAS-SQDAAFDPR
KLFG---------------GGR-ARSPPLP---------------YMLSWLLQSRPHPKL
PADE----SSIDE-DIEL-ADY--SDSDQED-ES-DEYDQLPPFKPLRKSLLAKLSKEQK
KAYLEEYDYRVKLLQKKQLKEELRRMKEM---KK-KGKNA-AVLE-DDYAA----DP-EN
GEPAAVQVPLPDMVLPPSFD-SDNPVYRYRFLE-P-NSQLLVRPVLDTHGWDHDPGYDGV
NVENSLAIAGK-----YPAALTVQVTKDKKDFNLHLDSSVATK-HGGEDNSGSSMA----
GFDIQNV-GKQMAYIVRGETKFKNF--KK-NRTAVGVSVTFLGPN-------VATGFKLE
DQISLG---------KRMVLVGSTGTVRSQGDSAY---------GANLEVRLREADFPIG
QDQSSLGLSLV-KWRGDLALAANLQSQFSVGRSSKIAVRAGLN-NKLSGQISVRTSS--S
DQLQIALVGLLPILASIYK-----------------------------------------
----------------------------SIRPPA------------SEESYS--------
LY
>Mimulus_guttatus_gnl|BL_ORD_ID|4265 _mgv1a000181m|PACid:17673660
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRPSLFGTAAPSAGGGGGGEVE
DRLSDEEKKKLEKLQEIRVKFLRLVHRLGLSPEESVAAQVLYRLALLG----GR--QSTH
--TF--NLDAAKRTALLLE-AGGN--DDLDFSINILVLGKSGVGKSATINSVFGE-EKAP
IDAFET----GTASAREISGLVDGVKVRVIDTPGLKSS-VMEQSFNRGVLSSVKKFTKKS
PPD---------VVLYVDRLDAQSRDLNDLPLLKTITSSLNSSIWRSAIVTLTHAASAPP
DGPSGAPLSYDVFVSQRSHVVQQSIGHAVGDLRMMSPSLMNPVSLVENHPSCRK-NRDGH
KIL---PNGQ-IWRPQLL------LLCYSMKILS------EASSLSKPQD-P----FDHR
KLF----------------GMR-QRAPPLP---------------YMLSSMLQTRTHPKL
QSDQ-GG-DSVDS-DIDLDEDL--SDDDQE--GV-DEYDQLPPFKPLKKAQMAKLTAEQR
KAYFEEYDYRVKLLQKKQWREELKRMREM---KK-NGGKDAAAGD-YAFAED---DA-DA
GAAAPIAVPLPDMALPPSFD-GDNPAYRFRFLE-P-TSQFLARPVLDNHGWDHDCGYDGV
NLEHSLAIASR-----FPAVYTVQVTKDKKDFSISLDSSVSAK-YG---DDISTMA----
GFDIQSM-GKQLAYIFRGEAKIKNL--KK-HRATGGLSFTLLGEN-------VVPGVKIE
DQISLG---------KQYSLSGSAGAVRSQQDTAY---------GANFELQRRELDYPIG
QVQSTLSVSVV-KWRGDLALGLNSLAQFSLGRNSKVAVRAGIN-NKLSGQITVRTSS--S
EHLSLALTAIIPTVLSVYK-----------------------------------------
----------------------------KFFAGG------------G-EKYP--------
IY
>Vitis_vinifera_gnl|BL_ORD_ID|18594 _GSVIVT01027981001|PACid:17835219
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NRSNLFTPSNLAI----GGDSE
NTLSEEDKRKQEKIQLIRVKFLRLVQRL------------------------GR--QTGE
--EF--SLDTAKRRAMQLE-AEGK--DDLNFSLNILVLGKSGVGKSATINSIFGE-QKAL
INAFEP----ATTTVREIIGTIDGVKIRVFDTPGLKSS-FLEQGVNRKILSSIQKFTKKC
PPD---------IVLYVDRLDAQTRDLNDLPLLRTITSSLGPSIWRSAIVTLTHGASAPP
DGPSGAPLSYETYVSQRSHVVQQY------------------------------------
------------------------------------------------------------
-------------------------------------------------YLKQSRTHPKL
SAEQ----------------------------DE-DEYDQLPPFKPLRKSQIAKLSKEQR
KAYFEEYDYR------------------------------------------------DN
GGPAAVPVPLPDMVLPPSFD-CDNPAYRYRFLE-P-TSQFLARPVLDTHGWDHDCGYDGV
NLEQSLAILGQ-----FPAAVSVQVTKDKKEFNIHLDSSAAAK-HG---ENGSSMA----
GFDIQNI-GKQLAYILRGETKFKIL--KK-NKTAAGFSVTFLGEN-------VATGFKVE
DQ----------------------------------------------------------
---------------GDLALGANLQSQFSIGRSSKMAVRVGLN-NKLSGQITVKTSS--S
EQLQIALVGIIPVVMAIYK-----------------------------------------
----------------------------AIWPGV------------N-SILPCLHLFQAL
VI
>Populus_trichocarpa_gnl|BL_ORD_ID|43011 _POPTR_0008s22130.1|PACid:18249494
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------ETV----EDVAK
NDLNEEDKKVIEKIQQIAVKFLRLVQRLGQSPEDSIVAQVLHRLVVAT----RA--HVNQ
--EF--SLENAEKMAMQLE-AEGK--DDLDFSLSILVLGKTGVGKSATINSIFGE-KKVE
INAFEP----ATTMLKEVVGIVDGVKIRIIDTPGLRSS-VKEEAINRKILASIKTSINKF
PPD---------VILYTDRLDTHSLDLNDLPMLRLLTKSLTSSIWKNSVVTLTHATSPPP
DGPSGSPLSFEMFVGQRSHAIQQAISQAVGDLRLIHPRMMHPVSLVENHPLCQK-NENSE
YIL---PNGQ-SWRPQLL------LLCYSLKILS------EASSIAKPRD-P----FDHK
KPF----------------GFR-LRSLPLP---------------HLVSSLLQSRPHPKL
TADQ-GG-DDIDS-DIDM-VDL--SDSDEE--IE-DEYDQLPPFKPLKKSHVAKLTKEQR
KAYLEEYDYRVKLLQKKQWREEVKMLKGM---KK-KGKDG------YDGIGED-VDQ-ED
VGPATVPVAMPDFVLPPSFD-SDNPSYRYRALE-P-TSQFLMRPVLDSHGWDHDCGYDGV
SLERNLAVAGQ-----FPGAFAVQITKDKKDFNIHLDSSVCAK-HG---ENGSTMA----
GFDIQNV-GRQLAYILRSETKFKNF--KM-NKTSAGISFTVLGEN-------VATGLKIE
DQIAVA---------KRLALVGAAGAVRSGGDTAY---------GANFEVCLKSKDFPIE
KDQSTLGLSLM-KWRGDLGLMANLQSQFSIGRNSKMAVRVGMN-NKRSGQVTIKTSS--S
E-MQVALIAIVPIVTSLLR-----------------------------------------
----------------------------SIYSGY------------A-ASNS-----HTL
DY
>Medicago_truncatula_gnl|BL_ORD_ID|14531 _Medtr2g129610.1|PACid:17446182
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------RSTIDVEQNNVV------VVD
NQLNEEEKMKLEKLQQIRIKFLRLVLRLGLTTQESIAAQVLQRLTLIASGRDPR--QTSQ
--IF--NLNAAEESAFNLE-ARG---EILNHSLNVLVLGKSGVGKSATINSIFGK-VKTK
ISAYGS----ATNSIKEIVGMVDGVSIRIFDTPGLKSS-ALEQCYNKKVLSMIQKLTKKK
PLD---------IVLYVDRLDIQTKNLNDLPLLRTICNVFGPLIWRNTVITLTHAATAPP
DGPLGSPLSYDVFVTQRNRAVQQAIGQVIGDEQINNLSLMNPVALVENHPSCRK-NKNGH
KVL---PNGQ-TWRPLLL------LLCYSMKILS------EATSLSKTQE-M----FNYN
KLF----------------GFR-VRTPSLP---------------YLLSWLMQPRNHAKL
ASNQ-GG-NDIGGFEMEF-AEL--SDSDQED-DE-DEYDRLLPFRPLKKSQVAKLSREQR
KAYFEEYDCRVKLLQKKQWKEELRRMREI---KKNKGK-----SE-YGYTEEG--AQ-NM
ESPNAVPTPLHDMIMPLSFD-GDNPVFRYHFLE-S-TSQFLTRPVLDANGWDHDCGYDGV
TIENSLAIANK-----FPASFGVQVAKDKKDFNMQLESSVAAK-HG---ENGSSMA----
GFDIQNI-GKQLAYVVRGETEFKNF--KR-NKTCAGVSATFLGEN-------VSTGLKVE
DQIALG---------KCLLLMGSAGLMRSQGDSAY---------GTNVEVRFKEADFPIG
QDQSSLSLSLV-KWRGELALGANLQSQFSIGRSYKMAVRAGLN-NKRSGQISVRTSS--S
EQLQIALVAVLPIVRAIYA-----------------------------------------
----------------------------NFWSKA------------C-DRDP------NS
IF
>Vitis_vinifera_gnl|BL_ORD_ID|11234 _GSVIVT01017736001|PACid:17827859
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NGLNISASSDLMA----GAESK
DSISEEEKKKLEKIQLLRVRFLRLVQRLGHSPEDSIVSQVLYQLAIDA----GK--HSNE
--AF--SLESAKGMAMKLE-AEGK--GDIEFSLNILVLGKTGVGKSATINSIFCE-EKAM
TNAFEP----TTSAVNEIIGTIDGVKIRVLDTPGLRSS-LMEQAFNRKILSSIKKFMKKF
PPD---------VVLYVDRLDTEDKDLNDLPLLKSITSSLGSSIWRNAIVTLTHGASSPP
DKPSGSPLSYDLFVSQRSHSVQQSIRQTVGDLRLMNPNLINPVSLVENHPLCRK-NGNGQ
K-----------------------------------------------------------
KVI----------------WLS-APFPTLP---------------YLLSSLLQSFTHPKL
STDQ-GG-ENVDS-DIEL-GNM--TDTDEE--ND-DVYDQLPAFKPLRRSDIAKLSKEQR
KAYFEEYDYRVKLLRKKEWRQELKRLREM---KK-KCKDG--GND-NVHVGEDG-DQ-ES
GSPATVPVPLPDMVLPPSFD-ADNPAYRYRSLD-A-MSRHLARPVLITRCWDHDCGYDGV
SLEENLAIAGM-----FPTEISVQVTKGKNEFNIHFDSSVSAK-HG---ENGSTMA----
GFNIQTI-GRQVAYILRGETKIKNF--QT-NKTAAGVSITFSGKN-------VAAGLKIE
DQIAVG---------RRLVFVGSTGAILSQNDAAY---------GANFEIRLKENDFPIG
QDQATLGLSLM-KWRNDFALMGNLQCHFSVGQSSKMAFHVGLN-NKLSGQITVRTSS--L
EQLQIALMGFLPIAITIFR-----------------------------------------
----------------------------SLCPGSVLFHCTDVVIHLS-RSDS--------
KL
>Amborella_trichopoda_gnl|BL_ORD_ID|12687 evm_15.model.AmTr_v1.0_scaffold00072.35 EVM_15_evm_15.TU.AmTr_v1.0_scaffold00072.35 AmTr_v1.0_scaffold00072:1761957-1764089(+)
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MED----CHSSH
HYPDGKSSDILEKLDALQVNFLRLVHRLGQSSQNLVVAQVLYRLELTKQIRASN--SNAK
RVGL--SIDRAKAIAREQE-TAGQGGSELDFSIKVLLLGKTGVGKSATINSIFNQ-AKVF
TDAFQP----ATEKIEEIAGTVMGVKVKVIDTPGLLPS-PSDQRLNRRTLRTVERFIRKS
LPD---------IVLYFDRLDIINMGYSDFPLLKLITETFGSAIWFNTTIVLTHSSSALP
EGPDGTSLVYEAFVAQCKNIMQHHIHQAAADTR-----LRNPLLLVENHPLCVR-NREGE
KVL---PNGQ-AWRSQFL------LLCISSKVLN------DANALLKFQD------VH-G
K------------------QNN-QRRPSLP---------------HLLSSFLQPCSAP--
--------NASDL--MLI-DEVGEEVTDL--ESE-DEYDKLPPIRILSKGQFKRLSKAQK
EDYLDELDYQETLYLKKQLKEELRKCRDG---------LS--------INDTDGHNE-GE
PPPD--TLPLPDMAMPLSFD-SACPTYRYRFLE-Y-SNKWLVRPVLDPHGWDQEIGFNGV
NLEASFPIEKN-----LNTSLNSQLSKDKQDCNFQMECAATHI-KE---KGPSYYT----
GLDVQNL-GRGLACTARGHMQLKTH--KY-NKAGCGFLMGSIGSN-------VFVGAKLE
DTI-AK---------KRWKLVVDTGVMASQGNMTF---------GGRLEASLRGKDYPVR
RDQASVSLTML-SCNKEVLLEGGLSVQFRPARGTNMAIQANVN-HKKSGQICVKGNS--S
EHIQIASIAIIPIVRALFR-----------------------------------------
--------------------------------------RREIQHGHPVTD----------
--
>Amborella_trichopoda_gnl|BL_ORD_ID|7457 evm_15.model.AmTr_v1.0_scaffold00036.127 EVM_15_evm_15.TU.AmTr_v1.0_scaffold00036.127 AmTr_v1.0_scaffold00036:4818376-4824545(-)
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------MKTFKDWISWKSLLSARPLSGSDSFL
EEDETRRHEDVDVAGTPPGSSGTASTTSACPANGIQSSASCPYFPPVVMED----CHSSP
HYPDGKSSDILEKLDALQVNFLRLVHRLGQSSQNLVVAQVLYRLELTKQIRASD--SNAR
SVGL--SIDRVKTIAREQE-TAGQGGSELDFSINVLLLGKTGVGKSATINSIFNQ-AKVF
TDAFQP----ATEEIQEIIGTVMGVKVKVIDTPGLLPS-PSDQRLNRRNMHTVKRFIRNS
PPD---------IVLYFDRLDVINMGYSDVPLLKLITETFGSAIWFNTIIVLTHSSSALP
EGPDGTSLGYEAFVTQCKNIMQHHIHQAAADMR-----LRNPLLLVENHPLCIR-NRERE
KVL---PNGQ-AWRSQFL------LLCISSKVLN------DANALLKFQD-V----VH-G
K------------------QNN-QRRPSLP---------------HLLSFFLQPCSAP--
--------NASDL--MLI-DEVGEEVSYL--ESE-DEYDKLPPIRILSKGQFKRLSKAQK
EDYLDELDYRETLYLKKQLKEELGKCRDG---------SS--------INGKDGHNE-GE
PPPD--TVPLPDMAMPLSFD-SACPTYRYRSLE-Y-GNKWLVRPVLDPHGWDQEIGFDGV
NLEASFPIVKN-----LNTSLNSQLSKDKQDCNFQMECAATHI-DE---KGPSYYT----
GLDVQNL-GRGLACTARGHMQLKTH--KY-NKAGCGFLMGSIGSN-------VYVGAKLE
DTI-AK---------KRWKLVVDTGGMASQGDMTF---------GGRLEGSLRGKDYPVR
RDQASVSLTML-SCNKEVLLEGGLLVRFRPARGTNMAIQANVN-HKKSGQICIKANS--S
EHIQIALIAIIPIVRALFR-----------------------------------------
--------------------------------------RRAIQHDPPVTDR---------
--
>Toc90_gi|75291915|sp|Q6S5G3.1|TOC90_ARATH RecName: Full=Translocase of chloroplast 90, chloroplastic; Short=AtToc90; AltName: Full=90 kDa chloroplast outer envelope protein; AltName: Full=Plastid protein import 4
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MKGFKDWVFALSNSMASSRPLLGSD
PFFRDPHQEQDNHSQAPAAPQPVTLSEPPCSTSSDLEILPPLSQQQVPLES----LYQSS
IDLNGKKHNPLAKIGGLQVQFLRLVQRFGQSQNNILVSKVLYRVHLAMLIRAEE--SELK
NVKL--RQDRAKALAREQE-SSGI--PELDFSLRILVLGKTGVGKSATINSIFGQ-PKSE
TDAFRP----GTDRIEEVMGTVSGVKVTFIDTPGFHPLSSSSTRKNRKILLSIKRYVKKR
PPD---------VVLYLDRLDMIDMRYSDFSLLQLITEIFGAAIWLNTILVMTHSAAT-T
EGRNGQSVNYESYVGQRMDVVQHYIHQAVSDTK-----LENPVLLVENHPSCKK-NLAGE
YVL---PNGV-VWKPQFM------FLCVCTKVLG------DVQSLLRFRD-S----IGLG
Q------------------PSS-TRTASLP---------------HLLSVFLRRRLSS--
--------GADET-EKEI-DKL--LNLDL--EEE-DEYDQLPTIRILGKSRFEKLSKSQK
KEYLDELDYRETLYLKKQLKEECRRRRDE---KL-VEEEN--------L-E----DT-EQ
RDQA--AVPLPDMAGPDSFD-SDFPAHRYRCVS-A-GDQWLVRPVYDPQGWDRDVGFDGI
NIETAAKINRN-----LFASATGQVSRDKQRFTIQSETNAAYTRNF---REQTFSV----
AVDLQSS-GEDLVYSFQGGTKLQTF--KH-NTTDVGVGLTSFGGK-------YYVGGKLE
DTLLVG---------KRVKLTANAGQMRGSGQTAN---------GGSFEACIRGRDYPVR
NEQIGLTMTAL-SFKRELVLNYGLQTQFRPARGTNIDVNINMN-NRKMGKINVKLNS--S
EHWEIALISALTMFKALVR-----------------------------------------
--------------------------------------RSK--TEMTEENE-EEKIVNFL
VS
>Toc90_gi|75291915|sp|Q6S5G3.1|TOC90_ARATH RecName: Full=Translocase of chloroplast 90, chloroplastic; Short=AtToc90; AltName: Full=90 kDa chloroplast outer envelope protein; AltName: Full=Plastid protein import 4
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------LPPLSQQQVPLES----LYQSS
IDLNGKKHNPLAKIGGLQVQFLRLVQRFGQSQNNILVSKVLYRVHLAMLIRAEE--SELK
NVKL--RQDRAKALAREQE-SSGI--PELDFSLRILVLGKTGVGKSATINSIFGQ-PKSE
TDAFRP----GTDRIEEVMGTVSGVKVTFIDTPGFHPLSSSSTRKNRKILLSIKRYVKKR
PPD---------VVLYLDRLDMIDMRYSDFSLLQLITEIFGAAIWLNTILVMTHSAAT-T
EGRNGQSVNYESYVGQRMDVVQHYIHQAVSDTK-----LENPVLLVENHPSCKK-NLAGE
YVL---PNGV-VWKPQFM------FLCVCTKVLG------DVQSLLRFRD-S----IGLG
Q------------------PSS-TRTASLP---------------HLLSVFLRRRLSS--
--------GADET-EKEI-DKL--LNLDL--EEE-DEYDQLPTIRILGKSRFEKLSKSQK
KEYLDELDYRETLYLKKQLKEECRRRRDE---KL-VEEEN--------L-E----DT-EQ
RDQA--AVPLPDMAGPDSFD-SDFPAHRYRCVS-A-GDQWLVRPVYDPQGWDRDVGFDGI
NIETAAKINRN-----LFASATGQVSRDKQRFTIQSETNAAYTRNF---REQTFSV----
AVDLQSS-GEDLVYSFQGGTKLQTF--KH-NTTDVGVGLTSFGGK-------YYVGGKLE
DTLLVG---------KRVKLTANAGQMRGSGQTAN---------GGSFEACIRGRDYPVR
NEQIGLTMTAL-SFKRELVLNYGLQTQFRPARGTNIDVNINMN-NRKMGKINVKLNS--S
EHWEIALISALTMFKALVR-----------------------------------------
--------------------------------------RSK--TEMTEENE-EEKIVNFL
VS
>Arabidopsis_lyrata_gnl|BL_ORD_ID|24265 _910069|PACid:16058012
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------QPPLSQQQVPLES----LYQSS
IDLNGKKHNPLAKIGDLQVQFLRLVQRFGQSQNNILVSKVLYRVHLALLIRAEE--SELK
TVKL--RQDRAKALAREQE-LSGT--PELDFSLRILILGKTGVGKSATINSIFGQ-SKSE
TDAFRP----ATDRIEEVMGTVNGVKVTFIDTPGFHPLSSSSTRKNRKILLSIKRYVKKR
PPD---------VVLYLDRLDMIDMRYSDFSLLQLISEILGAAIWLNTILVMTHSSTT-T
EGRNGQSVNYESYVGQRMDVVQHYIHQAVSDTK-----LENPVLLVENHPSCKK-NLAGE
YVL---PNGL-VWKPQFM------FLCVCTKVLG------DVQSLLRFRD-S----IGLG
Q------------------PSS-TRTASLP---------------HLLSVFLRRRLSA--
--------GADEA-EKEI-DEL--LNLDL--EEE-VEYDQLPTIRILGKSRFEKLSKSQK
KEYLDELDYRETLYLKKQLKEECRRRRDE---KL-IDEEN--------L-N----DT-EQ
SDQA--AVPLPDMAGPDSFD-SDFPAHRYRCVA-A-GDQWLVRPVYDPQGWDRDVGFDGI
NIETAAKIKRN-----LFASATGQVSRDKQRFTIQSETNAAYTRNS---REQTFSV----
AVDLQSS-GEDLVYSFQGGTKLQTF--KH-NTTDLGVGLTSFGGK-------YYVGGKLE
DTLLVG---------KRVKLTVNAGQMRGSGQTAH---------GGSFEACIRGRDYPVR
NEQICLTMTAL-SFNRELVLNYGLQTQLRPARGTNIDVNINMN-NRKMGKINVKLNS--A
EHWEIALISALTMFKALVR-----------------------------------------
--------------------------------------RRK--SEMTKENE-EEEL----
--
>Capsella_rubella_gnl|BL_ORD_ID|24005 _v10000266m|PACid:20909811
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------PPPLSQQQIPLES----LYQSS
IDLNGKKHNPLAKIGDLQVQFFRLVQRFGQSQNNILVSKVLYRVHLAMLIRAEE--SELK
TVKL--RQDRAKALAREQE-SSGI--PELDFSLRILVLGKTGVGKSATINSIFGQ-PKSE
TDAFRP----ATDRIEEVMGTVNGVNVTFIDTPGFHPLSSSSTRKNRKILLSIKRYVKKR
PPD---------VVLYLDRLDMIDIRYSDFSLLQLITEILGAAIWLNTILVMTHCSTP-T
EGRNGQSMNYESYVGQRMDVVQHYIHQAVSDTK-----LENPVLLVENHLSCKK-NLAGE
YVL---PNGL-VWKPQFM------FLCVCTKVLG------DVQSLLRFRD-G----SGLG
Q------------------PSS-TRTASLP---------------HLLSIFLRRRLSS--
--------GVDEA-EKEI-DEL--LNSDV--EEE-DEYDQLPTIRILGKSRFEKLSKTQK
KDYLDELDYRETLYLKKQLKEEFRRRRDE---KL-TEEEN--------P-N----DT-EQ
NDQA--AVPLPDMAGPDSFD-SDFPAHRYRCVA-A-GDQWLVRPVYDPQGWDRDVGFDGI
NIETAAKIEKK-----LFASATGQVSRDKHHFTIQSETNAGYTRRS---GEQAFSV----
AVDLQSS-GEDLVYSFQGGTKLQTF--KH-NTTDLGFGLTSFGGK-------YYLGGKLE
DTLLVG---------KRVKLTVNAGQMRGSGQTAH---------GGSLEACIRGRDYPVR
NEQIGLTMTAL-SFNQELVLNWGLQTQLRPARGTNIDVNINMN-NRKMGKIHVKLNS--S
EHWEIALISALTMFKALLR-----------------------------------------
--------------------------------------RRK--SEMTKENE-EEES----
--
>Thellungiella_halophila_gnl|BL_ORD_ID|25456 _Thhalv10012730m|PACid:20205134
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------QLPLSQQQVPLES----LYQSS
FDLNEKKHNPLARIGDLQVQFLRLVQRFGQSQSNILVSKVLYRVHLAMLIRAEE--SELK
TVKL--RQDRAKALAREQE-SRGI--PELDFSLRILVLGKTGVGKSATINSIFGQ-SKSE
TDAFRP----TTDRIEEVMGTVSGVKVTFIDTPGFQPPSASSTRKNRKILLSIKRYVKKR
PPD---------VVLYLDRLDMIDMRYSDFPLLKLISEILGAAIWLNTILVMTHSSIA-S
EGRNGQSVNYETYVGQRMDVVQHYIHQAVSDTK-----LENPVLLVENHPSCKK-NPAGE
HVL---PNGL-VWKPQFM------FLCVCTKVLG------DVQSLLRFRD-S----IGLG
Q------------------PIS-TRTASLP---------------HLLTLFLRRRLSS--
--------GADEA-EKEI-DEL--LSSEL--EEE-DEYDQLPAIRILGKSRFEKLSKSQK
KEYLDELDYRETLYLKKQLKEECRRRRDE---KL-VEEEN--------VNN----DT-EQ
SDQA--AVPLPDMAGPDSFD-SDFPAHRYRCIV-T-SDQWLVRPVYDPQGWDRDVGFDGI
NIETAAKVKRN-----LFASATGQVSRDKQRFTIQSETNAAYTTDS---REQTFSV----
AVDLQSS-GEDLVYSFQGGTKLKTF--KH-NTTDLGVALTSFGGK-------YYMGGKLE
DTLLVG---------KRVKLTVNAGQMKGSGQTAH---------GGSFEACIRGSDYPVR
NEQIGLTMTAL-SFNQELVLNWGLQTQLRPNRDTNIDVNINMN-NRKMGKINVKLNS--S
EHWEIALISAFTIFKALLR-----------------------------------------
--------------------------------------RKKVVSEITKENE-EEL-----
--
>Brassica_rapa_gnl|BL_ORD_ID|8882 _002291|PACid:22692392
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------HPPISQQQTPLES----LHQSS
LDLNDKKHNPLAKIGDLQVQFLRLVHRFGQSQNNILVSKVLYRVHLAMLIRAEE--SELK
TVKL--KQDKAKTLAKEQE-SSGV--PELDFSLRILVLGKTGVGKSATINSILGQ-SKSE
TDAFQP----ATDRIEEVNGTVSGVKVTFIDTPGLHQPSPSSARKNRKTLLSIKRYVKKR
PPD---------VVLYLDRLDTIDLRYSDYPLLSLITEVLGAALWLNTILVMTHSSVA-S
EGRN---MNYESYVGQRVDVVQHYIHQAVSDTK-----LENPVLLVENHPSCRK-NHAGE
CVL---PNGL-VWKPQFM------FLCVCTKVLG------DVQSLLRFRD-S----IGLG
Q------------------ASG-TRTASLP---------------HLLSVFLRRRLSS--
--------GGDEA-EREI-DEL--MDSELEEEEE-DEYDQLPAIRILGKARFEKLSKSQK
REYLDELDYRETLYLKKQLKEECRRRKDE---KL-NEEEE------------------EK
SDQA--AVPLPEMAGPDSFD-SDFPSHRYRSIA-T-SDQWLVRPVYDPQGWDHDVGFDGI
NIETAVKVKKN-----LFASANGQVSRDKQRFTIHSETNAAYTTDS---RIQTFSV----
AADVQSS-GDDLVYTFHGGTKLKTF--KQ-NTTDLGVGLTSFGGK-------YYLAGKIE
DSLLVG---------KRVKLTVNAGQMKGSGETAH---------GGSFEACIRGRDYPVR
NEQIGVTVTAL-SFKKELVLNWGLQTQVRPTRDTNVDVSVNMN-NRKMGKINVKLNS--S
EHWEIALISAFTLFKALVR-----------------------------------------
--------------------------------------RKKAVSEITNENE-EEL-----
--
>Aquilegia_coerulea_gnl|BL_ORD_ID|13906 _006_00073.1|PACid:22036942
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------RRA-------SAD----DLGLS
GNMDRNRMDPLAKIESLQIKFMRLVHRLGQSHDNILVAKVLYRLHLATLIRVGE------
KTSL--RNDRARAMAAELE-AAGR--PDLNFSLRILVLGKTGVGKSATINSIFDQ-MKAA
TDAFQP----ATNHIREVIGTSKGIKLTFIDTPGLLPSSTRNVRRNRKILRSVKNFIRNT
PPD---------IVLYFERLDHINMGYSDFPLLKLITDTFGSAIWLNTILVMTHSSGALP
EGPNGYPVSYEPFVAQCTNLVQHYIHQAVSDLK-----IENPVLMVENHPQCKK-NISGE
KVL---PNGQ-AWRSQFL------LLCICMKVLG------DANTLLKFRD-G----FQIG
P------------------SAS-NRLPSLP---------------HLLSTLLRPRST---
--------------EREN-DEL--DDQDT--DDE-DEYDQLPPIRILTKAQFEKLTKSQK
NAYLDELDYRETLYLKKQLRADIQKRRNN---LL-PKDGN--------SANDEDYDN-HE
GNPE--AVQLPDIAVPPSFD-SDWPVHRYRCVV-T-SDQWLARPVLDPQGWDHDVGFDGI
NLENVVEMKKN-----LHLSVLGQLSKDKQDFSVQTECNALFT-DL---KGSSASA----
SLDVQTA-GKDLVCTARGDTKLRNL--KH-NTTGCGVSVTSFGNK-------YFVGAKIE
DTISVG---------RRVELDLNVGRMGGLGQVAY---------GGSFEATVRGRDYPVR
NEKIGLTMTVL-SFDKEMVFGGNILSDFRIGHSSKISLNANLN-SRRMGQICVKTSS--S
DHVEIGLIAVISICRAIFR-----------------------------------------
--------------------------------------RRAIEDRTVD------------
--
>Citrus_clementina_gnl|BL_ORD_ID|10791 _0.9_002789m|PACid:19261909
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------RRYSTSQQVPVED----PSPHN
QNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGE--SDMK
MVNL--RSDRTRAIAREQE-AAGI--PDLDFSIRILVLGKTGVGKSATINSIFDQ-TKTE
TDAFQP----ATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRS
PPD---------IVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLP
EGSSGYPFSYESYVTQCTDLVQQRIHQAVSDAR-----LENQVLLVENHPQCRR-NVKGE
QIL---PNGQ-IWKSRFL------LLCICTKVLG------DANALLGFRD-S----IELG
P------------------LGN-TRVPSMP---------------HLLSSFLRHRSLS--
--------SPSEA-ENEI-DEI--LASEI--DEE-DEYDQLPPIKILKKSQFERLSKSQK
KSYLDELDYREILYFKKQLKEESRRRKEN---KL-SKEEC--------LPNDST-PD-EQ
TSSE--AVMLPDMVVPPSFD-PDCLAYRYRCLV-T-SDQWLVRPVLDLQGWDHDVGFDGI
NLETAVEIKSN-----VFASIAGQITKDKHDFNIHSESAAAYV-DP---EGPTYCI----
GLDVQSS-GKDMIYTVHGNTKLRNF--KH-NVTDCGVSLTSFGNK-------NYVGAKLE
DSLLVG---------KRLKLVMNAGRMGGSGQVAY---------GGSFEAILRGADYPVR
NDNISLTMTAL-SFNKEVVLTGGFQSEFRPIRGLNMSVNANLN-SRKMGQVCIKLNS--S
AHMEIALLAVFSIFRGLLR-----------------------------------------
--------------------------------------RKAAENKSTEALE-TG------
--
>Citrus_sinensis_gnl|BL_ORD_ID|33002 _1.1g003845m|PACid:18125948
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------RRYSTSQQVPVED----PSPHN
QNTDDKMMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGE--SDMK
MVNL--RSDRTRAIAREQE-ATGI--PDLDFSIRILVLGKTGVGKSATINSIFDQ-TKTE
TDAFQP----ATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRS
PPD---------IVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLP
EGSSGYPFSYESYVTQCTDLVQQRIHQAVSDAR-----LENQVLLVENHPQCRR-NVKGE
QIL---PNGQ-IWKSRFL------LLCICTKVLG------DANALLGFRD-S----IELG
P------------------LGN-TRVPSMP---------------HLLSSFLRHRSLS--
--------SPSEA-ENEI-DEI--LASEI--DEE-DEYDQLPPIKILKKSQFERLSKSQK
KSYLDELDYREILYFKKQLKEESRRRKEN---KL-SKEEC--------LPNDST-PD-EQ
TSSE--AVMLPDMVVPPSFD-PDCLAYRYRCLV-T-SDQWLVRPVLDLQGWDHDVGFDGI
NLETAVEIKSN-----VFASIAGQITKDKHDFNIHSESAAAYV-DP---EGPTYCI----
GLDVQSS-GKDMIYTVHGNTKLRNF--KH-NVTDCGVSLTSFGNK-------NYVGAKLE
DSLLVG---------KRLKLVMNAGRMGGSGQVAY---------GGSFEAILRGADYPVR
NDNISLTMTAL-SFNKEVVLTGGFQSEFRPIRGLNMSVNANLN-SRKMGQVCIKLNS--S
AHMEIALLAVFSIFRGLLR-----------------------------------------
--------------------------------------RKAAENRSTEALE-TG------
--
>Manihot_esculenta_gnl|BL_ORD_ID|26569 _4.1_002049m|PACid:17986541
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------GPHPSLQE-------------D
ANRTNHASDPLAKIEDLQVKFFRLLQRLGYSNDNVLVAKVLYRIRLAISIRGRE--LDLK
---------RARKVAEEQE-AIDT--PELDFSVRILVLGKTGVGKSATINSIFDQ-RKMI
TDAFEP----ATNHIEEIAGTVNGFRITFIDTPGFFPSSASNMRRNRKIMLSVKRFIRKS
PPH---------IVLFFERLDLVNMGYYDFPLMKLMTEVFGSAIWFNTILVMTHASSTLP
EGPSGFPVNYESYVTRCTDLIQHFIHQAVSDTK-----LENPVLLAENHTQCKK-NFMGE
NVL---PNGQ-AWRSQFL------LLCMCTKVLG------DANILLEFQD-S----IELG
-------------------SSS-PRVPSLS---------------HLLLSLLRHRLS---
--------SPNGA-EYDV-NEI--LLSDA--DEE-DEYDQLPPIRILTKSQIERLTKSQK
RDYLDELDYRETLYLKKQLKEDISRKREK---KL-AESET--------SGEDNNHED-QQ
PPPD--NVLLPDMAVPPTFD-SDCPVHRYHCVA-T-SDQWLVRPVLDPQGWDHDVSFDGI
NLETAMEIKRN-----IYASITGQMSKDKQNFSIQSECVAAYT-DP---RGPTYSL----
GFDVQSA-GKDLIYTVHSNTKLKTL--KH-HITECAMSLTCFGEN-------YYVGTKLE
DTILIG---------KRLKFIMNAGQMRSSGQVAY---------GGTFEATLRGRDYPVR
NDIISLSMTAL-SFKKETVLGVGFQSEFQPVRGMRMAVNANLN-SQKTGQVSLKMSS--S
ECTEIALVAIFSILRALFH-----------------------------------------
--------------------------------------RKDEGNGRKEVLEM--------
--
>Ricinus_communis_gnl|BL_ORD_ID|60 _27394.m000352|PACid:16798225
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------GHHPCLQQD-SEE----SNRFS
HGGDHKRMDPLAKIEALQIKFFRLLQRLGHSHDNLLAAKVLYRLHLAASIRAGE--TDSK
---------RVRKVAAEQE-AIDI--PKLNYSMRILVLGKTGVGKSATINSVFDQ-TKTM
TNAFEP----ATSRIQEIVGTVKGIKVTFIDTPGFLPSSTSTVRRNRKMMLSVKKFISKY
PPD---------IVLFFERLDLVNLGYSDFPLLTLMTEVFGSAIWFNTVLVMTHAAPTLP
EGPNGYPVNYESYVTRCTDVLQHYIHQAVSDAK-----LENPVLLVENHPQCKK-NFMGE
SIL---PNGQ-AWKSQVL------LLCICNKILG------DASTLLEFQD-S----IKLG
S------------------SNS-QRMPSLP---------------HLLSSVLQHRSVS--
--------SPNES-EHEV-DGI--LLSDA--DEE-DEYDQLPPIRILTKSQFERLTKSQK
RDYLDELDYRETLYLKKQLKEDARRRREK---QL-SDAEN--------FGEDNTYDD-QQ
ASPE--AVLLPDMAVPPSFD-SDCPVHRYRCLA-T-SDQWLVRPVLDPQGWDHDVGFDGI
NLETAIEVKRN-----IHASIVGQMTKDKQHFSIQSECAAAYK-DP---KGPTYSV----
GFDVQSS-GKDLIYTVHSDTKLRIL--RH-NIADCAVSLTSFGNK-------YYVGAKLE
DAILIG---------KRLKFVMNAGQMRGPGQVAY---------GGTLEATLKGRDYPVR
NDSTSLSMTAL-SFKKEMVLGGGFQSQFRPILGMTMAVNANLN-SQKMGKVSIKLSS--S
EHTEIALIAIFSIFRGLLH-----------------------------------------
--------------------------------------RKEAENGSKEALEM--------
--
>Populus_trichocarpa_gnl|BL_ORD_ID|6388 _POPTR_0006s06230.1|PACid:18212433
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------GSPQSLEQV-AAD----SYQPN
HEVEVKKADSLTKIEDLRINFFRLLLRFGRSHDNLLVAKVLHRLHLAAAIRAGE--SNLK
RV----KADGARTVAAEQE-ASGT--PELNFSLRILVLGKTGVGKSATINSVFDQ-PKAP
TDAFRP----ATEHIKEVVGSINGVKVTFIDTPGFLPSSTSNLRRNRKIMLSVRRFIRKS
PPD---------IVLFFERLDLINMGYCDFPLLKLMTEVFGNAVWFNTILVMTHGSST-P
EGPTGYPISYESYVTQCTGLMQHYINQAVSDSK-----LENPVVLVENNPHCKK-NLMGE
SVL---PNGQ-VWKSHFL------LFCICTKVLG------DANTLLEFEG-G----IELG
P------------------LIT-PRVPSLP---------------HLLSSFLKHRSTP--
--------CPSES-EPEV-DEI--LLSDA--DEE-DDYDQLPPIRIMTKSQFEKLTKSLK
KDYLDELDYRETLYLKKQLKDESRRRRER---KL-SGEEN--------FGEDSNSDP-QQ
ASPE--AVLLPDMAVPPSFD-SDCTIHRYRCLV-T-SDQWLVRPVLDPQGWDHDVGFDGV
NMETAIEIRKN-----VHASITGQMSKDKQDFSIQSECAAAYA-DP---RGRTYSV----
GLDVQSS-GKGTIYTVHSNTKLKNL--KQ-NVTECGVSLTSFGNK-------YYVGTKLE
DTMLVG---------KQLKFVVNAGQMRCSEQVAY---------GGSLEATLRGGDYPVR
DDRISLSMSAL-SFKKEMVLGGGFQSEFRPVRGMRMAVNANLN-SQNMGQVNIKISS--S
EHIEIALVSVFSIFKAILH-----------------------------------------
--------------------------------------KKMTENKSREVLE-MG------
--
>Malus_domestica_gnl|BL_ORD_ID|43752 _0000491236|PACid:22663736
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------QSGPSLQHAVVEN----LDHSH
NRSGKKKMDPLVRIDDLQVKFLRLLLRLGLSQNNVLVAKVLYRIHLATLIRAEE--SDLK
RVNL--RSDRARTVAAEQE-ASGL--PEMDFSLRILVLGKTGVGKSATINSIFDQ-TMTE
TNAFRP----GTNRIREVVGTVNGIRVXIIDTPGFLPSCTGNFXRNKKIMLSVKKFIRKS
PPD---------IVLFFERLDLMSTSYNDFSLLKQITEVFGPAVWFNTILVMTHSSLALP
EGLDGNPVNYESYVRQSTDMVQHYIHQAVFDSR-----IENPVLLVENHLQCRK-NIAGE
KIL---PNGQ-VWKSQFL------LLCICTKVLS------DVNILMKFQD-S----IHLG
P------------------SNA-THVPSLP---------------HLLSSLLRHRSTI--
--------SPSGG-DVEV-DES--LVSYT--QEE-DEYDQLPPIRILTKSQFERLTKSQK
KDYLDELDYRETLYLKKQLKEEYRRQMEV---KL-SKEKN--------MASGDNSDS-QQ
ASQE-EAVLLPEMEVPPSFG-SNCPAHRYRCLV-T-SDQWIMRPVLDSHGWDNDVGLDGV
SLEAAMQVNRN-----VFTSVAGQMSKDKQDFSIQSECAAAYL-DH---SGTTYSV----
GLDVQSA-GKDTIYTLHSNTKLRKL--WH-NVAESGFSLTSFGNK-------YYIGGKLE
DTISVG---------KRLKLVMNVGQMMGPEQVAY---------GGSVEATLRGRDYPVR
NDNVSLMMTIL-SFNKEMVLGGNLQSESRLGRDMRVSVNANMN-NRRMGKISIKTSS--T
DHLQFSMVAAFTIFWALLR-----------------------------------------
--------------------------------------KKDVKSTVHE------------
--
>Prunus_persica_gnl|BL_ORD_ID|27646 _ppa001605m|PACid:17668321
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------QSNPSRQHVVVEN----SDQSR
NGSDKKKMDPLVRIDDLQVKFLRLILRLGLSQNNLLVAKVLYRIHLATLIRAEE--SDLK
RVNL--RSDRARAVAAEQE-ASGL--PEMDFSLRILVLGKTGVGKSATINSIFDQ-RKTV
TNAFRP----GTDHIREVVGTINGVRVTIIDTPGFLPSSTGNFRRNKKIMLSVKRFIRKC
PPD---------IVLFFERLDLINASYNDFSLLKLITEVFGPAIWFNTILVMTHSSSALP
EGPDGYPVSYESYVRQSTDMVQHYIHQAVSDSR-----LENPVLLVENHPQCKK-NIIGE
KIL---PNGQ-VWKSQFL------LLCLCTKVLG------DVNTLMKFED-S----IQLG
P------------------SSA-SHMPSLP---------------HLLSSLLRHRSVV--
--------SPSGV-DIEV-DES--LLSDT--EEE-DEYDQLPPIRILTKSQFERLTKSQK
KDYLDELDYRETLYLKKQLKEEYRRRMEI---KL-SKEKI--------FASNDNSDR-QQ
ASQE-SAVLLPDMEVPPSFG-SDCTAHRYRCLV-T-GDQWIMRPVLDPHGWDNDVCFDGI
SLETAMQINSN-----VFTTVTGQMSKDKQDFSIQSECAAAYS-DP---SGTTYTV----
GLDVQSA-GKDTIYTFHSNTKLKKV--WR-NTADCGVSLTSFGNK-------CYIGAKLE
DTISVG---------KRLKFVMNAGQMVGPEQVAY---------GGGIEATLRGRDYPVS
NDNVSLTMTLL-SFNEEMVLGGNLQSESRLGRNLRVSVNANLN-SRKMGKICIKTSS--T
DHLQFSMAAAFTIFWALLQ-----------------------------------------
--------------------------------------KKAVKSTSHE------------
--
>Glycine_max_gnl|BL_ORD_ID|46717 _17g11770.1|PACid:16305250
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------