diff --git a/go.mod b/go.mod index 42ebab5701..6bb85f95a4 100644 --- a/go.mod +++ b/go.mod @@ -104,16 +104,16 @@ require ( go.uber.org/atomic v1.7.0 // indirect go.uber.org/multierr v1.6.0 // indirect go.uber.org/zap v1.24.0 // indirect - golang.org/x/crypto v0.1.0 // indirect - golang.org/x/mod v0.9.0 // indirect - golang.org/x/net v0.8.0 // indirect + golang.org/x/crypto v0.12.0 // indirect + golang.org/x/mod v0.12.0 // indirect + golang.org/x/net v0.14.0 // indirect golang.org/x/oauth2 v0.5.0 // indirect - golang.org/x/sync v0.1.0 // indirect - golang.org/x/sys v0.6.0 // indirect - golang.org/x/term v0.6.0 // indirect - golang.org/x/text v0.8.0 // indirect + golang.org/x/sync v0.3.0 // indirect + golang.org/x/sys v0.11.0 // indirect + golang.org/x/term v0.11.0 // indirect + golang.org/x/text v0.12.0 // indirect golang.org/x/time v0.3.0 // indirect - golang.org/x/tools v0.7.0 // indirect + golang.org/x/tools v0.12.0 // indirect google.golang.org/appengine v1.6.7 // indirect google.golang.org/genproto v0.0.0-20230110181048-76db0878b65f // indirect gopkg.in/inf.v0 v0.9.1 // indirect diff --git a/go.sum b/go.sum index e1f0107b40..44f709de7e 100644 --- a/go.sum +++ b/go.sum @@ -389,8 +389,8 @@ golang.org/x/crypto v0.0.0-20190605123033-f99c8df09eb5/go.mod h1:yigFU9vqHzYiE8U golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= -golang.org/x/crypto v0.1.0 h1:MDRAIl0xIo9Io2xV565hzXHw3zVseKrJKodhohM5CjU= -golang.org/x/crypto v0.1.0/go.mod h1:RecgLatLF4+eUMCP1PoPZQb+cVrJcOPbHkTkbkB9sbw= +golang.org/x/crypto v0.12.0 h1:tFM/ta59kqch6LlvYnPa0yx5a83cL2nHflFhYKvv9Yk= +golang.org/x/crypto v0.12.0/go.mod h1:NF0Gs7EO5K4qLn+Ylc+fih8BSTeIjAP05siRnAh98yw= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -423,8 +423,8 @@ golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.6.0-dev.0.20220106191415-9b9b3d81d5e3/go.mod h1:3p9vT2HGsQu2K1YbXdKPJLVgG5VJdoTa1poYQBtP1AY= -golang.org/x/mod v0.9.0 h1:KENHtAZL2y3NLMYZeHY9DW8HW8V+kQyJsY/V9JlKvCs= -golang.org/x/mod v0.9.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= +golang.org/x/mod v0.12.0 h1:rmsUpXtvNzj340zd98LZ4KntptpfRHwpFOHG188oHXc= +golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180906233101-161cd47e91fd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -463,8 +463,8 @@ golang.org/x/net v0.0.0-20211015210444-4f30a5c0130f/go.mod h1:9nx3DQGgdP8bBQD5qx golang.org/x/net v0.0.0-20220225172249-27dd8689420f/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220425223048-2871e0cb64e4/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220802222814-0bcc04d9c69b/go.mod h1:YDH+HFinaLZZlnHAfSS6ZXJJ9M9t4Dl22yv3iI2vPwk= -golang.org/x/net v0.8.0 h1:Zrh2ngAOFYneWTAIAPethzeaQLuHwhuBkuV6ZiRnUaQ= -golang.org/x/net v0.8.0/go.mod h1:QVkue5JL9kW//ek3r6jTKnTFis1tRmNAW2P1shuFdJc= +golang.org/x/net v0.14.0 h1:BONx9s002vGdD9umnlX1Po8vOZmrgH34qlHcD1MfK14= +golang.org/x/net v0.14.0/go.mod h1:PpSgVXXLK0OxS0F31C1/tv6XNguvCrnXIDrFMspZIUI= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -483,8 +483,8 @@ golang.org/x/sync v0.0.0-20200317015054-43a5402ce75a/go.mod h1:RxMgew5VJxzue5/jJ golang.org/x/sync v0.0.0-20200625203802-6e8e738ad208/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sync v0.1.0 h1:wsuoTGHzEhffawBOhz5CYhcrV4IdKZbEyZjBMuTp12o= -golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.3.0 h1:ftCYgMx6zT/asHUrPw8BLLscYtGznsLAnjq5RH9P66E= +golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y= golang.org/x/sys v0.0.0-20180830151530-49385e6e1522/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180909124046-d0be0721c37e/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= @@ -532,12 +532,12 @@ golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220728004956-3c1f35247d10/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220731174439-a90be440212d/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.6.0 h1:MVltZSvRTcU2ljQOhs94SXPftV6DCNnZViHeQps87pQ= -golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.11.0 h1:eG7RXZHdqOJ1i+0lgLgCpSXAp6M3LYlAo6osgSi0xOM= +golang.org/x/sys v0.11.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= -golang.org/x/term v0.6.0 h1:clScbb1cHjoCkyRbWwBEUZ5H/tIFu5TAXIqaZD0Gcjw= -golang.org/x/term v0.6.0/go.mod h1:m6U89DPEgQRMq3DNkDClhWw02AUbt2daBVO4cn4Hv9U= +golang.org/x/term v0.11.0 h1:F9tnn/DA/Im8nCwm+fX+1/eBwi4qFjRT++MhtVC4ZX0= +golang.org/x/term v0.11.0/go.mod h1:zC9APTIj3jG3FdV/Ons+XE1riIZXG4aZ4GTHiPZJPIU= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -546,8 +546,8 @@ golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.5/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= -golang.org/x/text v0.8.0 h1:57P1ETyNKtuIjB4SRd15iJxuhj8Gc416Y78H3qgMh68= -golang.org/x/text v0.8.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.12.0 h1:k+n5B8goJNdU7hSvEtMUz3d1Q6D/XW4COJSJR6fN0mc= +golang.org/x/text v0.12.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -599,8 +599,8 @@ golang.org/x/tools v0.0.0-20210106214847-113979e3529a/go.mod h1:emZCQorbCU4vsT4f golang.org/x/tools v0.1.1/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.6-0.20210726203631-07bc1bf47fb2/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.10/go.mod h1:Uh6Zz+xoGYZom868N8YTex3t7RhtHDBrE8Gzo9bV56E= -golang.org/x/tools v0.7.0 h1:W4OVu8VVOaIO0yzWMNdepAulS7YfoS3Zabrm8DOXXU4= -golang.org/x/tools v0.7.0/go.mod h1:4pg6aUX35JBAogB10C9AtvVL+qowtN4pT3CGSQex14s= +golang.org/x/tools v0.12.0 h1:YW6HUoUmYBpwSgyaGaZq1fHjrBjX1rlpZ54T6mu2kss= +golang.org/x/tools v0.12.0/go.mod h1:Sc0INKfu04TlqNoRA1hgpFZbhYXHPr4V5DzpSBTPqQM= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= diff --git a/vendor/golang.org/x/crypto/cryptobyte/asn1.go b/vendor/golang.org/x/crypto/cryptobyte/asn1.go index 3a1674a1e5..6fc2838a3f 100644 --- a/vendor/golang.org/x/crypto/cryptobyte/asn1.go +++ b/vendor/golang.org/x/crypto/cryptobyte/asn1.go @@ -264,36 +264,35 @@ func (s *String) ReadASN1Boolean(out *bool) bool { return true } -var bigIntType = reflect.TypeOf((*big.Int)(nil)).Elem() - // ReadASN1Integer decodes an ASN.1 INTEGER into out and advances. If out does -// not point to an integer or to a big.Int, it panics. It reports whether the -// read was successful. +// not point to an integer, to a big.Int, or to a []byte it panics. Only +// positive and zero values can be decoded into []byte, and they are returned as +// big-endian binary values that share memory with s. Positive values will have +// no leading zeroes, and zero will be returned as a single zero byte. +// ReadASN1Integer reports whether the read was successful. func (s *String) ReadASN1Integer(out interface{}) bool { - if reflect.TypeOf(out).Kind() != reflect.Ptr { - panic("out is not a pointer") - } - switch reflect.ValueOf(out).Elem().Kind() { - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + switch out := out.(type) { + case *int, *int8, *int16, *int32, *int64: var i int64 if !s.readASN1Int64(&i) || reflect.ValueOf(out).Elem().OverflowInt(i) { return false } reflect.ValueOf(out).Elem().SetInt(i) return true - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + case *uint, *uint8, *uint16, *uint32, *uint64: var u uint64 if !s.readASN1Uint64(&u) || reflect.ValueOf(out).Elem().OverflowUint(u) { return false } reflect.ValueOf(out).Elem().SetUint(u) return true - case reflect.Struct: - if reflect.TypeOf(out).Elem() == bigIntType { - return s.readASN1BigInt(out.(*big.Int)) - } + case *big.Int: + return s.readASN1BigInt(out) + case *[]byte: + return s.readASN1Bytes(out) + default: + panic("out does not point to an integer type") } - panic("out does not point to an integer type") } func checkASN1Integer(bytes []byte) bool { @@ -333,6 +332,21 @@ func (s *String) readASN1BigInt(out *big.Int) bool { return true } +func (s *String) readASN1Bytes(out *[]byte) bool { + var bytes String + if !s.ReadASN1(&bytes, asn1.INTEGER) || !checkASN1Integer(bytes) { + return false + } + if bytes[0]&0x80 == 0x80 { + return false + } + for len(bytes) > 1 && bytes[0] == 0 { + bytes = bytes[1:] + } + *out = bytes + return true +} + func (s *String) readASN1Int64(out *int64) bool { var bytes String if !s.ReadASN1(&bytes, asn1.INTEGER) || !checkASN1Integer(bytes) || !asn1Signed(out, bytes) { @@ -417,6 +431,14 @@ func (s *String) readBase128Int(out *int) bool { } ret <<= 7 b := s.read(1)[0] + + // ITU-T X.690, section 8.19.2: + // The subidentifier shall be encoded in the fewest possible octets, + // that is, the leading octet of the subidentifier shall not have the value 0x80. + if i == 0 && b == 0x80 { + return false + } + ret |= int(b & 0x7f) if b&0x80 == 0 { *out = ret @@ -532,7 +554,7 @@ func (s *String) ReadASN1BitString(out *encoding_asn1.BitString) bool { return false } - paddingBits := uint8(bytes[0]) + paddingBits := bytes[0] bytes = bytes[1:] if paddingBits > 7 || len(bytes) == 0 && paddingBits != 0 || @@ -545,7 +567,7 @@ func (s *String) ReadASN1BitString(out *encoding_asn1.BitString) bool { return true } -// ReadASN1BitString decodes an ASN.1 BIT STRING into out and advances. It is +// ReadASN1BitStringAsBytes decodes an ASN.1 BIT STRING into out and advances. It is // an error if the BIT STRING is not a whole number of bytes. It reports // whether the read was successful. func (s *String) ReadASN1BitStringAsBytes(out *[]byte) bool { @@ -554,7 +576,7 @@ func (s *String) ReadASN1BitStringAsBytes(out *[]byte) bool { return false } - paddingBits := uint8(bytes[0]) + paddingBits := bytes[0] if paddingBits != 0 { return false } @@ -654,34 +676,27 @@ func (s *String) SkipOptionalASN1(tag asn1.Tag) bool { return s.ReadASN1(&unused, tag) } -// ReadOptionalASN1Integer attempts to read an optional ASN.1 INTEGER -// explicitly tagged with tag into out and advances. If no element with a -// matching tag is present, it writes defaultValue into out instead. If out -// does not point to an integer or to a big.Int, it panics. It reports -// whether the read was successful. +// ReadOptionalASN1Integer attempts to read an optional ASN.1 INTEGER explicitly +// tagged with tag into out and advances. If no element with a matching tag is +// present, it writes defaultValue into out instead. Otherwise, it behaves like +// ReadASN1Integer. func (s *String) ReadOptionalASN1Integer(out interface{}, tag asn1.Tag, defaultValue interface{}) bool { - if reflect.TypeOf(out).Kind() != reflect.Ptr { - panic("out is not a pointer") - } var present bool var i String if !s.ReadOptionalASN1(&i, &present, tag) { return false } if !present { - switch reflect.ValueOf(out).Elem().Kind() { - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, - reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + switch out.(type) { + case *int, *int8, *int16, *int32, *int64, + *uint, *uint8, *uint16, *uint32, *uint64, *[]byte: reflect.ValueOf(out).Elem().Set(reflect.ValueOf(defaultValue)) - case reflect.Struct: - if reflect.TypeOf(out).Elem() != bigIntType { - panic("invalid integer type") - } - if reflect.TypeOf(defaultValue).Kind() != reflect.Ptr || - reflect.TypeOf(defaultValue).Elem() != bigIntType { + case *big.Int: + if defaultValue, ok := defaultValue.(*big.Int); ok { + out.(*big.Int).Set(defaultValue) + } else { panic("out points to big.Int, but defaultValue does not") } - out.(*big.Int).Set(defaultValue.(*big.Int)) default: panic("invalid integer type") } diff --git a/vendor/golang.org/x/crypto/cryptobyte/builder.go b/vendor/golang.org/x/crypto/cryptobyte/builder.go index 2a90c592d7..c05ac7d16d 100644 --- a/vendor/golang.org/x/crypto/cryptobyte/builder.go +++ b/vendor/golang.org/x/crypto/cryptobyte/builder.go @@ -303,9 +303,9 @@ func (b *Builder) add(bytes ...byte) { b.result = append(b.result, bytes...) } -// Unwrite rolls back n bytes written directly to the Builder. An attempt by a -// child builder passed to a continuation to unwrite bytes from its parent will -// panic. +// Unwrite rolls back non-negative n bytes written directly to the Builder. +// An attempt by a child builder passed to a continuation to unwrite bytes +// from its parent will panic. func (b *Builder) Unwrite(n int) { if b.err != nil { return @@ -317,6 +317,9 @@ func (b *Builder) Unwrite(n int) { if length < 0 { panic("cryptobyte: internal error") } + if n < 0 { + panic("cryptobyte: attempted to unwrite negative number of bytes") + } if n > length { panic("cryptobyte: attempted to unwrite more than was written") } diff --git a/vendor/golang.org/x/crypto/curve25519/curve25519.go b/vendor/golang.org/x/crypto/curve25519/curve25519.go index bc62161d6e..00f963ea20 100644 --- a/vendor/golang.org/x/crypto/curve25519/curve25519.go +++ b/vendor/golang.org/x/crypto/curve25519/curve25519.go @@ -5,71 +5,18 @@ // Package curve25519 provides an implementation of the X25519 function, which // performs scalar multiplication on the elliptic curve known as Curve25519. // See RFC 7748. +// +// Starting in Go 1.20, this package is a wrapper for the X25519 implementation +// in the crypto/ecdh package. package curve25519 // import "golang.org/x/crypto/curve25519" -import ( - "crypto/subtle" - "errors" - "strconv" - - "golang.org/x/crypto/curve25519/internal/field" -) - // ScalarMult sets dst to the product scalar * point. // // Deprecated: when provided a low-order point, ScalarMult will set dst to all // zeroes, irrespective of the scalar. Instead, use the X25519 function, which // will return an error. func ScalarMult(dst, scalar, point *[32]byte) { - var e [32]byte - - copy(e[:], scalar[:]) - e[0] &= 248 - e[31] &= 127 - e[31] |= 64 - - var x1, x2, z2, x3, z3, tmp0, tmp1 field.Element - x1.SetBytes(point[:]) - x2.One() - x3.Set(&x1) - z3.One() - - swap := 0 - for pos := 254; pos >= 0; pos-- { - b := e[pos/8] >> uint(pos&7) - b &= 1 - swap ^= int(b) - x2.Swap(&x3, swap) - z2.Swap(&z3, swap) - swap = int(b) - - tmp0.Subtract(&x3, &z3) - tmp1.Subtract(&x2, &z2) - x2.Add(&x2, &z2) - z2.Add(&x3, &z3) - z3.Multiply(&tmp0, &x2) - z2.Multiply(&z2, &tmp1) - tmp0.Square(&tmp1) - tmp1.Square(&x2) - x3.Add(&z3, &z2) - z2.Subtract(&z3, &z2) - x2.Multiply(&tmp1, &tmp0) - tmp1.Subtract(&tmp1, &tmp0) - z2.Square(&z2) - - z3.Mult32(&tmp1, 121666) - x3.Square(&x3) - tmp0.Add(&tmp0, &z3) - z3.Multiply(&x1, &z2) - z2.Multiply(&tmp1, &tmp0) - } - - x2.Swap(&x3, swap) - z2.Swap(&z3, swap) - - z2.Invert(&z2) - x2.Multiply(&x2, &z2) - copy(dst[:], x2.Bytes()) + scalarMult(dst, scalar, point) } // ScalarBaseMult sets dst to the product scalar * base where base is the @@ -78,7 +25,7 @@ func ScalarMult(dst, scalar, point *[32]byte) { // It is recommended to use the X25519 function with Basepoint instead, as // copying into fixed size arrays can lead to unexpected bugs. func ScalarBaseMult(dst, scalar *[32]byte) { - ScalarMult(dst, scalar, &basePoint) + scalarBaseMult(dst, scalar) } const ( @@ -91,21 +38,10 @@ const ( // Basepoint is the canonical Curve25519 generator. var Basepoint []byte -var basePoint = [32]byte{9, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0} +var basePoint = [32]byte{9} func init() { Basepoint = basePoint[:] } -func checkBasepoint() { - if subtle.ConstantTimeCompare(Basepoint, []byte{ - 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - }) != 1 { - panic("curve25519: global Basepoint value was modified") - } -} - // X25519 returns the result of the scalar multiplication (scalar * point), // according to RFC 7748, Section 5. scalar, point and the return value are // slices of 32 bytes. @@ -121,26 +57,3 @@ func X25519(scalar, point []byte) ([]byte, error) { var dst [32]byte return x25519(&dst, scalar, point) } - -func x25519(dst *[32]byte, scalar, point []byte) ([]byte, error) { - var in [32]byte - if l := len(scalar); l != 32 { - return nil, errors.New("bad scalar length: " + strconv.Itoa(l) + ", expected 32") - } - if l := len(point); l != 32 { - return nil, errors.New("bad point length: " + strconv.Itoa(l) + ", expected 32") - } - copy(in[:], scalar) - if &point[0] == &Basepoint[0] { - checkBasepoint() - ScalarBaseMult(dst, &in) - } else { - var base, zero [32]byte - copy(base[:], point) - ScalarMult(dst, &in, &base) - if subtle.ConstantTimeCompare(dst[:], zero[:]) == 1 { - return nil, errors.New("bad input point: low order point") - } - } - return dst[:], nil -} diff --git a/vendor/golang.org/x/crypto/curve25519/curve25519_compat.go b/vendor/golang.org/x/crypto/curve25519/curve25519_compat.go new file mode 100644 index 0000000000..ba647e8d77 --- /dev/null +++ b/vendor/golang.org/x/crypto/curve25519/curve25519_compat.go @@ -0,0 +1,105 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.20 + +package curve25519 + +import ( + "crypto/subtle" + "errors" + "strconv" + + "golang.org/x/crypto/curve25519/internal/field" +) + +func scalarMult(dst, scalar, point *[32]byte) { + var e [32]byte + + copy(e[:], scalar[:]) + e[0] &= 248 + e[31] &= 127 + e[31] |= 64 + + var x1, x2, z2, x3, z3, tmp0, tmp1 field.Element + x1.SetBytes(point[:]) + x2.One() + x3.Set(&x1) + z3.One() + + swap := 0 + for pos := 254; pos >= 0; pos-- { + b := e[pos/8] >> uint(pos&7) + b &= 1 + swap ^= int(b) + x2.Swap(&x3, swap) + z2.Swap(&z3, swap) + swap = int(b) + + tmp0.Subtract(&x3, &z3) + tmp1.Subtract(&x2, &z2) + x2.Add(&x2, &z2) + z2.Add(&x3, &z3) + z3.Multiply(&tmp0, &x2) + z2.Multiply(&z2, &tmp1) + tmp0.Square(&tmp1) + tmp1.Square(&x2) + x3.Add(&z3, &z2) + z2.Subtract(&z3, &z2) + x2.Multiply(&tmp1, &tmp0) + tmp1.Subtract(&tmp1, &tmp0) + z2.Square(&z2) + + z3.Mult32(&tmp1, 121666) + x3.Square(&x3) + tmp0.Add(&tmp0, &z3) + z3.Multiply(&x1, &z2) + z2.Multiply(&tmp1, &tmp0) + } + + x2.Swap(&x3, swap) + z2.Swap(&z3, swap) + + z2.Invert(&z2) + x2.Multiply(&x2, &z2) + copy(dst[:], x2.Bytes()) +} + +func scalarBaseMult(dst, scalar *[32]byte) { + checkBasepoint() + scalarMult(dst, scalar, &basePoint) +} + +func x25519(dst *[32]byte, scalar, point []byte) ([]byte, error) { + var in [32]byte + if l := len(scalar); l != 32 { + return nil, errors.New("bad scalar length: " + strconv.Itoa(l) + ", expected 32") + } + if l := len(point); l != 32 { + return nil, errors.New("bad point length: " + strconv.Itoa(l) + ", expected 32") + } + copy(in[:], scalar) + if &point[0] == &Basepoint[0] { + scalarBaseMult(dst, &in) + } else { + var base, zero [32]byte + copy(base[:], point) + scalarMult(dst, &in, &base) + if subtle.ConstantTimeCompare(dst[:], zero[:]) == 1 { + return nil, errors.New("bad input point: low order point") + } + } + return dst[:], nil +} + +func checkBasepoint() { + if subtle.ConstantTimeCompare(Basepoint, []byte{ + 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + }) != 1 { + panic("curve25519: global Basepoint value was modified") + } +} diff --git a/vendor/golang.org/x/crypto/curve25519/curve25519_go120.go b/vendor/golang.org/x/crypto/curve25519/curve25519_go120.go new file mode 100644 index 0000000000..627df49727 --- /dev/null +++ b/vendor/golang.org/x/crypto/curve25519/curve25519_go120.go @@ -0,0 +1,46 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.20 + +package curve25519 + +import "crypto/ecdh" + +func x25519(dst *[32]byte, scalar, point []byte) ([]byte, error) { + curve := ecdh.X25519() + pub, err := curve.NewPublicKey(point) + if err != nil { + return nil, err + } + priv, err := curve.NewPrivateKey(scalar) + if err != nil { + return nil, err + } + out, err := priv.ECDH(pub) + if err != nil { + return nil, err + } + copy(dst[:], out) + return dst[:], nil +} + +func scalarMult(dst, scalar, point *[32]byte) { + if _, err := x25519(dst, scalar[:], point[:]); err != nil { + // The only error condition for x25519 when the inputs are 32 bytes long + // is if the output would have been the all-zero value. + for i := range dst { + dst[i] = 0 + } + } +} + +func scalarBaseMult(dst, scalar *[32]byte) { + curve := ecdh.X25519() + priv, err := curve.NewPrivateKey(scalar[:]) + if err != nil { + panic("curve25519: internal error: scalarBaseMult was not 32 bytes") + } + copy(dst[:], priv.PublicKey().Bytes()) +} diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go index 7b5b78cbd6..2671217da5 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go @@ -245,7 +245,7 @@ func feSquareGeneric(v, a *Element) { v.carryPropagate() } -// carryPropagate brings the limbs below 52 bits by applying the reduction +// carryPropagateGeneric brings the limbs below 52 bits by applying the reduction // identity (a * 2²⁵⁵ + b = a * 19 + b) to the l4 carry. TODO inline func (v *Element) carryPropagateGeneric() *Element { c0 := v.l0 >> 51 diff --git a/vendor/golang.org/x/crypto/salsa20/salsa/hsalsa20.go b/vendor/golang.org/x/crypto/salsa20/salsa/hsalsa20.go index 4c96147c86..3fd05b2751 100644 --- a/vendor/golang.org/x/crypto/salsa20/salsa/hsalsa20.go +++ b/vendor/golang.org/x/crypto/salsa20/salsa/hsalsa20.go @@ -5,6 +5,8 @@ // Package salsa provides low-level access to functions in the Salsa family. package salsa // import "golang.org/x/crypto/salsa20/salsa" +import "math/bits" + // Sigma is the Salsa20 constant for 256-bit keys. var Sigma = [16]byte{'e', 'x', 'p', 'a', 'n', 'd', ' ', '3', '2', '-', 'b', 'y', 't', 'e', ' ', 'k'} @@ -31,76 +33,76 @@ func HSalsa20(out *[32]byte, in *[16]byte, k *[32]byte, c *[16]byte) { for i := 0; i < 20; i += 2 { u := x0 + x12 - x4 ^= u<<7 | u>>(32-7) + x4 ^= bits.RotateLeft32(u, 7) u = x4 + x0 - x8 ^= u<<9 | u>>(32-9) + x8 ^= bits.RotateLeft32(u, 9) u = x8 + x4 - x12 ^= u<<13 | u>>(32-13) + x12 ^= bits.RotateLeft32(u, 13) u = x12 + x8 - x0 ^= u<<18 | u>>(32-18) + x0 ^= bits.RotateLeft32(u, 18) u = x5 + x1 - x9 ^= u<<7 | u>>(32-7) + x9 ^= bits.RotateLeft32(u, 7) u = x9 + x5 - x13 ^= u<<9 | u>>(32-9) + x13 ^= bits.RotateLeft32(u, 9) u = x13 + x9 - x1 ^= u<<13 | u>>(32-13) + x1 ^= bits.RotateLeft32(u, 13) u = x1 + x13 - x5 ^= u<<18 | u>>(32-18) + x5 ^= bits.RotateLeft32(u, 18) u = x10 + x6 - x14 ^= u<<7 | u>>(32-7) + x14 ^= bits.RotateLeft32(u, 7) u = x14 + x10 - x2 ^= u<<9 | u>>(32-9) + x2 ^= bits.RotateLeft32(u, 9) u = x2 + x14 - x6 ^= u<<13 | u>>(32-13) + x6 ^= bits.RotateLeft32(u, 13) u = x6 + x2 - x10 ^= u<<18 | u>>(32-18) + x10 ^= bits.RotateLeft32(u, 18) u = x15 + x11 - x3 ^= u<<7 | u>>(32-7) + x3 ^= bits.RotateLeft32(u, 7) u = x3 + x15 - x7 ^= u<<9 | u>>(32-9) + x7 ^= bits.RotateLeft32(u, 9) u = x7 + x3 - x11 ^= u<<13 | u>>(32-13) + x11 ^= bits.RotateLeft32(u, 13) u = x11 + x7 - x15 ^= u<<18 | u>>(32-18) + x15 ^= bits.RotateLeft32(u, 18) u = x0 + x3 - x1 ^= u<<7 | u>>(32-7) + x1 ^= bits.RotateLeft32(u, 7) u = x1 + x0 - x2 ^= u<<9 | u>>(32-9) + x2 ^= bits.RotateLeft32(u, 9) u = x2 + x1 - x3 ^= u<<13 | u>>(32-13) + x3 ^= bits.RotateLeft32(u, 13) u = x3 + x2 - x0 ^= u<<18 | u>>(32-18) + x0 ^= bits.RotateLeft32(u, 18) u = x5 + x4 - x6 ^= u<<7 | u>>(32-7) + x6 ^= bits.RotateLeft32(u, 7) u = x6 + x5 - x7 ^= u<<9 | u>>(32-9) + x7 ^= bits.RotateLeft32(u, 9) u = x7 + x6 - x4 ^= u<<13 | u>>(32-13) + x4 ^= bits.RotateLeft32(u, 13) u = x4 + x7 - x5 ^= u<<18 | u>>(32-18) + x5 ^= bits.RotateLeft32(u, 18) u = x10 + x9 - x11 ^= u<<7 | u>>(32-7) + x11 ^= bits.RotateLeft32(u, 7) u = x11 + x10 - x8 ^= u<<9 | u>>(32-9) + x8 ^= bits.RotateLeft32(u, 9) u = x8 + x11 - x9 ^= u<<13 | u>>(32-13) + x9 ^= bits.RotateLeft32(u, 13) u = x9 + x8 - x10 ^= u<<18 | u>>(32-18) + x10 ^= bits.RotateLeft32(u, 18) u = x15 + x14 - x12 ^= u<<7 | u>>(32-7) + x12 ^= bits.RotateLeft32(u, 7) u = x12 + x15 - x13 ^= u<<9 | u>>(32-9) + x13 ^= bits.RotateLeft32(u, 9) u = x13 + x12 - x14 ^= u<<13 | u>>(32-13) + x14 ^= bits.RotateLeft32(u, 13) u = x14 + x13 - x15 ^= u<<18 | u>>(32-18) + x15 ^= bits.RotateLeft32(u, 18) } out[0] = byte(x0) out[1] = byte(x0 >> 8) diff --git a/vendor/golang.org/x/crypto/salsa20/salsa/salsa208.go b/vendor/golang.org/x/crypto/salsa20/salsa/salsa208.go index 9bfc0927ce..7ec7bb39bc 100644 --- a/vendor/golang.org/x/crypto/salsa20/salsa/salsa208.go +++ b/vendor/golang.org/x/crypto/salsa20/salsa/salsa208.go @@ -4,6 +4,8 @@ package salsa +import "math/bits" + // Core208 applies the Salsa20/8 core function to the 64-byte array in and puts // the result into the 64-byte array out. The input and output may be the same array. func Core208(out *[64]byte, in *[64]byte) { @@ -29,76 +31,76 @@ func Core208(out *[64]byte, in *[64]byte) { for i := 0; i < 8; i += 2 { u := x0 + x12 - x4 ^= u<<7 | u>>(32-7) + x4 ^= bits.RotateLeft32(u, 7) u = x4 + x0 - x8 ^= u<<9 | u>>(32-9) + x8 ^= bits.RotateLeft32(u, 9) u = x8 + x4 - x12 ^= u<<13 | u>>(32-13) + x12 ^= bits.RotateLeft32(u, 13) u = x12 + x8 - x0 ^= u<<18 | u>>(32-18) + x0 ^= bits.RotateLeft32(u, 18) u = x5 + x1 - x9 ^= u<<7 | u>>(32-7) + x9 ^= bits.RotateLeft32(u, 7) u = x9 + x5 - x13 ^= u<<9 | u>>(32-9) + x13 ^= bits.RotateLeft32(u, 9) u = x13 + x9 - x1 ^= u<<13 | u>>(32-13) + x1 ^= bits.RotateLeft32(u, 13) u = x1 + x13 - x5 ^= u<<18 | u>>(32-18) + x5 ^= bits.RotateLeft32(u, 18) u = x10 + x6 - x14 ^= u<<7 | u>>(32-7) + x14 ^= bits.RotateLeft32(u, 7) u = x14 + x10 - x2 ^= u<<9 | u>>(32-9) + x2 ^= bits.RotateLeft32(u, 9) u = x2 + x14 - x6 ^= u<<13 | u>>(32-13) + x6 ^= bits.RotateLeft32(u, 13) u = x6 + x2 - x10 ^= u<<18 | u>>(32-18) + x10 ^= bits.RotateLeft32(u, 18) u = x15 + x11 - x3 ^= u<<7 | u>>(32-7) + x3 ^= bits.RotateLeft32(u, 7) u = x3 + x15 - x7 ^= u<<9 | u>>(32-9) + x7 ^= bits.RotateLeft32(u, 9) u = x7 + x3 - x11 ^= u<<13 | u>>(32-13) + x11 ^= bits.RotateLeft32(u, 13) u = x11 + x7 - x15 ^= u<<18 | u>>(32-18) + x15 ^= bits.RotateLeft32(u, 18) u = x0 + x3 - x1 ^= u<<7 | u>>(32-7) + x1 ^= bits.RotateLeft32(u, 7) u = x1 + x0 - x2 ^= u<<9 | u>>(32-9) + x2 ^= bits.RotateLeft32(u, 9) u = x2 + x1 - x3 ^= u<<13 | u>>(32-13) + x3 ^= bits.RotateLeft32(u, 13) u = x3 + x2 - x0 ^= u<<18 | u>>(32-18) + x0 ^= bits.RotateLeft32(u, 18) u = x5 + x4 - x6 ^= u<<7 | u>>(32-7) + x6 ^= bits.RotateLeft32(u, 7) u = x6 + x5 - x7 ^= u<<9 | u>>(32-9) + x7 ^= bits.RotateLeft32(u, 9) u = x7 + x6 - x4 ^= u<<13 | u>>(32-13) + x4 ^= bits.RotateLeft32(u, 13) u = x4 + x7 - x5 ^= u<<18 | u>>(32-18) + x5 ^= bits.RotateLeft32(u, 18) u = x10 + x9 - x11 ^= u<<7 | u>>(32-7) + x11 ^= bits.RotateLeft32(u, 7) u = x11 + x10 - x8 ^= u<<9 | u>>(32-9) + x8 ^= bits.RotateLeft32(u, 9) u = x8 + x11 - x9 ^= u<<13 | u>>(32-13) + x9 ^= bits.RotateLeft32(u, 13) u = x9 + x8 - x10 ^= u<<18 | u>>(32-18) + x10 ^= bits.RotateLeft32(u, 18) u = x15 + x14 - x12 ^= u<<7 | u>>(32-7) + x12 ^= bits.RotateLeft32(u, 7) u = x12 + x15 - x13 ^= u<<9 | u>>(32-9) + x13 ^= bits.RotateLeft32(u, 9) u = x13 + x12 - x14 ^= u<<13 | u>>(32-13) + x14 ^= bits.RotateLeft32(u, 13) u = x14 + x13 - x15 ^= u<<18 | u>>(32-18) + x15 ^= bits.RotateLeft32(u, 18) } x0 += j0 x1 += j1 diff --git a/vendor/golang.org/x/crypto/salsa20/salsa/salsa20_ref.go b/vendor/golang.org/x/crypto/salsa20/salsa/salsa20_ref.go index 68169c6d68..e5cdb9a25b 100644 --- a/vendor/golang.org/x/crypto/salsa20/salsa/salsa20_ref.go +++ b/vendor/golang.org/x/crypto/salsa20/salsa/salsa20_ref.go @@ -4,6 +4,8 @@ package salsa +import "math/bits" + const rounds = 20 // core applies the Salsa20 core function to 16-byte input in, 32-byte key k, @@ -31,76 +33,76 @@ func core(out *[64]byte, in *[16]byte, k *[32]byte, c *[16]byte) { for i := 0; i < rounds; i += 2 { u := x0 + x12 - x4 ^= u<<7 | u>>(32-7) + x4 ^= bits.RotateLeft32(u, 7) u = x4 + x0 - x8 ^= u<<9 | u>>(32-9) + x8 ^= bits.RotateLeft32(u, 9) u = x8 + x4 - x12 ^= u<<13 | u>>(32-13) + x12 ^= bits.RotateLeft32(u, 13) u = x12 + x8 - x0 ^= u<<18 | u>>(32-18) + x0 ^= bits.RotateLeft32(u, 18) u = x5 + x1 - x9 ^= u<<7 | u>>(32-7) + x9 ^= bits.RotateLeft32(u, 7) u = x9 + x5 - x13 ^= u<<9 | u>>(32-9) + x13 ^= bits.RotateLeft32(u, 9) u = x13 + x9 - x1 ^= u<<13 | u>>(32-13) + x1 ^= bits.RotateLeft32(u, 13) u = x1 + x13 - x5 ^= u<<18 | u>>(32-18) + x5 ^= bits.RotateLeft32(u, 18) u = x10 + x6 - x14 ^= u<<7 | u>>(32-7) + x14 ^= bits.RotateLeft32(u, 7) u = x14 + x10 - x2 ^= u<<9 | u>>(32-9) + x2 ^= bits.RotateLeft32(u, 9) u = x2 + x14 - x6 ^= u<<13 | u>>(32-13) + x6 ^= bits.RotateLeft32(u, 13) u = x6 + x2 - x10 ^= u<<18 | u>>(32-18) + x10 ^= bits.RotateLeft32(u, 18) u = x15 + x11 - x3 ^= u<<7 | u>>(32-7) + x3 ^= bits.RotateLeft32(u, 7) u = x3 + x15 - x7 ^= u<<9 | u>>(32-9) + x7 ^= bits.RotateLeft32(u, 9) u = x7 + x3 - x11 ^= u<<13 | u>>(32-13) + x11 ^= bits.RotateLeft32(u, 13) u = x11 + x7 - x15 ^= u<<18 | u>>(32-18) + x15 ^= bits.RotateLeft32(u, 18) u = x0 + x3 - x1 ^= u<<7 | u>>(32-7) + x1 ^= bits.RotateLeft32(u, 7) u = x1 + x0 - x2 ^= u<<9 | u>>(32-9) + x2 ^= bits.RotateLeft32(u, 9) u = x2 + x1 - x3 ^= u<<13 | u>>(32-13) + x3 ^= bits.RotateLeft32(u, 13) u = x3 + x2 - x0 ^= u<<18 | u>>(32-18) + x0 ^= bits.RotateLeft32(u, 18) u = x5 + x4 - x6 ^= u<<7 | u>>(32-7) + x6 ^= bits.RotateLeft32(u, 7) u = x6 + x5 - x7 ^= u<<9 | u>>(32-9) + x7 ^= bits.RotateLeft32(u, 9) u = x7 + x6 - x4 ^= u<<13 | u>>(32-13) + x4 ^= bits.RotateLeft32(u, 13) u = x4 + x7 - x5 ^= u<<18 | u>>(32-18) + x5 ^= bits.RotateLeft32(u, 18) u = x10 + x9 - x11 ^= u<<7 | u>>(32-7) + x11 ^= bits.RotateLeft32(u, 7) u = x11 + x10 - x8 ^= u<<9 | u>>(32-9) + x8 ^= bits.RotateLeft32(u, 9) u = x8 + x11 - x9 ^= u<<13 | u>>(32-13) + x9 ^= bits.RotateLeft32(u, 13) u = x9 + x8 - x10 ^= u<<18 | u>>(32-18) + x10 ^= bits.RotateLeft32(u, 18) u = x15 + x14 - x12 ^= u<<7 | u>>(32-7) + x12 ^= bits.RotateLeft32(u, 7) u = x12 + x15 - x13 ^= u<<9 | u>>(32-9) + x13 ^= bits.RotateLeft32(u, 9) u = x13 + x12 - x14 ^= u<<13 | u>>(32-13) + x14 ^= bits.RotateLeft32(u, 13) u = x14 + x13 - x15 ^= u<<18 | u>>(32-18) + x15 ^= bits.RotateLeft32(u, 18) } x0 += j0 x1 += j1 diff --git a/vendor/golang.org/x/crypto/ssh/cipher.go b/vendor/golang.org/x/crypto/ssh/cipher.go index 87f48552ce..741e984f33 100644 --- a/vendor/golang.org/x/crypto/ssh/cipher.go +++ b/vendor/golang.org/x/crypto/ssh/cipher.go @@ -114,7 +114,8 @@ var cipherModes = map[string]*cipherMode{ "arcfour": {16, 0, streamCipherMode(0, newRC4)}, // AEAD ciphers - gcmCipherID: {16, 12, newGCMCipher}, + gcm128CipherID: {16, 12, newGCMCipher}, + gcm256CipherID: {32, 12, newGCMCipher}, chacha20Poly1305ID: {64, 0, newChaCha20Cipher}, // CBC mode is insecure and so is not included in the default config. diff --git a/vendor/golang.org/x/crypto/ssh/common.go b/vendor/golang.org/x/crypto/ssh/common.go index 7a5ff2d2eb..b419c761ed 100644 --- a/vendor/golang.org/x/crypto/ssh/common.go +++ b/vendor/golang.org/x/crypto/ssh/common.go @@ -10,6 +10,7 @@ import ( "fmt" "io" "math" + "strings" "sync" _ "crypto/sha1" @@ -27,7 +28,7 @@ const ( // supportedCiphers lists ciphers we support but might not recommend. var supportedCiphers = []string{ "aes128-ctr", "aes192-ctr", "aes256-ctr", - "aes128-gcm@openssh.com", + "aes128-gcm@openssh.com", gcm256CipherID, chacha20Poly1305ID, "arcfour256", "arcfour128", "arcfour", aes128cbcID, @@ -36,7 +37,7 @@ var supportedCiphers = []string{ // preferredCiphers specifies the default preference for ciphers. var preferredCiphers = []string{ - "aes128-gcm@openssh.com", + "aes128-gcm@openssh.com", gcm256CipherID, chacha20Poly1305ID, "aes128-ctr", "aes192-ctr", "aes256-ctr", } @@ -48,7 +49,8 @@ var supportedKexAlgos = []string{ // P384 and P521 are not constant-time yet, but since we don't // reuse ephemeral keys, using them for ECDH should be OK. kexAlgoECDH256, kexAlgoECDH384, kexAlgoECDH521, - kexAlgoDH14SHA256, kexAlgoDH14SHA1, kexAlgoDH1SHA1, + kexAlgoDH14SHA256, kexAlgoDH16SHA512, kexAlgoDH14SHA1, + kexAlgoDH1SHA1, } // serverForbiddenKexAlgos contains key exchange algorithms, that are forbidden @@ -58,8 +60,9 @@ var serverForbiddenKexAlgos = map[string]struct{}{ kexAlgoDHGEXSHA256: {}, // server half implementation is only minimal to satisfy the automated tests } -// preferredKexAlgos specifies the default preference for key-exchange algorithms -// in preference order. +// preferredKexAlgos specifies the default preference for key-exchange +// algorithms in preference order. The diffie-hellman-group16-sha512 algorithm +// is disabled by default because it is a bit slower than the others. var preferredKexAlgos = []string{ kexAlgoCurve25519SHA256, kexAlgoCurve25519SHA256LibSSH, kexAlgoECDH256, kexAlgoECDH384, kexAlgoECDH521, @@ -69,12 +72,12 @@ var preferredKexAlgos = []string{ // supportedHostKeyAlgos specifies the supported host-key algorithms (i.e. methods // of authenticating servers) in preference order. var supportedHostKeyAlgos = []string{ - CertAlgoRSASHA512v01, CertAlgoRSASHA256v01, + CertAlgoRSASHA256v01, CertAlgoRSASHA512v01, CertAlgoRSAv01, CertAlgoDSAv01, CertAlgoECDSA256v01, CertAlgoECDSA384v01, CertAlgoECDSA521v01, CertAlgoED25519v01, KeyAlgoECDSA256, KeyAlgoECDSA384, KeyAlgoECDSA521, - KeyAlgoRSASHA512, KeyAlgoRSASHA256, + KeyAlgoRSASHA256, KeyAlgoRSASHA512, KeyAlgoRSA, KeyAlgoDSA, KeyAlgoED25519, @@ -84,7 +87,7 @@ var supportedHostKeyAlgos = []string{ // This is based on RFC 4253, section 6.4, but with hmac-md5 variants removed // because they have reached the end of their useful life. var supportedMACs = []string{ - "hmac-sha2-256-etm@openssh.com", "hmac-sha2-256", "hmac-sha1", "hmac-sha1-96", + "hmac-sha2-256-etm@openssh.com", "hmac-sha2-512-etm@openssh.com", "hmac-sha2-256", "hmac-sha2-512", "hmac-sha1", "hmac-sha1-96", } var supportedCompressions = []string{compressionNone} @@ -118,6 +121,27 @@ func algorithmsForKeyFormat(keyFormat string) []string { } } +// isRSA returns whether algo is a supported RSA algorithm, including certificate +// algorithms. +func isRSA(algo string) bool { + algos := algorithmsForKeyFormat(KeyAlgoRSA) + return contains(algos, underlyingAlgo(algo)) +} + +// supportedPubKeyAuthAlgos specifies the supported client public key +// authentication algorithms. Note that this doesn't include certificate types +// since those use the underlying algorithm. This list is sent to the client if +// it supports the server-sig-algs extension. Order is irrelevant. +var supportedPubKeyAuthAlgos = []string{ + KeyAlgoED25519, + KeyAlgoSKED25519, KeyAlgoSKECDSA256, + KeyAlgoECDSA256, KeyAlgoECDSA384, KeyAlgoECDSA521, + KeyAlgoRSASHA256, KeyAlgoRSASHA512, KeyAlgoRSA, + KeyAlgoDSA, +} + +var supportedPubKeyAuthAlgosList = strings.Join(supportedPubKeyAuthAlgos, ",") + // unexpectedMessageError results when the SSH message that we received didn't // match what we wanted. func unexpectedMessageError(expected, got uint8) error { @@ -153,7 +177,7 @@ func (a *directionAlgorithms) rekeyBytes() int64 { // 2^(BLOCKSIZE/4) blocks. For all AES flavors BLOCKSIZE is // 128. switch a.Cipher { - case "aes128-ctr", "aes192-ctr", "aes256-ctr", gcmCipherID, aes128cbcID: + case "aes128-ctr", "aes192-ctr", "aes256-ctr", gcm128CipherID, gcm256CipherID, aes128cbcID: return 16 * (1 << 32) } @@ -163,7 +187,8 @@ func (a *directionAlgorithms) rekeyBytes() int64 { } var aeadCiphers = map[string]bool{ - gcmCipherID: true, + gcm128CipherID: true, + gcm256CipherID: true, chacha20Poly1305ID: true, } @@ -246,16 +271,16 @@ type Config struct { // unspecified, a size suitable for the chosen cipher is used. RekeyThreshold uint64 - // The allowed key exchanges algorithms. If unspecified then a - // default set of algorithms is used. + // The allowed key exchanges algorithms. If unspecified then a default set + // of algorithms is used. Unsupported values are silently ignored. KeyExchanges []string - // The allowed cipher algorithms. If unspecified then a sensible - // default is used. + // The allowed cipher algorithms. If unspecified then a sensible default is + // used. Unsupported values are silently ignored. Ciphers []string - // The allowed MAC algorithms. If unspecified then a sensible default - // is used. + // The allowed MAC algorithms. If unspecified then a sensible default is + // used. Unsupported values are silently ignored. MACs []string } @@ -272,7 +297,7 @@ func (c *Config) SetDefaults() { var ciphers []string for _, c := range c.Ciphers { if cipherModes[c] != nil { - // reject the cipher if we have no cipherModes definition + // Ignore the cipher if we have no cipherModes definition. ciphers = append(ciphers, c) } } @@ -281,10 +306,26 @@ func (c *Config) SetDefaults() { if c.KeyExchanges == nil { c.KeyExchanges = preferredKexAlgos } + var kexs []string + for _, k := range c.KeyExchanges { + if kexAlgoMap[k] != nil { + // Ignore the KEX if we have no kexAlgoMap definition. + kexs = append(kexs, k) + } + } + c.KeyExchanges = kexs if c.MACs == nil { c.MACs = supportedMACs } + var macs []string + for _, m := range c.MACs { + if macModes[m] != nil { + // Ignore the MAC if we have no macModes definition. + macs = append(macs, m) + } + } + c.MACs = macs if c.RekeyThreshold == 0 { // cipher specific default diff --git a/vendor/golang.org/x/crypto/ssh/connection.go b/vendor/golang.org/x/crypto/ssh/connection.go index 35661a52be..8f345ee924 100644 --- a/vendor/golang.org/x/crypto/ssh/connection.go +++ b/vendor/golang.org/x/crypto/ssh/connection.go @@ -97,7 +97,7 @@ func (c *connection) Close() error { return c.sshConn.conn.Close() } -// sshconn provides net.Conn metadata, but disallows direct reads and +// sshConn provides net.Conn metadata, but disallows direct reads and // writes. type sshConn struct { conn net.Conn diff --git a/vendor/golang.org/x/crypto/ssh/handshake.go b/vendor/golang.org/x/crypto/ssh/handshake.go index 653dc4d2cf..07a1843e0a 100644 --- a/vendor/golang.org/x/crypto/ssh/handshake.go +++ b/vendor/golang.org/x/crypto/ssh/handshake.go @@ -58,11 +58,13 @@ type handshakeTransport struct { incoming chan []byte readError error - mu sync.Mutex - writeError error - sentInitPacket []byte - sentInitMsg *kexInitMsg - pendingPackets [][]byte // Used when a key exchange is in progress. + mu sync.Mutex + writeError error + sentInitPacket []byte + sentInitMsg *kexInitMsg + pendingPackets [][]byte // Used when a key exchange is in progress. + writePacketsLeft uint32 + writeBytesLeft int64 // If the read loop wants to schedule a kex, it pings this // channel, and the write loop will send out a kex @@ -71,7 +73,8 @@ type handshakeTransport struct { // If the other side requests or confirms a kex, its kexInit // packet is sent here for the write loop to find it. - startKex chan *pendingKex + startKex chan *pendingKex + kexLoopDone chan struct{} // closed (with writeError non-nil) when kexLoop exits // data for host key checking hostKeyCallback HostKeyCallback @@ -86,12 +89,10 @@ type handshakeTransport struct { // Algorithms agreed in the last key exchange. algorithms *algorithms + // Counters exclusively owned by readLoop. readPacketsLeft uint32 readBytesLeft int64 - writePacketsLeft uint32 - writeBytesLeft int64 - // The session ID or nil if first kex did not complete yet. sessionID []byte } @@ -108,7 +109,8 @@ func newHandshakeTransport(conn keyingTransport, config *Config, clientVersion, clientVersion: clientVersion, incoming: make(chan []byte, chanSize), requestKex: make(chan struct{}, 1), - startKex: make(chan *pendingKex, 1), + startKex: make(chan *pendingKex), + kexLoopDone: make(chan struct{}), config: config, } @@ -340,16 +342,17 @@ write: t.mu.Unlock() } + // Unblock reader. + t.conn.Close() + // drain startKex channel. We don't service t.requestKex // because nobody does blocking sends there. - go func() { - for init := range t.startKex { - init.done <- t.writeError - } - }() + for request := range t.startKex { + request.done <- t.getWriteError() + } - // Unblock reader. - t.conn.Close() + // Mark that the loop is done so that Close can return. + close(t.kexLoopDone) } // The protocol uses uint32 for packet counters, so we can't let them @@ -545,7 +548,16 @@ func (t *handshakeTransport) writePacket(p []byte) error { } func (t *handshakeTransport) Close() error { - return t.conn.Close() + // Close the connection. This should cause the readLoop goroutine to wake up + // and close t.startKex, which will shut down kexLoop if running. + err := t.conn.Close() + + // Wait for the kexLoop goroutine to complete. + // At that point we know that the readLoop goroutine is complete too, + // because kexLoop itself waits for readLoop to close the startKex channel. + <-t.kexLoopDone + + return err } func (t *handshakeTransport) enterKeyExchange(otherInitPacket []byte) error { @@ -615,7 +627,8 @@ func (t *handshakeTransport) enterKeyExchange(otherInitPacket []byte) error { return err } - if t.sessionID == nil { + firstKeyExchange := t.sessionID == nil + if firstKeyExchange { t.sessionID = result.H } result.SessionID = t.sessionID @@ -626,6 +639,24 @@ func (t *handshakeTransport) enterKeyExchange(otherInitPacket []byte) error { if err = t.conn.writePacket([]byte{msgNewKeys}); err != nil { return err } + + // On the server side, after the first SSH_MSG_NEWKEYS, send a SSH_MSG_EXT_INFO + // message with the server-sig-algs extension if the client supports it. See + // RFC 8308, Sections 2.4 and 3.1. + if !isClient && firstKeyExchange && contains(clientInit.KexAlgos, "ext-info-c") { + extInfo := &extInfoMsg{ + NumExtensions: 1, + Payload: make([]byte, 0, 4+15+4+len(supportedPubKeyAuthAlgosList)), + } + extInfo.Payload = appendInt(extInfo.Payload, len("server-sig-algs")) + extInfo.Payload = append(extInfo.Payload, "server-sig-algs"...) + extInfo.Payload = appendInt(extInfo.Payload, len(supportedPubKeyAuthAlgosList)) + extInfo.Payload = append(extInfo.Payload, supportedPubKeyAuthAlgosList...) + if err := t.conn.writePacket(Marshal(extInfo)); err != nil { + return err + } + } + if packet, err := t.conn.readPacket(); err != nil { return err } else if packet[0] != msgNewKeys { diff --git a/vendor/golang.org/x/crypto/ssh/kex.go b/vendor/golang.org/x/crypto/ssh/kex.go index 927a90cd46..8a05f79902 100644 --- a/vendor/golang.org/x/crypto/ssh/kex.go +++ b/vendor/golang.org/x/crypto/ssh/kex.go @@ -23,6 +23,7 @@ const ( kexAlgoDH1SHA1 = "diffie-hellman-group1-sha1" kexAlgoDH14SHA1 = "diffie-hellman-group14-sha1" kexAlgoDH14SHA256 = "diffie-hellman-group14-sha256" + kexAlgoDH16SHA512 = "diffie-hellman-group16-sha512" kexAlgoECDH256 = "ecdh-sha2-nistp256" kexAlgoECDH384 = "ecdh-sha2-nistp384" kexAlgoECDH521 = "ecdh-sha2-nistp521" @@ -430,6 +431,17 @@ func init() { hashFunc: crypto.SHA256, } + // This is the group called diffie-hellman-group16-sha512 in RFC + // 8268 and Oakley Group 16 in RFC 3526. + p, _ = new(big.Int).SetString("FFFFFFFFFFFFFFFFC90FDAA22168C234C4C6628B80DC1CD129024E088A67CC74020BBEA63B139B22514A08798E3404DDEF9519B3CD3A431B302B0A6DF25F14374FE1356D6D51C245E485B576625E7EC6F44C42E9A637ED6B0BFF5CB6F406B7EDEE386BFB5A899FA5AE9F24117C4B1FE649286651ECE45B3DC2007CB8A163BF0598DA48361C55D39A69163FA8FD24CF5F83655D23DCA3AD961C62F356208552BB9ED529077096966D670C354E4ABC9804F1746C08CA18217C32905E462E36CE3BE39E772C180E86039B2783A2EC07A28FB5C55DF06F4C52C9DE2BCBF6955817183995497CEA956AE515D2261898FA051015728E5A8AAAC42DAD33170D04507A33A85521ABDF1CBA64ECFB850458DBEF0A8AEA71575D060C7DB3970F85A6E1E4C7ABF5AE8CDB0933D71E8C94E04A25619DCEE3D2261AD2EE6BF12FFA06D98A0864D87602733EC86A64521F2B18177B200CBBE117577A615D6C770988C0BAD946E208E24FA074E5AB3143DB5BFCE0FD108E4B82D120A92108011A723C12A787E6D788719A10BDBA5B2699C327186AF4E23C1A946834B6150BDA2583E9CA2AD44CE8DBBBC2DB04DE8EF92E8EFC141FBECAA6287C59474E6BC05D99B2964FA090C3A2233BA186515BE7ED1F612970CEE2D7AFB81BDD762170481CD0069127D5B05AA993B4EA988D8FDDC186FFB7DC90A6C08F4DF435C934063199FFFFFFFFFFFFFFFF", 16) + + kexAlgoMap[kexAlgoDH16SHA512] = &dhGroup{ + g: new(big.Int).SetInt64(2), + p: p, + pMinus1: new(big.Int).Sub(p, bigOne), + hashFunc: crypto.SHA512, + } + kexAlgoMap[kexAlgoECDH521] = &ecdh{elliptic.P521()} kexAlgoMap[kexAlgoECDH384] = &ecdh{elliptic.P384()} kexAlgoMap[kexAlgoECDH256] = &ecdh{elliptic.P256()} diff --git a/vendor/golang.org/x/crypto/ssh/keys.go b/vendor/golang.org/x/crypto/ssh/keys.go index 7296980413..dac8ee7244 100644 --- a/vendor/golang.org/x/crypto/ssh/keys.go +++ b/vendor/golang.org/x/crypto/ssh/keys.go @@ -1087,9 +1087,9 @@ func (*PassphraseMissingError) Error() string { return "ssh: this private key is passphrase protected" } -// ParseRawPrivateKey returns a private key from a PEM encoded private key. It -// supports RSA (PKCS#1), PKCS#8, DSA (OpenSSL), and ECDSA private keys. If the -// private key is encrypted, it will return a PassphraseMissingError. +// ParseRawPrivateKey returns a private key from a PEM encoded private key. It supports +// RSA, DSA, ECDSA, and Ed25519 private keys in PKCS#1, PKCS#8, OpenSSL, and OpenSSH +// formats. If the private key is encrypted, it will return a PassphraseMissingError. func ParseRawPrivateKey(pemBytes []byte) (interface{}, error) { block, _ := pem.Decode(pemBytes) if block == nil { diff --git a/vendor/golang.org/x/crypto/ssh/mac.go b/vendor/golang.org/x/crypto/ssh/mac.go index c07a06285e..06a1b27507 100644 --- a/vendor/golang.org/x/crypto/ssh/mac.go +++ b/vendor/golang.org/x/crypto/ssh/mac.go @@ -10,6 +10,7 @@ import ( "crypto/hmac" "crypto/sha1" "crypto/sha256" + "crypto/sha512" "hash" ) @@ -46,9 +47,15 @@ func (t truncatingMAC) Size() int { func (t truncatingMAC) BlockSize() int { return t.hmac.BlockSize() } var macModes = map[string]*macMode{ + "hmac-sha2-512-etm@openssh.com": {64, true, func(key []byte) hash.Hash { + return hmac.New(sha512.New, key) + }}, "hmac-sha2-256-etm@openssh.com": {32, true, func(key []byte) hash.Hash { return hmac.New(sha256.New, key) }}, + "hmac-sha2-512": {64, false, func(key []byte) hash.Hash { + return hmac.New(sha512.New, key) + }}, "hmac-sha2-256": {32, false, func(key []byte) hash.Hash { return hmac.New(sha256.New, key) }}, diff --git a/vendor/golang.org/x/crypto/ssh/messages.go b/vendor/golang.org/x/crypto/ssh/messages.go index 19bc67c464..922032d952 100644 --- a/vendor/golang.org/x/crypto/ssh/messages.go +++ b/vendor/golang.org/x/crypto/ssh/messages.go @@ -68,7 +68,7 @@ type kexInitMsg struct { // See RFC 4253, section 8. -// Diffie-Helman +// Diffie-Hellman const msgKexDHInit = 30 type kexDHInitMsg struct { diff --git a/vendor/golang.org/x/crypto/ssh/server.go b/vendor/golang.org/x/crypto/ssh/server.go index 2260b20afc..b21322affa 100644 --- a/vendor/golang.org/x/crypto/ssh/server.go +++ b/vendor/golang.org/x/crypto/ssh/server.go @@ -291,15 +291,6 @@ func (s *connection) serverHandshake(config *ServerConfig) (*Permissions, error) return perms, err } -func isAcceptableAlgo(algo string) bool { - switch algo { - case KeyAlgoRSA, KeyAlgoRSASHA256, KeyAlgoRSASHA512, KeyAlgoDSA, KeyAlgoECDSA256, KeyAlgoECDSA384, KeyAlgoECDSA521, KeyAlgoSKECDSA256, KeyAlgoED25519, KeyAlgoSKED25519, - CertAlgoRSAv01, CertAlgoDSAv01, CertAlgoECDSA256v01, CertAlgoECDSA384v01, CertAlgoECDSA521v01, CertAlgoSKECDSA256v01, CertAlgoED25519v01, CertAlgoSKED25519v01: - return true - } - return false -} - func checkSourceAddress(addr net.Addr, sourceAddrs string) error { if addr == nil { return errors.New("ssh: no address known for client, but source-address match required") @@ -379,6 +370,25 @@ func gssExchangeToken(gssapiConfig *GSSAPIWithMICConfig, firstToken []byte, s *c return authErr, perms, nil } +// isAlgoCompatible checks if the signature format is compatible with the +// selected algorithm taking into account edge cases that occur with old +// clients. +func isAlgoCompatible(algo, sigFormat string) bool { + // Compatibility for old clients. + // + // For certificate authentication with OpenSSH 7.2-7.7 signature format can + // be rsa-sha2-256 or rsa-sha2-512 for the algorithm + // ssh-rsa-cert-v01@openssh.com. + // + // With gpg-agent < 2.2.6 the algorithm can be rsa-sha2-256 or rsa-sha2-512 + // for signature format ssh-rsa. + if isRSA(algo) && isRSA(sigFormat) { + return true + } + // Standard case: the underlying algorithm must match the signature format. + return underlyingAlgo(algo) == sigFormat +} + // ServerAuthError represents server authentication errors and is // sometimes returned by NewServerConn. It appends any authentication // errors that may occur, and is returned if all of the authentication @@ -514,7 +524,7 @@ userAuthLoop: return nil, parseError(msgUserAuthRequest) } algo := string(algoBytes) - if !isAcceptableAlgo(algo) { + if !contains(supportedPubKeyAuthAlgos, underlyingAlgo(algo)) { authErr = fmt.Errorf("ssh: algorithm %q not accepted", algo) break } @@ -572,11 +582,11 @@ userAuthLoop: // algorithm name that corresponds to algo with // sig.Format. This is usually the same, but // for certs, the names differ. - if !isAcceptableAlgo(sig.Format) { + if !contains(supportedPubKeyAuthAlgos, sig.Format) { authErr = fmt.Errorf("ssh: algorithm %q not accepted", sig.Format) break } - if underlyingAlgo(algo) != sig.Format { + if !isAlgoCompatible(algo, sig.Format) { authErr = fmt.Errorf("ssh: signature %q not compatible with selected algorithm %q", sig.Format, algo) break } diff --git a/vendor/golang.org/x/crypto/ssh/transport.go b/vendor/golang.org/x/crypto/ssh/transport.go index acf5a21bbb..da015801ea 100644 --- a/vendor/golang.org/x/crypto/ssh/transport.go +++ b/vendor/golang.org/x/crypto/ssh/transport.go @@ -17,7 +17,8 @@ import ( const debugTransport = false const ( - gcmCipherID = "aes128-gcm@openssh.com" + gcm128CipherID = "aes128-gcm@openssh.com" + gcm256CipherID = "aes256-gcm@openssh.com" aes128cbcID = "aes128-cbc" tripledescbcID = "3des-cbc" ) diff --git a/vendor/golang.org/x/mod/semver/semver.go b/vendor/golang.org/x/mod/semver/semver.go index a30a22bf20..9a2dfd33a7 100644 --- a/vendor/golang.org/x/mod/semver/semver.go +++ b/vendor/golang.org/x/mod/semver/semver.go @@ -140,7 +140,7 @@ func Compare(v, w string) int { // Max canonicalizes its arguments and then returns the version string // that compares greater. // -// Deprecated: use Compare instead. In most cases, returning a canonicalized +// Deprecated: use [Compare] instead. In most cases, returning a canonicalized // version is not expected or desired. func Max(v, w string) string { v = Canonical(v) @@ -151,7 +151,7 @@ func Max(v, w string) string { return w } -// ByVersion implements sort.Interface for sorting semantic version strings. +// ByVersion implements [sort.Interface] for sorting semantic version strings. type ByVersion []string func (vs ByVersion) Len() int { return len(vs) } @@ -164,7 +164,7 @@ func (vs ByVersion) Less(i, j int) bool { return vs[i] < vs[j] } -// Sort sorts a list of semantic version strings using ByVersion. +// Sort sorts a list of semantic version strings using [ByVersion]. func Sort(list []string) { sort.Sort(ByVersion(list)) } diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go index 7a96eae331..2466ae3d9a 100644 --- a/vendor/golang.org/x/net/html/doc.go +++ b/vendor/golang.org/x/net/html/doc.go @@ -99,14 +99,20 @@ Care should be taken when parsing and interpreting HTML, whether full documents or fragments, within the framework of the HTML specification, especially with regard to untrusted inputs. -This package provides both a tokenizer and a parser. Only the parser constructs -a DOM according to the HTML specification, resolving malformed and misplaced -tags where appropriate. The tokenizer simply tokenizes the HTML presented to it, -and as such does not resolve issues that may exist in the processed HTML, -producing a literal interpretation of the input. - -If your use case requires semantically well-formed HTML, as defined by the -WHATWG specifiction, the parser should be used rather than the tokenizer. +This package provides both a tokenizer and a parser, which implement the +tokenization, and tokenization and tree construction stages of the WHATWG HTML +parsing specification respectively. While the tokenizer parses and normalizes +individual HTML tokens, only the parser constructs the DOM tree from the +tokenized HTML, as described in the tree construction stage of the +specification, dynamically modifying or extending the docuemnt's DOM tree. + +If your use case requires semantically well-formed HTML documents, as defined by +the WHATWG specification, the parser should be used rather than the tokenizer. + +In security contexts, if trust decisions are being made using the tokenized or +parsed content, the input must be re-serialized (for instance by using Render or +Token.String) in order for those trust decisions to hold, as the process of +tokenization or parsing may alter the content. */ package html // import "golang.org/x/net/html" diff --git a/vendor/golang.org/x/net/html/render.go b/vendor/golang.org/x/net/html/render.go index 8b28031905..e8c1233455 100644 --- a/vendor/golang.org/x/net/html/render.go +++ b/vendor/golang.org/x/net/html/render.go @@ -194,9 +194,8 @@ func render1(w writer, n *Node) error { } } - // Render any child nodes. - switch n.Data { - case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + // Render any child nodes + if childTextNodesAreLiteral(n) { for c := n.FirstChild; c != nil; c = c.NextSibling { if c.Type == TextNode { if _, err := w.WriteString(c.Data); err != nil { @@ -213,7 +212,7 @@ func render1(w writer, n *Node) error { // last element in the file, with no closing tag. return plaintextAbort } - default: + } else { for c := n.FirstChild; c != nil; c = c.NextSibling { if err := render1(w, c); err != nil { return err @@ -231,6 +230,27 @@ func render1(w writer, n *Node) error { return w.WriteByte('>') } +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + // writeQuoted writes s to w surrounded by quotes. Normally it will use double // quotes, but if s contains a double quote, it will use single quotes. // It is used for writing the identifiers in a doctype declaration. diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go index 5c2a1f4efa..de67f938a1 100644 --- a/vendor/golang.org/x/net/html/token.go +++ b/vendor/golang.org/x/net/html/token.go @@ -913,7 +913,14 @@ func (z *Tokenizer) readTagAttrKey() { case ' ', '\n', '\r', '\t', '\f', '/': z.pendingAttr[0].end = z.raw.end - 1 return - case '=', '>': + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case '>': z.raw.end-- z.pendingAttr[0].end = z.raw.end return diff --git a/vendor/golang.org/x/net/http2/pipe.go b/vendor/golang.org/x/net/http2/pipe.go index c15b8a7719..684d984fd9 100644 --- a/vendor/golang.org/x/net/http2/pipe.go +++ b/vendor/golang.org/x/net/http2/pipe.go @@ -88,13 +88,9 @@ func (p *pipe) Write(d []byte) (n int, err error) { p.c.L = &p.mu } defer p.c.Signal() - if p.err != nil { + if p.err != nil || p.breakErr != nil { return 0, errClosedPipeWrite } - if p.breakErr != nil { - p.unread += len(d) - return len(d), nil // discard when there is no reader - } return p.b.Write(d) } diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index 8cb14f3c97..033b6e6db6 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -441,7 +441,7 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { if s.NewWriteScheduler != nil { sc.writeSched = s.NewWriteScheduler() } else { - sc.writeSched = NewPriorityWriteScheduler(nil) + sc.writeSched = newRoundRobinWriteScheduler() } // These start at the RFC-specified defaults. If there is a higher @@ -1822,15 +1822,18 @@ func (sc *serverConn) processData(f *DataFrame) error { } if len(data) > 0 { + st.bodyBytes += int64(len(data)) wrote, err := st.body.Write(data) if err != nil { + // The handler has closed the request body. + // Return the connection-level flow control for the discarded data, + // but not the stream-level flow control. sc.sendWindowUpdate(nil, int(f.Length)-wrote) - return sc.countError("body_write_err", streamError(id, ErrCodeStreamClosed)) + return nil } if wrote != len(data) { panic("internal error: bad Writer") } - st.bodyBytes += int64(len(data)) } // Return any padded flow control now, since we won't @@ -2426,7 +2429,7 @@ type requestBody struct { conn *serverConn closeOnce sync.Once // for use by Close only sawEOF bool // for use by Read only - pipe *pipe // non-nil if we have a HTTP entity message body + pipe *pipe // non-nil if we have an HTTP entity message body needsContinue bool // need to send a 100-continue } @@ -2566,7 +2569,8 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { clen = "" } } - if clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { + _, hasContentLength := rws.snapHeader["Content-Length"] + if !hasContentLength && clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { clen = strconv.Itoa(len(p)) } _, hasContentType := rws.snapHeader["Content-Type"] @@ -2771,7 +2775,7 @@ func (w *responseWriter) FlushError() error { err = rws.bw.Flush() } else { // The bufio.Writer won't call chunkWriter.Write - // (writeChunk with zero bytes, so we have to do it + // (writeChunk with zero bytes), so we have to do it // ourselves to force the HTTP response header and/or // final DATA frame (with END_STREAM) to be sent. _, err = chunkWriter{rws}.Write(nil) diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index 05ba23d3d9..b0d482f9f4 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -19,6 +19,7 @@ import ( "io/fs" "log" "math" + "math/bits" mathrand "math/rand" "net" "net/http" @@ -518,11 +519,14 @@ func (t *Transport) RoundTrip(req *http.Request) (*http.Response, error) { func authorityAddr(scheme string, authority string) (addr string) { host, port, err := net.SplitHostPort(authority) if err != nil { // authority didn't have a port + host = authority + port = "" + } + if port == "" { // authority's port was empty port = "443" if scheme == "http" { port = "80" } - host = authority } if a, err := idna.ToASCII(host); err == nil { host = a @@ -560,10 +564,11 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res traceGotConn(req, cc, reused) res, err := cc.RoundTrip(req) if err != nil && retry <= 6 { + roundTripErr := err if req, err = shouldRetryRequest(req, err); err == nil { // After the first retry, do exponential backoff with 10% jitter. if retry == 0 { - t.vlogf("RoundTrip retrying after failure: %v", err) + t.vlogf("RoundTrip retrying after failure: %v", roundTripErr) continue } backoff := float64(uint(1) << (uint(retry) - 1)) @@ -572,7 +577,7 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res timer := backoffNewTimer(d) select { case <-timer.C: - t.vlogf("RoundTrip retrying after failure: %v", err) + t.vlogf("RoundTrip retrying after failure: %v", roundTripErr) continue case <-req.Context().Done(): timer.Stop() @@ -1265,6 +1270,29 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { return res, nil } + cancelRequest := func(cs *clientStream, err error) error { + cs.cc.mu.Lock() + bodyClosed := cs.reqBodyClosed + cs.cc.mu.Unlock() + // Wait for the request body to be closed. + // + // If nothing closed the body before now, abortStreamLocked + // will have started a goroutine to close it. + // + // Closing the body before returning avoids a race condition + // with net/http checking its readTrackingBody to see if the + // body was read from or closed. See golang/go#60041. + // + // The body is closed in a separate goroutine without the + // connection mutex held, but dropping the mutex before waiting + // will keep us from holding it indefinitely if the body + // close is slow for some reason. + if bodyClosed != nil { + <-bodyClosed + } + return err + } + for { select { case <-cs.respHeaderRecv: @@ -1284,10 +1312,10 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { case <-ctx.Done(): err := ctx.Err() cs.abortStream(err) - return nil, err + return nil, cancelRequest(cs, err) case <-cs.reqCancel: cs.abortStream(errRequestCanceled) - return nil, errRequestCanceled + return nil, cancelRequest(cs, errRequestCanceled) } } } @@ -1653,7 +1681,27 @@ func (cs *clientStream) frameScratchBufferLen(maxFrameSize int) int { return int(n) // doesn't truncate; max is 512K } -var bufPool sync.Pool // of *[]byte +// Seven bufPools manage different frame sizes. This helps to avoid scenarios where long-running +// streaming requests using small frame sizes occupy large buffers initially allocated for prior +// requests needing big buffers. The size ranges are as follows: +// {0 KB, 16 KB], {16 KB, 32 KB], {32 KB, 64 KB], {64 KB, 128 KB], {128 KB, 256 KB], +// {256 KB, 512 KB], {512 KB, infinity} +// In practice, the maximum scratch buffer size should not exceed 512 KB due to +// frameScratchBufferLen(maxFrameSize), thus the "infinity pool" should never be used. +// It exists mainly as a safety measure, for potential future increases in max buffer size. +var bufPools [7]sync.Pool // of *[]byte +func bufPoolIndex(size int) int { + if size <= 16384 { + return 0 + } + size -= 1 + bits := bits.Len(uint(size)) + index := bits - 14 + if index >= len(bufPools) { + return len(bufPools) - 1 + } + return index +} func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { cc := cs.cc @@ -1671,12 +1719,13 @@ func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { // Scratch buffer for reading into & writing from. scratchLen := cs.frameScratchBufferLen(maxFrameSize) var buf []byte - if bp, ok := bufPool.Get().(*[]byte); ok && len(*bp) >= scratchLen { - defer bufPool.Put(bp) + index := bufPoolIndex(scratchLen) + if bp, ok := bufPools[index].Get().(*[]byte); ok && len(*bp) >= scratchLen { + defer bufPools[index].Put(bp) buf = *bp } else { buf = make([]byte, scratchLen) - defer bufPool.Put(&buf) + defer bufPools[index].Put(&buf) } var sawEOF bool @@ -1844,6 +1893,9 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail if err != nil { return nil, err } + if !httpguts.ValidHostHeader(host) { + return nil, errors.New("http2: invalid Host header") + } var path string if req.Method != "CONNECT" { @@ -1880,7 +1932,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail // 8.1.2.3 Request Pseudo-Header Fields // The :path pseudo-header field includes the path and query parts of the // target URI (the path-absolute production and optionally a '?' character - // followed by the query production (see Sections 3.3 and 3.4 of + // followed by the query production, see Sections 3.3 and 3.4 of // [RFC3986]). f(":authority", host) m := req.Method @@ -2555,6 +2607,9 @@ func (b transportResponseBody) Close() error { cs := b.cs cc := cs.cc + cs.bufPipe.BreakWithError(errClosedResponseBody) + cs.abortStream(errClosedResponseBody) + unread := cs.bufPipe.Len() if unread > 0 { cc.mu.Lock() @@ -2573,9 +2628,6 @@ func (b transportResponseBody) Close() error { cc.wmu.Unlock() } - cs.bufPipe.BreakWithError(errClosedResponseBody) - cs.abortStream(errClosedResponseBody) - select { case <-cs.donec: case <-cs.ctx.Done(): diff --git a/vendor/golang.org/x/net/http2/writesched.go b/vendor/golang.org/x/net/http2/writesched.go index c7cd001739..cc893adc29 100644 --- a/vendor/golang.org/x/net/http2/writesched.go +++ b/vendor/golang.org/x/net/http2/writesched.go @@ -184,7 +184,8 @@ func (wr *FrameWriteRequest) replyToWriter(err error) { // writeQueue is used by implementations of WriteScheduler. type writeQueue struct { - s []FrameWriteRequest + s []FrameWriteRequest + prev, next *writeQueue } func (q *writeQueue) empty() bool { return len(q.s) == 0 } diff --git a/vendor/golang.org/x/net/http2/writesched_roundrobin.go b/vendor/golang.org/x/net/http2/writesched_roundrobin.go new file mode 100644 index 0000000000..54fe86322d --- /dev/null +++ b/vendor/golang.org/x/net/http2/writesched_roundrobin.go @@ -0,0 +1,119 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +import ( + "fmt" + "math" +) + +type roundRobinWriteScheduler struct { + // control contains control frames (SETTINGS, PING, etc.). + control writeQueue + + // streams maps stream ID to a queue. + streams map[uint32]*writeQueue + + // stream queues are stored in a circular linked list. + // head is the next stream to write, or nil if there are no streams open. + head *writeQueue + + // pool of empty queues for reuse. + queuePool writeQueuePool +} + +// newRoundRobinWriteScheduler constructs a new write scheduler. +// The round robin scheduler priorizes control frames +// like SETTINGS and PING over DATA frames. +// When there are no control frames to send, it performs a round-robin +// selection from the ready streams. +func newRoundRobinWriteScheduler() WriteScheduler { + ws := &roundRobinWriteScheduler{ + streams: make(map[uint32]*writeQueue), + } + return ws +} + +func (ws *roundRobinWriteScheduler) OpenStream(streamID uint32, options OpenStreamOptions) { + if ws.streams[streamID] != nil { + panic(fmt.Errorf("stream %d already opened", streamID)) + } + q := ws.queuePool.get() + ws.streams[streamID] = q + if ws.head == nil { + ws.head = q + q.next = q + q.prev = q + } else { + // Queues are stored in a ring. + // Insert the new stream before ws.head, putting it at the end of the list. + q.prev = ws.head.prev + q.next = ws.head + q.prev.next = q + q.next.prev = q + } +} + +func (ws *roundRobinWriteScheduler) CloseStream(streamID uint32) { + q := ws.streams[streamID] + if q == nil { + return + } + if q.next == q { + // This was the only open stream. + ws.head = nil + } else { + q.prev.next = q.next + q.next.prev = q.prev + if ws.head == q { + ws.head = q.next + } + } + delete(ws.streams, streamID) + ws.queuePool.put(q) +} + +func (ws *roundRobinWriteScheduler) AdjustStream(streamID uint32, priority PriorityParam) {} + +func (ws *roundRobinWriteScheduler) Push(wr FrameWriteRequest) { + if wr.isControl() { + ws.control.push(wr) + return + } + q := ws.streams[wr.StreamID()] + if q == nil { + // This is a closed stream. + // wr should not be a HEADERS or DATA frame. + // We push the request onto the control queue. + if wr.DataSize() > 0 { + panic("add DATA on non-open stream") + } + ws.control.push(wr) + return + } + q.push(wr) +} + +func (ws *roundRobinWriteScheduler) Pop() (FrameWriteRequest, bool) { + // Control and RST_STREAM frames first. + if !ws.control.empty() { + return ws.control.shift(), true + } + if ws.head == nil { + return FrameWriteRequest{}, false + } + q := ws.head + for { + if wr, ok := q.consume(math.MaxInt32); ok { + ws.head = q.next + return wr, true + } + q = q.next + if q == ws.head { + break + } + } + return FrameWriteRequest{}, false +} diff --git a/vendor/golang.org/x/net/idna/idna9.0.0.go b/vendor/golang.org/x/net/idna/idna9.0.0.go index aae6aac872..ee1698cefb 100644 --- a/vendor/golang.org/x/net/idna/idna9.0.0.go +++ b/vendor/golang.org/x/net/idna/idna9.0.0.go @@ -121,7 +121,7 @@ func CheckJoiners(enable bool) Option { } } -// StrictDomainName limits the set of permissable ASCII characters to those +// StrictDomainName limits the set of permissible ASCII characters to those // allowed in domain names as defined in RFC 1034 (A-Z, a-z, 0-9 and the // hyphen). This is set by default for MapForLookup and ValidateForRegistration, // but is only useful if ValidateLabels is set. diff --git a/vendor/golang.org/x/net/idna/tables13.0.0.go b/vendor/golang.org/x/net/idna/tables13.0.0.go index 390c5e56d2..66701eadfb 100644 --- a/vendor/golang.org/x/net/idna/tables13.0.0.go +++ b/vendor/golang.org/x/net/idna/tables13.0.0.go @@ -1,151 +1,294 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package idna // UnicodeVersion is the Unicode version from which the tables in this package are derived. const UnicodeVersion = "13.0.0" -var mappings string = "" + // Size: 8188 bytes - "\x00\x01 \x03 ̈\x01a\x03 ̄\x012\x013\x03 ́\x03 ̧\x011\x01o\x051⁄4\x051⁄2" + - "\x053⁄4\x03i̇\x03l·\x03ʼn\x01s\x03dž\x03ⱥ\x03ⱦ\x01h\x01j\x01r\x01w\x01y" + - "\x03 ̆\x03 ̇\x03 ̊\x03 ̨\x03 ̃\x03 ̋\x01l\x01x\x04̈́\x03 ι\x01;\x05 ̈́" + - "\x04եւ\x04اٴ\x04وٴ\x04ۇٴ\x04يٴ\x06क़\x06ख़\x06ग़\x06ज़\x06ड़\x06ढ़\x06फ़" + - "\x06य़\x06ড়\x06ঢ়\x06য়\x06ਲ਼\x06ਸ਼\x06ਖ਼\x06ਗ਼\x06ਜ਼\x06ਫ਼\x06ଡ଼\x06ଢ଼" + - "\x06ํา\x06ໍາ\x06ຫນ\x06ຫມ\x06གྷ\x06ཌྷ\x06དྷ\x06བྷ\x06ཛྷ\x06ཀྵ\x06ཱི\x06ཱུ" + - "\x06ྲྀ\x09ྲཱྀ\x06ླྀ\x09ླཱྀ\x06ཱྀ\x06ྒྷ\x06ྜྷ\x06ྡྷ\x06ྦྷ\x06ྫྷ\x06ྐྵ\x02" + - "в\x02д\x02о\x02с\x02т\x02ъ\x02ѣ\x02æ\x01b\x01d\x01e\x02ǝ\x01g\x01i\x01k" + - "\x01m\x01n\x02ȣ\x01p\x01t\x01u\x02ɐ\x02ɑ\x02ə\x02ɛ\x02ɜ\x02ŋ\x02ɔ\x02ɯ" + - "\x01v\x02β\x02γ\x02δ\x02φ\x02χ\x02ρ\x02н\x02ɒ\x01c\x02ɕ\x02ð\x01f\x02ɟ" + - "\x02ɡ\x02ɥ\x02ɨ\x02ɩ\x02ɪ\x02ʝ\x02ɭ\x02ʟ\x02ɱ\x02ɰ\x02ɲ\x02ɳ\x02ɴ\x02ɵ" + - "\x02ɸ\x02ʂ\x02ʃ\x02ƫ\x02ʉ\x02ʊ\x02ʋ\x02ʌ\x01z\x02ʐ\x02ʑ\x02ʒ\x02θ\x02ss" + - "\x02ά\x02έ\x02ή\x02ί\x02ό\x02ύ\x02ώ\x05ἀι\x05ἁι\x05ἂι\x05ἃι\x05ἄι\x05ἅι" + - "\x05ἆι\x05ἇι\x05ἠι\x05ἡι\x05ἢι\x05ἣι\x05ἤι\x05ἥι\x05ἦι\x05ἧι\x05ὠι\x05ὡι" + - "\x05ὢι\x05ὣι\x05ὤι\x05ὥι\x05ὦι\x05ὧι\x05ὰι\x04αι\x04άι\x05ᾶι\x02ι\x05 ̈͂" + - "\x05ὴι\x04ηι\x04ήι\x05ῆι\x05 ̓̀\x05 ̓́\x05 ̓͂\x02ΐ\x05 ̔̀\x05 ̔́\x05 ̔͂" + - "\x02ΰ\x05 ̈̀\x01`\x05ὼι\x04ωι\x04ώι\x05ῶι\x06′′\x09′′′\x06‵‵\x09‵‵‵\x02!" + - "!\x02??\x02?!\x02!?\x0c′′′′\x010\x014\x015\x016\x017\x018\x019\x01+\x01=" + - "\x01(\x01)\x02rs\x02ħ\x02no\x01q\x02sm\x02tm\x02ω\x02å\x02א\x02ב\x02ג" + - "\x02ד\x02π\x051⁄7\x051⁄9\x061⁄10\x051⁄3\x052⁄3\x051⁄5\x052⁄5\x053⁄5\x054" + - "⁄5\x051⁄6\x055⁄6\x051⁄8\x053⁄8\x055⁄8\x057⁄8\x041⁄\x02ii\x02iv\x02vi" + - "\x04viii\x02ix\x02xi\x050⁄3\x06∫∫\x09∫∫∫\x06∮∮\x09∮∮∮\x0210\x0211\x0212" + - "\x0213\x0214\x0215\x0216\x0217\x0218\x0219\x0220\x04(10)\x04(11)\x04(12)" + - "\x04(13)\x04(14)\x04(15)\x04(16)\x04(17)\x04(18)\x04(19)\x04(20)\x0c∫∫∫∫" + - "\x02==\x05⫝̸\x02ɫ\x02ɽ\x02ȿ\x02ɀ\x01.\x04 ゙\x04 ゚\x06より\x06コト\x05(ᄀ)\x05" + - "(ᄂ)\x05(ᄃ)\x05(ᄅ)\x05(ᄆ)\x05(ᄇ)\x05(ᄉ)\x05(ᄋ)\x05(ᄌ)\x05(ᄎ)\x05(ᄏ)\x05(ᄐ" + - ")\x05(ᄑ)\x05(ᄒ)\x05(가)\x05(나)\x05(다)\x05(라)\x05(마)\x05(바)\x05(사)\x05(아)" + - "\x05(자)\x05(차)\x05(카)\x05(타)\x05(파)\x05(하)\x05(주)\x08(오전)\x08(오후)\x05(一)" + - "\x05(二)\x05(三)\x05(四)\x05(五)\x05(六)\x05(七)\x05(八)\x05(九)\x05(十)\x05(月)" + - "\x05(火)\x05(水)\x05(木)\x05(金)\x05(土)\x05(日)\x05(株)\x05(有)\x05(社)\x05(名)" + - "\x05(特)\x05(財)\x05(祝)\x05(労)\x05(代)\x05(呼)\x05(学)\x05(監)\x05(企)\x05(資)" + - "\x05(協)\x05(祭)\x05(休)\x05(自)\x05(至)\x0221\x0222\x0223\x0224\x0225\x0226" + - "\x0227\x0228\x0229\x0230\x0231\x0232\x0233\x0234\x0235\x06참고\x06주의\x0236" + - "\x0237\x0238\x0239\x0240\x0241\x0242\x0243\x0244\x0245\x0246\x0247\x0248" + - "\x0249\x0250\x041月\x042月\x043月\x044月\x045月\x046月\x047月\x048月\x049月\x0510" + - "月\x0511月\x0512月\x02hg\x02ev\x06令和\x0cアパート\x0cアルファ\x0cアンペア\x09アール\x0cイニ" + - "ング\x09インチ\x09ウォン\x0fエスクード\x0cエーカー\x09オンス\x09オーム\x09カイリ\x0cカラット\x0cカロリー" + - "\x09ガロン\x09ガンマ\x06ギガ\x09ギニー\x0cキュリー\x0cギルダー\x06キロ\x0fキログラム\x12キロメートル\x0f" + - "キロワット\x09グラム\x0fグラムトン\x0fクルゼイロ\x0cクローネ\x09ケース\x09コルナ\x09コーポ\x0cサイクル" + - "\x0fサンチーム\x0cシリング\x09センチ\x09セント\x09ダース\x06デシ\x06ドル\x06トン\x06ナノ\x09ノット" + - "\x09ハイツ\x0fパーセント\x09パーツ\x0cバーレル\x0fピアストル\x09ピクル\x06ピコ\x06ビル\x0fファラッド\x0c" + - "フィート\x0fブッシェル\x09フラン\x0fヘクタール\x06ペソ\x09ペニヒ\x09ヘルツ\x09ペンス\x09ページ\x09ベータ" + - "\x0cポイント\x09ボルト\x06ホン\x09ポンド\x09ホール\x09ホーン\x0cマイクロ\x09マイル\x09マッハ\x09マルク" + - "\x0fマンション\x0cミクロン\x06ミリ\x0fミリバール\x06メガ\x0cメガトン\x0cメートル\x09ヤード\x09ヤール\x09" + - "ユアン\x0cリットル\x06リラ\x09ルピー\x0cルーブル\x06レム\x0fレントゲン\x09ワット\x040点\x041点\x04" + - "2点\x043点\x044点\x045点\x046点\x047点\x048点\x049点\x0510点\x0511点\x0512点\x0513点" + - "\x0514点\x0515点\x0516点\x0517点\x0518点\x0519点\x0520点\x0521点\x0522点\x0523点" + - "\x0524点\x02da\x02au\x02ov\x02pc\x02dm\x02iu\x06平成\x06昭和\x06大正\x06明治\x0c株" + - "式会社\x02pa\x02na\x02ma\x02ka\x02kb\x02mb\x02gb\x04kcal\x02pf\x02nf\x02m" + - "g\x02kg\x02hz\x02ml\x02dl\x02kl\x02fm\x02nm\x02mm\x02cm\x02km\x02m2\x02m" + - "3\x05m∕s\x06m∕s2\x07rad∕s\x08rad∕s2\x02ps\x02ns\x02ms\x02pv\x02nv\x02mv" + - "\x02kv\x02pw\x02nw\x02mw\x02kw\x02bq\x02cc\x02cd\x06c∕kg\x02db\x02gy\x02" + - "ha\x02hp\x02in\x02kk\x02kt\x02lm\x02ln\x02lx\x02ph\x02pr\x02sr\x02sv\x02" + - "wb\x05v∕m\x05a∕m\x041日\x042日\x043日\x044日\x045日\x046日\x047日\x048日\x049日" + - "\x0510日\x0511日\x0512日\x0513日\x0514日\x0515日\x0516日\x0517日\x0518日\x0519日" + - "\x0520日\x0521日\x0522日\x0523日\x0524日\x0525日\x0526日\x0527日\x0528日\x0529日" + - "\x0530日\x0531日\x02ь\x02ɦ\x02ɬ\x02ʞ\x02ʇ\x02œ\x02ʍ\x04𤋮\x04𢡊\x04𢡄\x04𣏕" + - "\x04𥉉\x04𥳐\x04𧻓\x02ff\x02fi\x02fl\x02st\x04մն\x04մե\x04մի\x04վն\x04մխ" + - "\x04יִ\x04ײַ\x02ע\x02ה\x02כ\x02ל\x02ם\x02ר\x02ת\x04שׁ\x04שׂ\x06שּׁ\x06שּ" + - "ׂ\x04אַ\x04אָ\x04אּ\x04בּ\x04גּ\x04דּ\x04הּ\x04וּ\x04זּ\x04טּ\x04יּ\x04" + - "ךּ\x04כּ\x04לּ\x04מּ\x04נּ\x04סּ\x04ףּ\x04פּ\x04צּ\x04קּ\x04רּ\x04שּ" + - "\x04תּ\x04וֹ\x04בֿ\x04כֿ\x04פֿ\x04אל\x02ٱ\x02ٻ\x02پ\x02ڀ\x02ٺ\x02ٿ\x02ٹ" + - "\x02ڤ\x02ڦ\x02ڄ\x02ڃ\x02چ\x02ڇ\x02ڍ\x02ڌ\x02ڎ\x02ڈ\x02ژ\x02ڑ\x02ک\x02گ" + - "\x02ڳ\x02ڱ\x02ں\x02ڻ\x02ۀ\x02ہ\x02ھ\x02ے\x02ۓ\x02ڭ\x02ۇ\x02ۆ\x02ۈ\x02ۋ" + - "\x02ۅ\x02ۉ\x02ې\x02ى\x04ئا\x04ئە\x04ئو\x04ئۇ\x04ئۆ\x04ئۈ\x04ئې\x04ئى\x02" + - "ی\x04ئج\x04ئح\x04ئم\x04ئي\x04بج\x04بح\x04بخ\x04بم\x04بى\x04بي\x04تج\x04" + - "تح\x04تخ\x04تم\x04تى\x04تي\x04ثج\x04ثم\x04ثى\x04ثي\x04جح\x04جم\x04حج" + - "\x04حم\x04خج\x04خح\x04خم\x04سج\x04سح\x04سخ\x04سم\x04صح\x04صم\x04ضج\x04ضح" + - "\x04ضخ\x04ضم\x04طح\x04طم\x04ظم\x04عج\x04عم\x04غج\x04غم\x04فج\x04فح\x04فخ" + - "\x04فم\x04فى\x04في\x04قح\x04قم\x04قى\x04قي\x04كا\x04كج\x04كح\x04كخ\x04كل" + - "\x04كم\x04كى\x04كي\x04لج\x04لح\x04لخ\x04لم\x04لى\x04لي\x04مج\x04مح\x04مخ" + - "\x04مم\x04مى\x04مي\x04نج\x04نح\x04نخ\x04نم\x04نى\x04ني\x04هج\x04هم\x04هى" + - "\x04هي\x04يج\x04يح\x04يخ\x04يم\x04يى\x04يي\x04ذٰ\x04رٰ\x04ىٰ\x05 ٌّ\x05 " + - "ٍّ\x05 َّ\x05 ُّ\x05 ِّ\x05 ّٰ\x04ئر\x04ئز\x04ئن\x04بر\x04بز\x04بن\x04ت" + - "ر\x04تز\x04تن\x04ثر\x04ثز\x04ثن\x04ما\x04نر\x04نز\x04نن\x04ير\x04يز\x04" + - "ين\x04ئخ\x04ئه\x04به\x04ته\x04صخ\x04له\x04نه\x04هٰ\x04يه\x04ثه\x04سه" + - "\x04شم\x04شه\x06ـَّ\x06ـُّ\x06ـِّ\x04طى\x04طي\x04عى\x04عي\x04غى\x04غي" + - "\x04سى\x04سي\x04شى\x04شي\x04حى\x04حي\x04جى\x04جي\x04خى\x04خي\x04صى\x04صي" + - "\x04ضى\x04ضي\x04شج\x04شح\x04شخ\x04شر\x04سر\x04صر\x04ضر\x04اً\x06تجم\x06ت" + - "حج\x06تحم\x06تخم\x06تمج\x06تمح\x06تمخ\x06جمح\x06حمي\x06حمى\x06سحج\x06سج" + - "ح\x06سجى\x06سمح\x06سمج\x06سمم\x06صحح\x06صمم\x06شحم\x06شجي\x06شمخ\x06شمم" + - "\x06ضحى\x06ضخم\x06طمح\x06طمم\x06طمي\x06عجم\x06عمم\x06عمى\x06غمم\x06غمي" + - "\x06غمى\x06فخم\x06قمح\x06قمم\x06لحم\x06لحي\x06لحى\x06لجج\x06لخم\x06لمح" + - "\x06محج\x06محم\x06محي\x06مجح\x06مجم\x06مخج\x06مخم\x06مجخ\x06همج\x06همم" + - "\x06نحم\x06نحى\x06نجم\x06نجى\x06نمي\x06نمى\x06يمم\x06بخي\x06تجي\x06تجى" + - "\x06تخي\x06تخى\x06تمي\x06تمى\x06جمي\x06جحى\x06جمى\x06سخى\x06صحي\x06شحي" + - "\x06ضحي\x06لجي\x06لمي\x06يحي\x06يجي\x06يمي\x06ممي\x06قمي\x06نحي\x06عمي" + - "\x06كمي\x06نجح\x06مخي\x06لجم\x06كمم\x06جحي\x06حجي\x06مجي\x06فمي\x06بحي" + - "\x06سخي\x06نجي\x06صلے\x06قلے\x08الله\x08اكبر\x08محمد\x08صلعم\x08رسول\x08" + - "عليه\x08وسلم\x06صلى!صلى الله عليه وسلم\x0fجل جلاله\x08ریال\x01,\x01:" + - "\x01!\x01?\x01_\x01{\x01}\x01[\x01]\x01#\x01&\x01*\x01-\x01<\x01>\x01\\" + - "\x01$\x01%\x01@\x04ـً\x04ـَ\x04ـُ\x04ـِ\x04ـّ\x04ـْ\x02ء\x02آ\x02أ\x02ؤ" + - "\x02إ\x02ئ\x02ا\x02ب\x02ة\x02ت\x02ث\x02ج\x02ح\x02خ\x02د\x02ذ\x02ر\x02ز" + - "\x02س\x02ش\x02ص\x02ض\x02ط\x02ظ\x02ع\x02غ\x02ف\x02ق\x02ك\x02ل\x02م\x02ن" + - "\x02ه\x02و\x02ي\x04لآ\x04لأ\x04لإ\x04لا\x01\x22\x01'\x01/\x01^\x01|\x01~" + - "\x02¢\x02£\x02¬\x02¦\x02¥\x08𝅗𝅥\x08𝅘𝅥\x0c𝅘𝅥𝅮\x0c𝅘𝅥𝅯\x0c𝅘𝅥𝅰\x0c𝅘𝅥𝅱\x0c𝅘𝅥𝅲" + - "\x08𝆹𝅥\x08𝆺𝅥\x0c𝆹𝅥𝅮\x0c𝆺𝅥𝅮\x0c𝆹𝅥𝅯\x0c𝆺𝅥𝅯\x02ı\x02ȷ\x02α\x02ε\x02ζ\x02η" + - "\x02κ\x02λ\x02μ\x02ν\x02ξ\x02ο\x02σ\x02τ\x02υ\x02ψ\x03∇\x03∂\x02ϝ\x02ٮ" + - "\x02ڡ\x02ٯ\x020,\x021,\x022,\x023,\x024,\x025,\x026,\x027,\x028,\x029," + - "\x03(a)\x03(b)\x03(c)\x03(d)\x03(e)\x03(f)\x03(g)\x03(h)\x03(i)\x03(j)" + - "\x03(k)\x03(l)\x03(m)\x03(n)\x03(o)\x03(p)\x03(q)\x03(r)\x03(s)\x03(t)" + - "\x03(u)\x03(v)\x03(w)\x03(x)\x03(y)\x03(z)\x07〔s〕\x02wz\x02hv\x02sd\x03p" + - "pv\x02wc\x02mc\x02md\x02mr\x02dj\x06ほか\x06ココ\x03サ\x03手\x03字\x03双\x03デ" + - "\x03二\x03多\x03解\x03天\x03交\x03映\x03無\x03料\x03前\x03後\x03再\x03新\x03初\x03終" + - "\x03生\x03販\x03声\x03吹\x03演\x03投\x03捕\x03一\x03三\x03遊\x03左\x03中\x03右\x03指" + - "\x03走\x03打\x03禁\x03空\x03合\x03満\x03有\x03月\x03申\x03割\x03営\x03配\x09〔本〕\x09〔" + - "三〕\x09〔二〕\x09〔安〕\x09〔点〕\x09〔打〕\x09〔盗〕\x09〔勝〕\x09〔敗〕\x03得\x03可\x03丽\x03" + - "丸\x03乁\x03你\x03侮\x03侻\x03倂\x03偺\x03備\x03僧\x03像\x03㒞\x03免\x03兔\x03兤\x03" + - "具\x03㒹\x03內\x03冗\x03冤\x03仌\x03冬\x03况\x03凵\x03刃\x03㓟\x03刻\x03剆\x03剷\x03" + - "㔕\x03勇\x03勉\x03勤\x03勺\x03包\x03匆\x03北\x03卉\x03卑\x03博\x03即\x03卽\x03卿\x03" + - "灰\x03及\x03叟\x03叫\x03叱\x03吆\x03咞\x03吸\x03呈\x03周\x03咢\x03哶\x03唐\x03啓\x03" + - "啣\x03善\x03喙\x03喫\x03喳\x03嗂\x03圖\x03嘆\x03圗\x03噑\x03噴\x03切\x03壮\x03城\x03" + - "埴\x03堍\x03型\x03堲\x03報\x03墬\x03売\x03壷\x03夆\x03夢\x03奢\x03姬\x03娛\x03娧\x03" + - "姘\x03婦\x03㛮\x03嬈\x03嬾\x03寃\x03寘\x03寧\x03寳\x03寿\x03将\x03尢\x03㞁\x03屠\x03" + - "屮\x03峀\x03岍\x03嵃\x03嵮\x03嵫\x03嵼\x03巡\x03巢\x03㠯\x03巽\x03帨\x03帽\x03幩\x03" + - "㡢\x03㡼\x03庰\x03庳\x03庶\x03廊\x03廾\x03舁\x03弢\x03㣇\x03形\x03彫\x03㣣\x03徚\x03" + - "忍\x03志\x03忹\x03悁\x03㤺\x03㤜\x03悔\x03惇\x03慈\x03慌\x03慎\x03慺\x03憎\x03憲\x03" + - "憤\x03憯\x03懞\x03懲\x03懶\x03成\x03戛\x03扝\x03抱\x03拔\x03捐\x03挽\x03拼\x03捨\x03" + - "掃\x03揤\x03搢\x03揅\x03掩\x03㨮\x03摩\x03摾\x03撝\x03摷\x03㩬\x03敏\x03敬\x03旣\x03" + - "書\x03晉\x03㬙\x03暑\x03㬈\x03㫤\x03冒\x03冕\x03最\x03暜\x03肭\x03䏙\x03朗\x03望\x03" + - "朡\x03杞\x03杓\x03㭉\x03柺\x03枅\x03桒\x03梅\x03梎\x03栟\x03椔\x03㮝\x03楂\x03榣\x03" + - "槪\x03檨\x03櫛\x03㰘\x03次\x03歔\x03㱎\x03歲\x03殟\x03殺\x03殻\x03汎\x03沿\x03泍\x03" + - "汧\x03洖\x03派\x03海\x03流\x03浩\x03浸\x03涅\x03洴\x03港\x03湮\x03㴳\x03滋\x03滇\x03" + - "淹\x03潮\x03濆\x03瀹\x03瀞\x03瀛\x03㶖\x03灊\x03災\x03灷\x03炭\x03煅\x03熜\x03爨\x03" + - "爵\x03牐\x03犀\x03犕\x03獺\x03王\x03㺬\x03玥\x03㺸\x03瑇\x03瑜\x03瑱\x03璅\x03瓊\x03" + - "㼛\x03甤\x03甾\x03異\x03瘐\x03㿼\x03䀈\x03直\x03眞\x03真\x03睊\x03䀹\x03瞋\x03䁆\x03" + - "䂖\x03硎\x03碌\x03磌\x03䃣\x03祖\x03福\x03秫\x03䄯\x03穀\x03穊\x03穏\x03䈂\x03篆\x03" + - "築\x03䈧\x03糒\x03䊠\x03糨\x03糣\x03紀\x03絣\x03䌁\x03緇\x03縂\x03繅\x03䌴\x03䍙\x03" + - "罺\x03羕\x03翺\x03者\x03聠\x03聰\x03䏕\x03育\x03脃\x03䐋\x03脾\x03媵\x03舄\x03辞\x03" + - "䑫\x03芑\x03芋\x03芝\x03劳\x03花\x03芳\x03芽\x03苦\x03若\x03茝\x03荣\x03莭\x03茣\x03" + - "莽\x03菧\x03著\x03荓\x03菊\x03菌\x03菜\x03䔫\x03蓱\x03蓳\x03蔖\x03蕤\x03䕝\x03䕡\x03" + - "䕫\x03虐\x03虜\x03虧\x03虩\x03蚩\x03蚈\x03蜎\x03蛢\x03蝹\x03蜨\x03蝫\x03螆\x03蟡\x03" + - "蠁\x03䗹\x03衠\x03衣\x03裗\x03裞\x03䘵\x03裺\x03㒻\x03䚾\x03䛇\x03誠\x03諭\x03變\x03" + - "豕\x03貫\x03賁\x03贛\x03起\x03跋\x03趼\x03跰\x03軔\x03輸\x03邔\x03郱\x03鄑\x03鄛\x03" + - "鈸\x03鋗\x03鋘\x03鉼\x03鏹\x03鐕\x03開\x03䦕\x03閷\x03䧦\x03雃\x03嶲\x03霣\x03䩮\x03" + - "䩶\x03韠\x03䪲\x03頋\x03頩\x03飢\x03䬳\x03餩\x03馧\x03駂\x03駾\x03䯎\x03鬒\x03鱀\x03" + - "鳽\x03䳎\x03䳭\x03鵧\x03䳸\x03麻\x03䵖\x03黹\x03黾\x03鼅\x03鼏\x03鼖\x03鼻" +var mappings string = "" + // Size: 6539 bytes + " ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक" + + "़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱ" + + "ཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳ" + + "ɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧ" + + "ιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?" + + "′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83" + + "⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12" + + ")(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)" + + "(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전" + + ")(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(" + + "財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)21222324252627282930313233343" + + "5참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパート" + + "アルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキロ" + + "グラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノ" + + "ノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポ" + + "イントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリ" + + "ラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20" + + "点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlk" + + "lfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhah" + + "pinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日1" + + "8日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմ" + + "խיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּו" + + "ֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئم" + + "ئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحط" + + "مظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمي" + + "نجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترت" + + "زتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيس" + + "ىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميح" + + "مىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمى" + + "فخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنم" + + "ينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمين" + + "حيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليه" + + "وسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\\$%@ـًـَـُـِـّـْءآ" + + "أؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا\x22'/^|~¢£¬¦¥𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱" + + "𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκλμνξοστυψ∇∂ϝٮڡٯ0,1,2,3,4,5,6,7,8,9,(a)(b)(c" + + ")(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)〔s" + + "〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申割営配〔" + + "本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉卑博即卽" + + "卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢㠯巽帨帽" + + "幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最暜肭䏙朗" + + "望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸瑇瑜瑱璅" + + "瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦若茝荣莭" + + "茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷䧦雃嶲霣" + + "䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻" + +var mappingIndex = []uint16{ // 1650 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0004, 0x0005, 0x0008, 0x0009, 0x000a, + 0x000d, 0x0010, 0x0011, 0x0012, 0x0017, 0x001c, 0x0021, 0x0024, + 0x0027, 0x002a, 0x002b, 0x002e, 0x0031, 0x0034, 0x0035, 0x0036, + 0x0037, 0x0038, 0x0039, 0x003c, 0x003f, 0x0042, 0x0045, 0x0048, + 0x004b, 0x004c, 0x004d, 0x0051, 0x0054, 0x0055, 0x005a, 0x005e, + 0x0062, 0x0066, 0x006a, 0x006e, 0x0074, 0x007a, 0x0080, 0x0086, + 0x008c, 0x0092, 0x0098, 0x009e, 0x00a4, 0x00aa, 0x00b0, 0x00b6, + 0x00bc, 0x00c2, 0x00c8, 0x00ce, 0x00d4, 0x00da, 0x00e0, 0x00e6, + // Entry 40 - 7F + 0x00ec, 0x00f2, 0x00f8, 0x00fe, 0x0104, 0x010a, 0x0110, 0x0116, + 0x011c, 0x0122, 0x0128, 0x012e, 0x0137, 0x013d, 0x0146, 0x014c, + 0x0152, 0x0158, 0x015e, 0x0164, 0x016a, 0x0170, 0x0172, 0x0174, + 0x0176, 0x0178, 0x017a, 0x017c, 0x017e, 0x0180, 0x0181, 0x0182, + 0x0183, 0x0185, 0x0186, 0x0187, 0x0188, 0x0189, 0x018a, 0x018c, + 0x018d, 0x018e, 0x018f, 0x0191, 0x0193, 0x0195, 0x0197, 0x0199, + 0x019b, 0x019d, 0x019f, 0x01a0, 0x01a2, 0x01a4, 0x01a6, 0x01a8, + 0x01aa, 0x01ac, 0x01ae, 0x01b0, 0x01b1, 0x01b3, 0x01b5, 0x01b6, + // Entry 80 - BF + 0x01b8, 0x01ba, 0x01bc, 0x01be, 0x01c0, 0x01c2, 0x01c4, 0x01c6, + 0x01c8, 0x01ca, 0x01cc, 0x01ce, 0x01d0, 0x01d2, 0x01d4, 0x01d6, + 0x01d8, 0x01da, 0x01dc, 0x01de, 0x01e0, 0x01e2, 0x01e4, 0x01e5, + 0x01e7, 0x01e9, 0x01eb, 0x01ed, 0x01ef, 0x01f1, 0x01f3, 0x01f5, + 0x01f7, 0x01f9, 0x01fb, 0x01fd, 0x0202, 0x0207, 0x020c, 0x0211, + 0x0216, 0x021b, 0x0220, 0x0225, 0x022a, 0x022f, 0x0234, 0x0239, + 0x023e, 0x0243, 0x0248, 0x024d, 0x0252, 0x0257, 0x025c, 0x0261, + 0x0266, 0x026b, 0x0270, 0x0275, 0x027a, 0x027e, 0x0282, 0x0287, + // Entry C0 - FF + 0x0289, 0x028e, 0x0293, 0x0297, 0x029b, 0x02a0, 0x02a5, 0x02aa, + 0x02af, 0x02b1, 0x02b6, 0x02bb, 0x02c0, 0x02c2, 0x02c7, 0x02c8, + 0x02cd, 0x02d1, 0x02d5, 0x02da, 0x02e0, 0x02e9, 0x02ef, 0x02f8, + 0x02fa, 0x02fc, 0x02fe, 0x0300, 0x030c, 0x030d, 0x030e, 0x030f, + 0x0310, 0x0311, 0x0312, 0x0313, 0x0314, 0x0315, 0x0316, 0x0317, + 0x0319, 0x031b, 0x031d, 0x031e, 0x0320, 0x0322, 0x0324, 0x0326, + 0x0328, 0x032a, 0x032c, 0x032e, 0x0330, 0x0335, 0x033a, 0x0340, + 0x0345, 0x034a, 0x034f, 0x0354, 0x0359, 0x035e, 0x0363, 0x0368, + // Entry 100 - 13F + 0x036d, 0x0372, 0x0377, 0x037c, 0x0380, 0x0382, 0x0384, 0x0386, + 0x038a, 0x038c, 0x038e, 0x0393, 0x0399, 0x03a2, 0x03a8, 0x03b1, + 0x03b3, 0x03b5, 0x03b7, 0x03b9, 0x03bb, 0x03bd, 0x03bf, 0x03c1, + 0x03c3, 0x03c5, 0x03c7, 0x03cb, 0x03cf, 0x03d3, 0x03d7, 0x03db, + 0x03df, 0x03e3, 0x03e7, 0x03eb, 0x03ef, 0x03f3, 0x03ff, 0x0401, + 0x0406, 0x0408, 0x040a, 0x040c, 0x040e, 0x040f, 0x0413, 0x0417, + 0x041d, 0x0423, 0x0428, 0x042d, 0x0432, 0x0437, 0x043c, 0x0441, + 0x0446, 0x044b, 0x0450, 0x0455, 0x045a, 0x045f, 0x0464, 0x0469, + // Entry 140 - 17F + 0x046e, 0x0473, 0x0478, 0x047d, 0x0482, 0x0487, 0x048c, 0x0491, + 0x0496, 0x049b, 0x04a0, 0x04a5, 0x04aa, 0x04af, 0x04b4, 0x04bc, + 0x04c4, 0x04c9, 0x04ce, 0x04d3, 0x04d8, 0x04dd, 0x04e2, 0x04e7, + 0x04ec, 0x04f1, 0x04f6, 0x04fb, 0x0500, 0x0505, 0x050a, 0x050f, + 0x0514, 0x0519, 0x051e, 0x0523, 0x0528, 0x052d, 0x0532, 0x0537, + 0x053c, 0x0541, 0x0546, 0x054b, 0x0550, 0x0555, 0x055a, 0x055f, + 0x0564, 0x0569, 0x056e, 0x0573, 0x0578, 0x057a, 0x057c, 0x057e, + 0x0580, 0x0582, 0x0584, 0x0586, 0x0588, 0x058a, 0x058c, 0x058e, + // Entry 180 - 1BF + 0x0590, 0x0592, 0x0594, 0x0596, 0x059c, 0x05a2, 0x05a4, 0x05a6, + 0x05a8, 0x05aa, 0x05ac, 0x05ae, 0x05b0, 0x05b2, 0x05b4, 0x05b6, + 0x05b8, 0x05ba, 0x05bc, 0x05be, 0x05c0, 0x05c4, 0x05c8, 0x05cc, + 0x05d0, 0x05d4, 0x05d8, 0x05dc, 0x05e0, 0x05e4, 0x05e9, 0x05ee, + 0x05f3, 0x05f5, 0x05f7, 0x05fd, 0x0609, 0x0615, 0x0621, 0x062a, + 0x0636, 0x063f, 0x0648, 0x0657, 0x0663, 0x066c, 0x0675, 0x067e, + 0x068a, 0x0696, 0x069f, 0x06a8, 0x06ae, 0x06b7, 0x06c3, 0x06cf, + 0x06d5, 0x06e4, 0x06f6, 0x0705, 0x070e, 0x071d, 0x072c, 0x0738, + // Entry 1C0 - 1FF + 0x0741, 0x074a, 0x0753, 0x075f, 0x076e, 0x077a, 0x0783, 0x078c, + 0x0795, 0x079b, 0x07a1, 0x07a7, 0x07ad, 0x07b6, 0x07bf, 0x07ce, + 0x07d7, 0x07e3, 0x07f2, 0x07fb, 0x0801, 0x0807, 0x0816, 0x0822, + 0x0831, 0x083a, 0x0849, 0x084f, 0x0858, 0x0861, 0x086a, 0x0873, + 0x087c, 0x0888, 0x0891, 0x0897, 0x08a0, 0x08a9, 0x08b2, 0x08be, + 0x08c7, 0x08d0, 0x08d9, 0x08e8, 0x08f4, 0x08fa, 0x0909, 0x090f, + 0x091b, 0x0927, 0x0930, 0x0939, 0x0942, 0x094e, 0x0954, 0x095d, + 0x0969, 0x096f, 0x097e, 0x0987, 0x098b, 0x098f, 0x0993, 0x0997, + // Entry 200 - 23F + 0x099b, 0x099f, 0x09a3, 0x09a7, 0x09ab, 0x09af, 0x09b4, 0x09b9, + 0x09be, 0x09c3, 0x09c8, 0x09cd, 0x09d2, 0x09d7, 0x09dc, 0x09e1, + 0x09e6, 0x09eb, 0x09f0, 0x09f5, 0x09fa, 0x09fc, 0x09fe, 0x0a00, + 0x0a02, 0x0a04, 0x0a06, 0x0a0c, 0x0a12, 0x0a18, 0x0a1e, 0x0a2a, + 0x0a2c, 0x0a2e, 0x0a30, 0x0a32, 0x0a34, 0x0a36, 0x0a38, 0x0a3c, + 0x0a3e, 0x0a40, 0x0a42, 0x0a44, 0x0a46, 0x0a48, 0x0a4a, 0x0a4c, + 0x0a4e, 0x0a50, 0x0a52, 0x0a54, 0x0a56, 0x0a58, 0x0a5a, 0x0a5f, + 0x0a65, 0x0a6c, 0x0a74, 0x0a76, 0x0a78, 0x0a7a, 0x0a7c, 0x0a7e, + // Entry 240 - 27F + 0x0a80, 0x0a82, 0x0a84, 0x0a86, 0x0a88, 0x0a8a, 0x0a8c, 0x0a8e, + 0x0a90, 0x0a96, 0x0a98, 0x0a9a, 0x0a9c, 0x0a9e, 0x0aa0, 0x0aa2, + 0x0aa4, 0x0aa6, 0x0aa8, 0x0aaa, 0x0aac, 0x0aae, 0x0ab0, 0x0ab2, + 0x0ab4, 0x0ab9, 0x0abe, 0x0ac2, 0x0ac6, 0x0aca, 0x0ace, 0x0ad2, + 0x0ad6, 0x0ada, 0x0ade, 0x0ae2, 0x0ae7, 0x0aec, 0x0af1, 0x0af6, + 0x0afb, 0x0b00, 0x0b05, 0x0b0a, 0x0b0f, 0x0b14, 0x0b19, 0x0b1e, + 0x0b23, 0x0b28, 0x0b2d, 0x0b32, 0x0b37, 0x0b3c, 0x0b41, 0x0b46, + 0x0b4b, 0x0b50, 0x0b52, 0x0b54, 0x0b56, 0x0b58, 0x0b5a, 0x0b5c, + // Entry 280 - 2BF + 0x0b5e, 0x0b62, 0x0b66, 0x0b6a, 0x0b6e, 0x0b72, 0x0b76, 0x0b7a, + 0x0b7c, 0x0b7e, 0x0b80, 0x0b82, 0x0b86, 0x0b8a, 0x0b8e, 0x0b92, + 0x0b96, 0x0b9a, 0x0b9e, 0x0ba0, 0x0ba2, 0x0ba4, 0x0ba6, 0x0ba8, + 0x0baa, 0x0bac, 0x0bb0, 0x0bb4, 0x0bba, 0x0bc0, 0x0bc4, 0x0bc8, + 0x0bcc, 0x0bd0, 0x0bd4, 0x0bd8, 0x0bdc, 0x0be0, 0x0be4, 0x0be8, + 0x0bec, 0x0bf0, 0x0bf4, 0x0bf8, 0x0bfc, 0x0c00, 0x0c04, 0x0c08, + 0x0c0c, 0x0c10, 0x0c14, 0x0c18, 0x0c1c, 0x0c20, 0x0c24, 0x0c28, + 0x0c2c, 0x0c30, 0x0c34, 0x0c36, 0x0c38, 0x0c3a, 0x0c3c, 0x0c3e, + // Entry 2C0 - 2FF + 0x0c40, 0x0c42, 0x0c44, 0x0c46, 0x0c48, 0x0c4a, 0x0c4c, 0x0c4e, + 0x0c50, 0x0c52, 0x0c54, 0x0c56, 0x0c58, 0x0c5a, 0x0c5c, 0x0c5e, + 0x0c60, 0x0c62, 0x0c64, 0x0c66, 0x0c68, 0x0c6a, 0x0c6c, 0x0c6e, + 0x0c70, 0x0c72, 0x0c74, 0x0c76, 0x0c78, 0x0c7a, 0x0c7c, 0x0c7e, + 0x0c80, 0x0c82, 0x0c86, 0x0c8a, 0x0c8e, 0x0c92, 0x0c96, 0x0c9a, + 0x0c9e, 0x0ca2, 0x0ca4, 0x0ca8, 0x0cac, 0x0cb0, 0x0cb4, 0x0cb8, + 0x0cbc, 0x0cc0, 0x0cc4, 0x0cc8, 0x0ccc, 0x0cd0, 0x0cd4, 0x0cd8, + 0x0cdc, 0x0ce0, 0x0ce4, 0x0ce8, 0x0cec, 0x0cf0, 0x0cf4, 0x0cf8, + // Entry 300 - 33F + 0x0cfc, 0x0d00, 0x0d04, 0x0d08, 0x0d0c, 0x0d10, 0x0d14, 0x0d18, + 0x0d1c, 0x0d20, 0x0d24, 0x0d28, 0x0d2c, 0x0d30, 0x0d34, 0x0d38, + 0x0d3c, 0x0d40, 0x0d44, 0x0d48, 0x0d4c, 0x0d50, 0x0d54, 0x0d58, + 0x0d5c, 0x0d60, 0x0d64, 0x0d68, 0x0d6c, 0x0d70, 0x0d74, 0x0d78, + 0x0d7c, 0x0d80, 0x0d84, 0x0d88, 0x0d8c, 0x0d90, 0x0d94, 0x0d98, + 0x0d9c, 0x0da0, 0x0da4, 0x0da8, 0x0dac, 0x0db0, 0x0db4, 0x0db8, + 0x0dbc, 0x0dc0, 0x0dc4, 0x0dc8, 0x0dcc, 0x0dd0, 0x0dd4, 0x0dd8, + 0x0ddc, 0x0de0, 0x0de4, 0x0de8, 0x0dec, 0x0df0, 0x0df4, 0x0df8, + // Entry 340 - 37F + 0x0dfc, 0x0e00, 0x0e04, 0x0e08, 0x0e0c, 0x0e10, 0x0e14, 0x0e18, + 0x0e1d, 0x0e22, 0x0e27, 0x0e2c, 0x0e31, 0x0e36, 0x0e3a, 0x0e3e, + 0x0e42, 0x0e46, 0x0e4a, 0x0e4e, 0x0e52, 0x0e56, 0x0e5a, 0x0e5e, + 0x0e62, 0x0e66, 0x0e6a, 0x0e6e, 0x0e72, 0x0e76, 0x0e7a, 0x0e7e, + 0x0e82, 0x0e86, 0x0e8a, 0x0e8e, 0x0e92, 0x0e96, 0x0e9a, 0x0e9e, + 0x0ea2, 0x0ea6, 0x0eaa, 0x0eae, 0x0eb2, 0x0eb6, 0x0ebc, 0x0ec2, + 0x0ec8, 0x0ecc, 0x0ed0, 0x0ed4, 0x0ed8, 0x0edc, 0x0ee0, 0x0ee4, + 0x0ee8, 0x0eec, 0x0ef0, 0x0ef4, 0x0ef8, 0x0efc, 0x0f00, 0x0f04, + // Entry 380 - 3BF + 0x0f08, 0x0f0c, 0x0f10, 0x0f14, 0x0f18, 0x0f1c, 0x0f20, 0x0f24, + 0x0f28, 0x0f2c, 0x0f30, 0x0f34, 0x0f38, 0x0f3e, 0x0f44, 0x0f4a, + 0x0f50, 0x0f56, 0x0f5c, 0x0f62, 0x0f68, 0x0f6e, 0x0f74, 0x0f7a, + 0x0f80, 0x0f86, 0x0f8c, 0x0f92, 0x0f98, 0x0f9e, 0x0fa4, 0x0faa, + 0x0fb0, 0x0fb6, 0x0fbc, 0x0fc2, 0x0fc8, 0x0fce, 0x0fd4, 0x0fda, + 0x0fe0, 0x0fe6, 0x0fec, 0x0ff2, 0x0ff8, 0x0ffe, 0x1004, 0x100a, + 0x1010, 0x1016, 0x101c, 0x1022, 0x1028, 0x102e, 0x1034, 0x103a, + 0x1040, 0x1046, 0x104c, 0x1052, 0x1058, 0x105e, 0x1064, 0x106a, + // Entry 3C0 - 3FF + 0x1070, 0x1076, 0x107c, 0x1082, 0x1088, 0x108e, 0x1094, 0x109a, + 0x10a0, 0x10a6, 0x10ac, 0x10b2, 0x10b8, 0x10be, 0x10c4, 0x10ca, + 0x10d0, 0x10d6, 0x10dc, 0x10e2, 0x10e8, 0x10ee, 0x10f4, 0x10fa, + 0x1100, 0x1106, 0x110c, 0x1112, 0x1118, 0x111e, 0x1124, 0x112a, + 0x1130, 0x1136, 0x113c, 0x1142, 0x1148, 0x114e, 0x1154, 0x115a, + 0x1160, 0x1166, 0x116c, 0x1172, 0x1178, 0x1180, 0x1188, 0x1190, + 0x1198, 0x11a0, 0x11a8, 0x11b0, 0x11b6, 0x11d7, 0x11e6, 0x11ee, + 0x11ef, 0x11f0, 0x11f1, 0x11f2, 0x11f3, 0x11f4, 0x11f5, 0x11f6, + // Entry 400 - 43F + 0x11f7, 0x11f8, 0x11f9, 0x11fa, 0x11fb, 0x11fc, 0x11fd, 0x11fe, + 0x11ff, 0x1200, 0x1201, 0x1205, 0x1209, 0x120d, 0x1211, 0x1215, + 0x1219, 0x121b, 0x121d, 0x121f, 0x1221, 0x1223, 0x1225, 0x1227, + 0x1229, 0x122b, 0x122d, 0x122f, 0x1231, 0x1233, 0x1235, 0x1237, + 0x1239, 0x123b, 0x123d, 0x123f, 0x1241, 0x1243, 0x1245, 0x1247, + 0x1249, 0x124b, 0x124d, 0x124f, 0x1251, 0x1253, 0x1255, 0x1257, + 0x1259, 0x125b, 0x125d, 0x125f, 0x1263, 0x1267, 0x126b, 0x126f, + 0x1270, 0x1271, 0x1272, 0x1273, 0x1274, 0x1275, 0x1277, 0x1279, + // Entry 440 - 47F + 0x127b, 0x127d, 0x127f, 0x1287, 0x128f, 0x129b, 0x12a7, 0x12b3, + 0x12bf, 0x12cb, 0x12d3, 0x12db, 0x12e7, 0x12f3, 0x12ff, 0x130b, + 0x130d, 0x130f, 0x1311, 0x1313, 0x1315, 0x1317, 0x1319, 0x131b, + 0x131d, 0x131f, 0x1321, 0x1323, 0x1325, 0x1327, 0x1329, 0x132b, + 0x132e, 0x1331, 0x1333, 0x1335, 0x1337, 0x1339, 0x133b, 0x133d, + 0x133f, 0x1341, 0x1343, 0x1345, 0x1347, 0x1349, 0x134b, 0x134d, + 0x1350, 0x1353, 0x1356, 0x1359, 0x135c, 0x135f, 0x1362, 0x1365, + 0x1368, 0x136b, 0x136e, 0x1371, 0x1374, 0x1377, 0x137a, 0x137d, + // Entry 480 - 4BF + 0x1380, 0x1383, 0x1386, 0x1389, 0x138c, 0x138f, 0x1392, 0x1395, + 0x1398, 0x139b, 0x13a2, 0x13a4, 0x13a6, 0x13a8, 0x13ab, 0x13ad, + 0x13af, 0x13b1, 0x13b3, 0x13b5, 0x13bb, 0x13c1, 0x13c4, 0x13c7, + 0x13ca, 0x13cd, 0x13d0, 0x13d3, 0x13d6, 0x13d9, 0x13dc, 0x13df, + 0x13e2, 0x13e5, 0x13e8, 0x13eb, 0x13ee, 0x13f1, 0x13f4, 0x13f7, + 0x13fa, 0x13fd, 0x1400, 0x1403, 0x1406, 0x1409, 0x140c, 0x140f, + 0x1412, 0x1415, 0x1418, 0x141b, 0x141e, 0x1421, 0x1424, 0x1427, + 0x142a, 0x142d, 0x1430, 0x1433, 0x1436, 0x1439, 0x143c, 0x143f, + // Entry 4C0 - 4FF + 0x1442, 0x1445, 0x1448, 0x1451, 0x145a, 0x1463, 0x146c, 0x1475, + 0x147e, 0x1487, 0x1490, 0x1499, 0x149c, 0x149f, 0x14a2, 0x14a5, + 0x14a8, 0x14ab, 0x14ae, 0x14b1, 0x14b4, 0x14b7, 0x14ba, 0x14bd, + 0x14c0, 0x14c3, 0x14c6, 0x14c9, 0x14cc, 0x14cf, 0x14d2, 0x14d5, + 0x14d8, 0x14db, 0x14de, 0x14e1, 0x14e4, 0x14e7, 0x14ea, 0x14ed, + 0x14f0, 0x14f3, 0x14f6, 0x14f9, 0x14fc, 0x14ff, 0x1502, 0x1505, + 0x1508, 0x150b, 0x150e, 0x1511, 0x1514, 0x1517, 0x151a, 0x151d, + 0x1520, 0x1523, 0x1526, 0x1529, 0x152c, 0x152f, 0x1532, 0x1535, + // Entry 500 - 53F + 0x1538, 0x153b, 0x153e, 0x1541, 0x1544, 0x1547, 0x154a, 0x154d, + 0x1550, 0x1553, 0x1556, 0x1559, 0x155c, 0x155f, 0x1562, 0x1565, + 0x1568, 0x156b, 0x156e, 0x1571, 0x1574, 0x1577, 0x157a, 0x157d, + 0x1580, 0x1583, 0x1586, 0x1589, 0x158c, 0x158f, 0x1592, 0x1595, + 0x1598, 0x159b, 0x159e, 0x15a1, 0x15a4, 0x15a7, 0x15aa, 0x15ad, + 0x15b0, 0x15b3, 0x15b6, 0x15b9, 0x15bc, 0x15bf, 0x15c2, 0x15c5, + 0x15c8, 0x15cb, 0x15ce, 0x15d1, 0x15d4, 0x15d7, 0x15da, 0x15dd, + 0x15e0, 0x15e3, 0x15e6, 0x15e9, 0x15ec, 0x15ef, 0x15f2, 0x15f5, + // Entry 540 - 57F + 0x15f8, 0x15fb, 0x15fe, 0x1601, 0x1604, 0x1607, 0x160a, 0x160d, + 0x1610, 0x1613, 0x1616, 0x1619, 0x161c, 0x161f, 0x1622, 0x1625, + 0x1628, 0x162b, 0x162e, 0x1631, 0x1634, 0x1637, 0x163a, 0x163d, + 0x1640, 0x1643, 0x1646, 0x1649, 0x164c, 0x164f, 0x1652, 0x1655, + 0x1658, 0x165b, 0x165e, 0x1661, 0x1664, 0x1667, 0x166a, 0x166d, + 0x1670, 0x1673, 0x1676, 0x1679, 0x167c, 0x167f, 0x1682, 0x1685, + 0x1688, 0x168b, 0x168e, 0x1691, 0x1694, 0x1697, 0x169a, 0x169d, + 0x16a0, 0x16a3, 0x16a6, 0x16a9, 0x16ac, 0x16af, 0x16b2, 0x16b5, + // Entry 580 - 5BF + 0x16b8, 0x16bb, 0x16be, 0x16c1, 0x16c4, 0x16c7, 0x16ca, 0x16cd, + 0x16d0, 0x16d3, 0x16d6, 0x16d9, 0x16dc, 0x16df, 0x16e2, 0x16e5, + 0x16e8, 0x16eb, 0x16ee, 0x16f1, 0x16f4, 0x16f7, 0x16fa, 0x16fd, + 0x1700, 0x1703, 0x1706, 0x1709, 0x170c, 0x170f, 0x1712, 0x1715, + 0x1718, 0x171b, 0x171e, 0x1721, 0x1724, 0x1727, 0x172a, 0x172d, + 0x1730, 0x1733, 0x1736, 0x1739, 0x173c, 0x173f, 0x1742, 0x1745, + 0x1748, 0x174b, 0x174e, 0x1751, 0x1754, 0x1757, 0x175a, 0x175d, + 0x1760, 0x1763, 0x1766, 0x1769, 0x176c, 0x176f, 0x1772, 0x1775, + // Entry 5C0 - 5FF + 0x1778, 0x177b, 0x177e, 0x1781, 0x1784, 0x1787, 0x178a, 0x178d, + 0x1790, 0x1793, 0x1796, 0x1799, 0x179c, 0x179f, 0x17a2, 0x17a5, + 0x17a8, 0x17ab, 0x17ae, 0x17b1, 0x17b4, 0x17b7, 0x17ba, 0x17bd, + 0x17c0, 0x17c3, 0x17c6, 0x17c9, 0x17cc, 0x17cf, 0x17d2, 0x17d5, + 0x17d8, 0x17db, 0x17de, 0x17e1, 0x17e4, 0x17e7, 0x17ea, 0x17ed, + 0x17f0, 0x17f3, 0x17f6, 0x17f9, 0x17fc, 0x17ff, 0x1802, 0x1805, + 0x1808, 0x180b, 0x180e, 0x1811, 0x1814, 0x1817, 0x181a, 0x181d, + 0x1820, 0x1823, 0x1826, 0x1829, 0x182c, 0x182f, 0x1832, 0x1835, + // Entry 600 - 63F + 0x1838, 0x183b, 0x183e, 0x1841, 0x1844, 0x1847, 0x184a, 0x184d, + 0x1850, 0x1853, 0x1856, 0x1859, 0x185c, 0x185f, 0x1862, 0x1865, + 0x1868, 0x186b, 0x186e, 0x1871, 0x1874, 0x1877, 0x187a, 0x187d, + 0x1880, 0x1883, 0x1886, 0x1889, 0x188c, 0x188f, 0x1892, 0x1895, + 0x1898, 0x189b, 0x189e, 0x18a1, 0x18a4, 0x18a7, 0x18aa, 0x18ad, + 0x18b0, 0x18b3, 0x18b6, 0x18b9, 0x18bc, 0x18bf, 0x18c2, 0x18c5, + 0x18c8, 0x18cb, 0x18ce, 0x18d1, 0x18d4, 0x18d7, 0x18da, 0x18dd, + 0x18e0, 0x18e3, 0x18e6, 0x18e9, 0x18ec, 0x18ef, 0x18f2, 0x18f5, + // Entry 640 - 67F + 0x18f8, 0x18fb, 0x18fe, 0x1901, 0x1904, 0x1907, 0x190a, 0x190d, + 0x1910, 0x1913, 0x1916, 0x1919, 0x191c, 0x191f, 0x1922, 0x1925, + 0x1928, 0x192b, 0x192e, 0x1931, 0x1934, 0x1937, 0x193a, 0x193d, + 0x1940, 0x1943, 0x1946, 0x1949, 0x194c, 0x194f, 0x1952, 0x1955, + 0x1958, 0x195b, 0x195e, 0x1961, 0x1964, 0x1967, 0x196a, 0x196d, + 0x1970, 0x1973, 0x1976, 0x1979, 0x197c, 0x197f, 0x1982, 0x1985, + 0x1988, 0x198b, +} // Size: 3324 bytes var xorData string = "" + // Size: 4862 bytes "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + @@ -547,7 +690,7 @@ func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// idnaTrie. Total size: 30288 bytes (29.58 KiB). Checksum: c0cd84404a2f6f19. +// idnaTrie. Total size: 30196 bytes (29.49 KiB). Checksum: e2ae95a945f04016. type idnaTrie struct{} func newIdnaTrie(i int) *idnaTrie { @@ -600,11 +743,11 @@ var idnaValues = [8192]uint16{ 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, - 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x001a, 0xe9: 0x0018, - 0xea: 0x0039, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x004a, - 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0069, 0xf3: 0x0079, 0xf4: 0x008a, 0xf5: 0x0005, - 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x00aa, 0xf9: 0x00c9, 0xfa: 0x00d9, 0xfb: 0x0018, - 0xfc: 0x00e9, 0xfd: 0x0119, 0xfe: 0x0149, 0xff: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x0012, 0xe9: 0x0018, + 0xea: 0x0019, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x0022, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0029, 0xf3: 0x0031, 0xf4: 0x003a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x0042, 0xf9: 0x0049, 0xfa: 0x0051, 0xfb: 0x0018, + 0xfc: 0x0059, 0xfd: 0x0061, 0xfe: 0x0069, 0xff: 0x0018, // Block 0x4, offset 0x100 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, @@ -614,12 +757,12 @@ var idnaValues = [8192]uint16{ 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, - 0x130: 0x0179, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x130: 0x0071, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, - 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0199, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0079, // Block 0x5, offset 0x140 - 0x140: 0x0199, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, - 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x01b9, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x140: 0x0079, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x0081, 0x14a: 0xe00d, 0x14b: 0x0008, 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, @@ -628,7 +771,7 @@ var idnaValues = [8192]uint16{ 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, - 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x01d9, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x0089, // Block 0x6, offset 0x180 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, @@ -642,8 +785,8 @@ var idnaValues = [8192]uint16{ 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, // Block 0x7, offset 0x1c0 - 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x01e9, 0x1c5: 0x01e9, - 0x1c6: 0x01e9, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x0091, 0x1c5: 0x0091, + 0x1c6: 0x0091, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, @@ -663,22 +806,22 @@ var idnaValues = [8192]uint16{ 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, - 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0209, 0x23b: 0xe03d, - 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x0229, 0x23f: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0099, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x00a1, 0x23f: 0x0008, // Block 0x9, offset 0x240 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, - 0x258: 0x029a, 0x259: 0x02ba, 0x25a: 0x02da, 0x25b: 0x02fa, 0x25c: 0x031a, 0x25d: 0x033a, - 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0359, 0x262: 0x01d9, 0x263: 0x0369, + 0x258: 0x00d2, 0x259: 0x00da, 0x25a: 0x00e2, 0x25b: 0x00ea, 0x25c: 0x00f2, 0x25d: 0x00fa, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0101, 0x262: 0x0089, 0x263: 0x0109, 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, // Block 0xa, offset 0x280 - 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0379, 0x285: 0x040d, + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0111, 0x285: 0x040d, 0x286: 0x3308, 0x287: 0x3308, 0x288: 0x3308, 0x289: 0x3308, 0x28a: 0x3308, 0x28b: 0x3308, 0x28c: 0x3308, 0x28d: 0x3308, 0x28e: 0x3308, 0x28f: 0x33c0, 0x290: 0x3308, 0x291: 0x3308, 0x292: 0x3308, 0x293: 0x3308, 0x294: 0x3308, 0x295: 0x3308, 0x296: 0x3308, 0x297: 0x3308, @@ -687,10 +830,10 @@ var idnaValues = [8192]uint16{ 0x2a4: 0x3308, 0x2a5: 0x3308, 0x2a6: 0x3308, 0x2a7: 0x3308, 0x2a8: 0x3308, 0x2a9: 0x3308, 0x2aa: 0x3308, 0x2ab: 0x3308, 0x2ac: 0x3308, 0x2ad: 0x3308, 0x2ae: 0x3308, 0x2af: 0x3308, 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, - 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x03a2, 0x2bb: 0x0008, - 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x03c2, 0x2bf: 0x043d, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x011a, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x0122, 0x2bf: 0x043d, // Block 0xb, offset 0x2c0 - 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x008a, 0x2c5: 0x03d2, + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x003a, 0x2c5: 0x012a, 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, @@ -782,8 +925,8 @@ var idnaValues = [8192]uint16{ 0x49e: 0x3308, 0x49f: 0x3308, 0x4a0: 0x0808, 0x4a1: 0x0808, 0x4a2: 0x0808, 0x4a3: 0x0808, 0x4a4: 0x0808, 0x4a5: 0x0808, 0x4a6: 0x0808, 0x4a7: 0x0808, 0x4a8: 0x0808, 0x4a9: 0x0808, 0x4aa: 0x0018, 0x4ab: 0x0818, 0x4ac: 0x0818, 0x4ad: 0x0818, 0x4ae: 0x0a08, 0x4af: 0x0a08, - 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0429, - 0x4b6: 0x0451, 0x4b7: 0x0479, 0x4b8: 0x04a1, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, + 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0139, + 0x4b6: 0x0141, 0x4b7: 0x0149, 0x4b8: 0x0151, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, 0x4bc: 0x0a08, 0x4bd: 0x0a08, 0x4be: 0x0a08, 0x4bf: 0x0a08, // Block 0x13, offset 0x4c0 0x4c0: 0x0c08, 0x4c1: 0x0a08, 0x4c2: 0x0a08, 0x4c3: 0x0c08, 0x4c4: 0x0c08, 0x4c5: 0x0c08, @@ -826,8 +969,8 @@ var idnaValues = [8192]uint16{ 0x586: 0x3308, 0x587: 0x3308, 0x588: 0x3308, 0x589: 0x3008, 0x58a: 0x3008, 0x58b: 0x3008, 0x58c: 0x3008, 0x58d: 0x3b08, 0x58e: 0x3008, 0x58f: 0x3008, 0x590: 0x0008, 0x591: 0x3308, 0x592: 0x3308, 0x593: 0x3308, 0x594: 0x3308, 0x595: 0x3308, 0x596: 0x3308, 0x597: 0x3308, - 0x598: 0x04c9, 0x599: 0x0501, 0x59a: 0x0539, 0x59b: 0x0571, 0x59c: 0x05a9, 0x59d: 0x05e1, - 0x59e: 0x0619, 0x59f: 0x0651, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x3308, 0x5a3: 0x3308, + 0x598: 0x0159, 0x599: 0x0161, 0x59a: 0x0169, 0x59b: 0x0171, 0x59c: 0x0179, 0x59d: 0x0181, + 0x59e: 0x0189, 0x59f: 0x0191, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x3308, 0x5a3: 0x3308, 0x5a4: 0x0018, 0x5a5: 0x0018, 0x5a6: 0x0008, 0x5a7: 0x0008, 0x5a8: 0x0008, 0x5a9: 0x0008, 0x5aa: 0x0008, 0x5ab: 0x0008, 0x5ac: 0x0008, 0x5ad: 0x0008, 0x5ae: 0x0008, 0x5af: 0x0008, 0x5b0: 0x0018, 0x5b1: 0x0008, 0x5b2: 0x0008, 0x5b3: 0x0008, 0x5b4: 0x0008, 0x5b5: 0x0008, @@ -850,8 +993,8 @@ var idnaValues = [8192]uint16{ 0x606: 0x0040, 0x607: 0x3008, 0x608: 0x3008, 0x609: 0x0040, 0x60a: 0x0040, 0x60b: 0x3008, 0x60c: 0x3008, 0x60d: 0x3b08, 0x60e: 0x0008, 0x60f: 0x0040, 0x610: 0x0040, 0x611: 0x0040, 0x612: 0x0040, 0x613: 0x0040, 0x614: 0x0040, 0x615: 0x0040, 0x616: 0x0040, 0x617: 0x3008, - 0x618: 0x0040, 0x619: 0x0040, 0x61a: 0x0040, 0x61b: 0x0040, 0x61c: 0x0689, 0x61d: 0x06c1, - 0x61e: 0x0040, 0x61f: 0x06f9, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x3308, 0x623: 0x3308, + 0x618: 0x0040, 0x619: 0x0040, 0x61a: 0x0040, 0x61b: 0x0040, 0x61c: 0x0199, 0x61d: 0x01a1, + 0x61e: 0x0040, 0x61f: 0x01a9, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x3308, 0x623: 0x3308, 0x624: 0x0040, 0x625: 0x0040, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0008, 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, 0x630: 0x0008, 0x631: 0x0008, 0x632: 0x0018, 0x633: 0x0018, 0x634: 0x0018, 0x635: 0x0018, @@ -866,16 +1009,16 @@ var idnaValues = [8192]uint16{ 0x65e: 0x0008, 0x65f: 0x0008, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x0008, 0x663: 0x0008, 0x664: 0x0008, 0x665: 0x0008, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0040, 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, - 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x0731, 0x674: 0x0040, 0x675: 0x0008, - 0x676: 0x0769, 0x677: 0x0040, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, + 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x01b1, 0x674: 0x0040, 0x675: 0x0008, + 0x676: 0x01b9, 0x677: 0x0040, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, 0x67c: 0x3308, 0x67d: 0x0040, 0x67e: 0x3008, 0x67f: 0x3008, // Block 0x1a, offset 0x680 0x680: 0x3008, 0x681: 0x3308, 0x682: 0x3308, 0x683: 0x0040, 0x684: 0x0040, 0x685: 0x0040, 0x686: 0x0040, 0x687: 0x3308, 0x688: 0x3308, 0x689: 0x0040, 0x68a: 0x0040, 0x68b: 0x3308, 0x68c: 0x3308, 0x68d: 0x3b08, 0x68e: 0x0040, 0x68f: 0x0040, 0x690: 0x0040, 0x691: 0x3308, 0x692: 0x0040, 0x693: 0x0040, 0x694: 0x0040, 0x695: 0x0040, 0x696: 0x0040, 0x697: 0x0040, - 0x698: 0x0040, 0x699: 0x07a1, 0x69a: 0x07d9, 0x69b: 0x0811, 0x69c: 0x0008, 0x69d: 0x0040, - 0x69e: 0x0849, 0x69f: 0x0040, 0x6a0: 0x0040, 0x6a1: 0x0040, 0x6a2: 0x0040, 0x6a3: 0x0040, + 0x698: 0x0040, 0x699: 0x01c1, 0x69a: 0x01c9, 0x69b: 0x01d1, 0x69c: 0x0008, 0x69d: 0x0040, + 0x69e: 0x01d9, 0x69f: 0x0040, 0x6a0: 0x0040, 0x6a1: 0x0040, 0x6a2: 0x0040, 0x6a3: 0x0040, 0x6a4: 0x0040, 0x6a5: 0x0040, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0008, 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, 0x6b0: 0x3308, 0x6b1: 0x3308, 0x6b2: 0x0008, 0x6b3: 0x0008, 0x6b4: 0x0008, 0x6b5: 0x3308, @@ -922,7 +1065,7 @@ var idnaValues = [8192]uint16{ 0x786: 0x0040, 0x787: 0x3008, 0x788: 0x3008, 0x789: 0x0040, 0x78a: 0x0040, 0x78b: 0x3008, 0x78c: 0x3008, 0x78d: 0x3b08, 0x78e: 0x0040, 0x78f: 0x0040, 0x790: 0x0040, 0x791: 0x0040, 0x792: 0x0040, 0x793: 0x0040, 0x794: 0x0040, 0x795: 0x3308, 0x796: 0x3308, 0x797: 0x3008, - 0x798: 0x0040, 0x799: 0x0040, 0x79a: 0x0040, 0x79b: 0x0040, 0x79c: 0x0881, 0x79d: 0x08b9, + 0x798: 0x0040, 0x799: 0x0040, 0x79a: 0x0040, 0x79b: 0x0040, 0x79c: 0x01e1, 0x79d: 0x01e9, 0x79e: 0x0040, 0x79f: 0x0008, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x3308, 0x7a3: 0x3308, 0x7a4: 0x0040, 0x7a5: 0x0040, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0008, 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, @@ -998,32 +1141,32 @@ var idnaValues = [8192]uint16{ 0x91e: 0x0008, 0x91f: 0x0008, 0x920: 0x0008, 0x921: 0x0008, 0x922: 0x0008, 0x923: 0x0008, 0x924: 0x0040, 0x925: 0x0008, 0x926: 0x0040, 0x927: 0x0008, 0x928: 0x0008, 0x929: 0x0008, 0x92a: 0x0008, 0x92b: 0x0008, 0x92c: 0x0008, 0x92d: 0x0008, 0x92e: 0x0008, 0x92f: 0x0008, - 0x930: 0x0008, 0x931: 0x3308, 0x932: 0x0008, 0x933: 0x0929, 0x934: 0x3308, 0x935: 0x3308, + 0x930: 0x0008, 0x931: 0x3308, 0x932: 0x0008, 0x933: 0x01f9, 0x934: 0x3308, 0x935: 0x3308, 0x936: 0x3308, 0x937: 0x3308, 0x938: 0x3308, 0x939: 0x3308, 0x93a: 0x3b08, 0x93b: 0x3308, 0x93c: 0x3308, 0x93d: 0x0008, 0x93e: 0x0040, 0x93f: 0x0040, // Block 0x25, offset 0x940 - 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x09d1, 0x944: 0x0008, 0x945: 0x0008, + 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0211, 0x944: 0x0008, 0x945: 0x0008, 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0040, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0008, - 0x94c: 0x0008, 0x94d: 0x0a09, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, - 0x952: 0x0a41, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0a79, - 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0ab1, 0x95d: 0x0008, + 0x94c: 0x0008, 0x94d: 0x0219, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0221, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0229, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0231, 0x95d: 0x0008, 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, - 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0ae9, + 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0239, 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0008, 0x96d: 0x0040, 0x96e: 0x0040, 0x96f: 0x0040, - 0x970: 0x0040, 0x971: 0x3308, 0x972: 0x3308, 0x973: 0x0b21, 0x974: 0x3308, 0x975: 0x0b59, - 0x976: 0x0b91, 0x977: 0x0bc9, 0x978: 0x0c19, 0x979: 0x0c51, 0x97a: 0x3308, 0x97b: 0x3308, + 0x970: 0x0040, 0x971: 0x3308, 0x972: 0x3308, 0x973: 0x0241, 0x974: 0x3308, 0x975: 0x0249, + 0x976: 0x0251, 0x977: 0x0259, 0x978: 0x0261, 0x979: 0x0269, 0x97a: 0x3308, 0x97b: 0x3308, 0x97c: 0x3308, 0x97d: 0x3308, 0x97e: 0x3308, 0x97f: 0x3008, // Block 0x26, offset 0x980 - 0x980: 0x3308, 0x981: 0x0ca1, 0x982: 0x3308, 0x983: 0x3308, 0x984: 0x3b08, 0x985: 0x0018, + 0x980: 0x3308, 0x981: 0x0271, 0x982: 0x3308, 0x983: 0x3308, 0x984: 0x3b08, 0x985: 0x0018, 0x986: 0x3308, 0x987: 0x3308, 0x988: 0x0008, 0x989: 0x0008, 0x98a: 0x0008, 0x98b: 0x0008, 0x98c: 0x0008, 0x98d: 0x3308, 0x98e: 0x3308, 0x98f: 0x3308, 0x990: 0x3308, 0x991: 0x3308, - 0x992: 0x3308, 0x993: 0x0cd9, 0x994: 0x3308, 0x995: 0x3308, 0x996: 0x3308, 0x997: 0x3308, - 0x998: 0x0040, 0x999: 0x3308, 0x99a: 0x3308, 0x99b: 0x3308, 0x99c: 0x3308, 0x99d: 0x0d11, - 0x99e: 0x3308, 0x99f: 0x3308, 0x9a0: 0x3308, 0x9a1: 0x3308, 0x9a2: 0x0d49, 0x9a3: 0x3308, - 0x9a4: 0x3308, 0x9a5: 0x3308, 0x9a6: 0x3308, 0x9a7: 0x0d81, 0x9a8: 0x3308, 0x9a9: 0x3308, - 0x9aa: 0x3308, 0x9ab: 0x3308, 0x9ac: 0x0db9, 0x9ad: 0x3308, 0x9ae: 0x3308, 0x9af: 0x3308, + 0x992: 0x3308, 0x993: 0x0279, 0x994: 0x3308, 0x995: 0x3308, 0x996: 0x3308, 0x997: 0x3308, + 0x998: 0x0040, 0x999: 0x3308, 0x99a: 0x3308, 0x99b: 0x3308, 0x99c: 0x3308, 0x99d: 0x0281, + 0x99e: 0x3308, 0x99f: 0x3308, 0x9a0: 0x3308, 0x9a1: 0x3308, 0x9a2: 0x0289, 0x9a3: 0x3308, + 0x9a4: 0x3308, 0x9a5: 0x3308, 0x9a6: 0x3308, 0x9a7: 0x0291, 0x9a8: 0x3308, 0x9a9: 0x3308, + 0x9aa: 0x3308, 0x9ab: 0x3308, 0x9ac: 0x0299, 0x9ad: 0x3308, 0x9ae: 0x3308, 0x9af: 0x3308, 0x9b0: 0x3308, 0x9b1: 0x3308, 0x9b2: 0x3308, 0x9b3: 0x3308, 0x9b4: 0x3308, 0x9b5: 0x3308, - 0x9b6: 0x3308, 0x9b7: 0x3308, 0x9b8: 0x3308, 0x9b9: 0x0df1, 0x9ba: 0x3308, 0x9bb: 0x3308, + 0x9b6: 0x3308, 0x9b7: 0x3308, 0x9b8: 0x3308, 0x9b9: 0x02a1, 0x9ba: 0x3308, 0x9bb: 0x3308, 0x9bc: 0x3308, 0x9bd: 0x0040, 0x9be: 0x0018, 0x9bf: 0x0018, // Block 0x27, offset 0x9c0 0x9c0: 0x0008, 0x9c1: 0x0008, 0x9c2: 0x0008, 0x9c3: 0x0008, 0x9c4: 0x0008, 0x9c5: 0x0008, @@ -1033,34 +1176,34 @@ var idnaValues = [8192]uint16{ 0x9d8: 0x0008, 0x9d9: 0x0008, 0x9da: 0x0008, 0x9db: 0x0008, 0x9dc: 0x0008, 0x9dd: 0x0008, 0x9de: 0x0008, 0x9df: 0x0008, 0x9e0: 0x0008, 0x9e1: 0x0008, 0x9e2: 0x0008, 0x9e3: 0x0008, 0x9e4: 0x0008, 0x9e5: 0x0008, 0x9e6: 0x0008, 0x9e7: 0x0008, 0x9e8: 0x0008, 0x9e9: 0x0008, - 0x9ea: 0x0008, 0x9eb: 0x0008, 0x9ec: 0x0039, 0x9ed: 0x0ed1, 0x9ee: 0x0ee9, 0x9ef: 0x0008, - 0x9f0: 0x0ef9, 0x9f1: 0x0f09, 0x9f2: 0x0f19, 0x9f3: 0x0f31, 0x9f4: 0x0249, 0x9f5: 0x0f41, - 0x9f6: 0x0259, 0x9f7: 0x0f51, 0x9f8: 0x0359, 0x9f9: 0x0f61, 0x9fa: 0x0f71, 0x9fb: 0x0008, - 0x9fc: 0x00d9, 0x9fd: 0x0f81, 0x9fe: 0x0f99, 0x9ff: 0x0269, + 0x9ea: 0x0008, 0x9eb: 0x0008, 0x9ec: 0x0019, 0x9ed: 0x02e1, 0x9ee: 0x02e9, 0x9ef: 0x0008, + 0x9f0: 0x02f1, 0x9f1: 0x02f9, 0x9f2: 0x0301, 0x9f3: 0x0309, 0x9f4: 0x00a9, 0x9f5: 0x0311, + 0x9f6: 0x00b1, 0x9f7: 0x0319, 0x9f8: 0x0101, 0x9f9: 0x0321, 0x9fa: 0x0329, 0x9fb: 0x0008, + 0x9fc: 0x0051, 0x9fd: 0x0331, 0x9fe: 0x0339, 0x9ff: 0x00b9, // Block 0x28, offset 0xa00 - 0xa00: 0x0fa9, 0xa01: 0x0fb9, 0xa02: 0x0279, 0xa03: 0x0039, 0xa04: 0x0fc9, 0xa05: 0x0fe1, - 0xa06: 0x05b5, 0xa07: 0x0ee9, 0xa08: 0x0ef9, 0xa09: 0x0f09, 0xa0a: 0x0ff9, 0xa0b: 0x1011, - 0xa0c: 0x1029, 0xa0d: 0x0f31, 0xa0e: 0x0008, 0xa0f: 0x0f51, 0xa10: 0x0f61, 0xa11: 0x1041, - 0xa12: 0x00d9, 0xa13: 0x1059, 0xa14: 0x05cd, 0xa15: 0x05cd, 0xa16: 0x0f99, 0xa17: 0x0fa9, - 0xa18: 0x0fb9, 0xa19: 0x05b5, 0xa1a: 0x1071, 0xa1b: 0x1089, 0xa1c: 0x05e5, 0xa1d: 0x1099, - 0xa1e: 0x10b1, 0xa1f: 0x10c9, 0xa20: 0x10e1, 0xa21: 0x10f9, 0xa22: 0x0f41, 0xa23: 0x0269, - 0xa24: 0x0fb9, 0xa25: 0x1089, 0xa26: 0x1099, 0xa27: 0x10b1, 0xa28: 0x1111, 0xa29: 0x10e1, - 0xa2a: 0x10f9, 0xa2b: 0x0008, 0xa2c: 0x0008, 0xa2d: 0x0008, 0xa2e: 0x0008, 0xa2f: 0x0008, + 0xa00: 0x0341, 0xa01: 0x0349, 0xa02: 0x00c1, 0xa03: 0x0019, 0xa04: 0x0351, 0xa05: 0x0359, + 0xa06: 0x05b5, 0xa07: 0x02e9, 0xa08: 0x02f1, 0xa09: 0x02f9, 0xa0a: 0x0361, 0xa0b: 0x0369, + 0xa0c: 0x0371, 0xa0d: 0x0309, 0xa0e: 0x0008, 0xa0f: 0x0319, 0xa10: 0x0321, 0xa11: 0x0379, + 0xa12: 0x0051, 0xa13: 0x0381, 0xa14: 0x05cd, 0xa15: 0x05cd, 0xa16: 0x0339, 0xa17: 0x0341, + 0xa18: 0x0349, 0xa19: 0x05b5, 0xa1a: 0x0389, 0xa1b: 0x0391, 0xa1c: 0x05e5, 0xa1d: 0x0399, + 0xa1e: 0x03a1, 0xa1f: 0x03a9, 0xa20: 0x03b1, 0xa21: 0x03b9, 0xa22: 0x0311, 0xa23: 0x00b9, + 0xa24: 0x0349, 0xa25: 0x0391, 0xa26: 0x0399, 0xa27: 0x03a1, 0xa28: 0x03c1, 0xa29: 0x03b1, + 0xa2a: 0x03b9, 0xa2b: 0x0008, 0xa2c: 0x0008, 0xa2d: 0x0008, 0xa2e: 0x0008, 0xa2f: 0x0008, 0xa30: 0x0008, 0xa31: 0x0008, 0xa32: 0x0008, 0xa33: 0x0008, 0xa34: 0x0008, 0xa35: 0x0008, - 0xa36: 0x0008, 0xa37: 0x0008, 0xa38: 0x1129, 0xa39: 0x0008, 0xa3a: 0x0008, 0xa3b: 0x0008, + 0xa36: 0x0008, 0xa37: 0x0008, 0xa38: 0x03c9, 0xa39: 0x0008, 0xa3a: 0x0008, 0xa3b: 0x0008, 0xa3c: 0x0008, 0xa3d: 0x0008, 0xa3e: 0x0008, 0xa3f: 0x0008, // Block 0x29, offset 0xa40 0xa40: 0x0008, 0xa41: 0x0008, 0xa42: 0x0008, 0xa43: 0x0008, 0xa44: 0x0008, 0xa45: 0x0008, 0xa46: 0x0008, 0xa47: 0x0008, 0xa48: 0x0008, 0xa49: 0x0008, 0xa4a: 0x0008, 0xa4b: 0x0008, 0xa4c: 0x0008, 0xa4d: 0x0008, 0xa4e: 0x0008, 0xa4f: 0x0008, 0xa50: 0x0008, 0xa51: 0x0008, 0xa52: 0x0008, 0xa53: 0x0008, 0xa54: 0x0008, 0xa55: 0x0008, 0xa56: 0x0008, 0xa57: 0x0008, - 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0008, 0xa5b: 0x1141, 0xa5c: 0x1159, 0xa5d: 0x1169, - 0xa5e: 0x1181, 0xa5f: 0x1029, 0xa60: 0x1199, 0xa61: 0x11a9, 0xa62: 0x11c1, 0xa63: 0x11d9, - 0xa64: 0x11f1, 0xa65: 0x1209, 0xa66: 0x1221, 0xa67: 0x05fd, 0xa68: 0x1239, 0xa69: 0x1251, - 0xa6a: 0xe17d, 0xa6b: 0x1269, 0xa6c: 0x1281, 0xa6d: 0x1299, 0xa6e: 0x12b1, 0xa6f: 0x12c9, - 0xa70: 0x12e1, 0xa71: 0x12f9, 0xa72: 0x1311, 0xa73: 0x1329, 0xa74: 0x1341, 0xa75: 0x1359, - 0xa76: 0x1371, 0xa77: 0x1389, 0xa78: 0x0615, 0xa79: 0x13a1, 0xa7a: 0x13b9, 0xa7b: 0x13d1, - 0xa7c: 0x13e1, 0xa7d: 0x13f9, 0xa7e: 0x1411, 0xa7f: 0x1429, + 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0008, 0xa5b: 0x03d1, 0xa5c: 0x03d9, 0xa5d: 0x03e1, + 0xa5e: 0x03e9, 0xa5f: 0x0371, 0xa60: 0x03f1, 0xa61: 0x03f9, 0xa62: 0x0401, 0xa63: 0x0409, + 0xa64: 0x0411, 0xa65: 0x0419, 0xa66: 0x0421, 0xa67: 0x05fd, 0xa68: 0x0429, 0xa69: 0x0431, + 0xa6a: 0xe17d, 0xa6b: 0x0439, 0xa6c: 0x0441, 0xa6d: 0x0449, 0xa6e: 0x0451, 0xa6f: 0x0459, + 0xa70: 0x0461, 0xa71: 0x0469, 0xa72: 0x0471, 0xa73: 0x0479, 0xa74: 0x0481, 0xa75: 0x0489, + 0xa76: 0x0491, 0xa77: 0x0499, 0xa78: 0x0615, 0xa79: 0x04a1, 0xa7a: 0x04a9, 0xa7b: 0x04b1, + 0xa7c: 0x04b9, 0xa7d: 0x04c1, 0xa7e: 0x04c9, 0xa7f: 0x04d1, // Block 0x2a, offset 0xa80 0xa80: 0xe00d, 0xa81: 0x0008, 0xa82: 0xe00d, 0xa83: 0x0008, 0xa84: 0xe00d, 0xa85: 0x0008, 0xa86: 0xe00d, 0xa87: 0x0008, 0xa88: 0xe00d, 0xa89: 0x0008, 0xa8a: 0xe00d, 0xa8b: 0x0008, @@ -1079,7 +1222,7 @@ var idnaValues = [8192]uint16{ 0xacc: 0xe00d, 0xacd: 0x0008, 0xace: 0xe00d, 0xacf: 0x0008, 0xad0: 0xe00d, 0xad1: 0x0008, 0xad2: 0xe00d, 0xad3: 0x0008, 0xad4: 0xe00d, 0xad5: 0x0008, 0xad6: 0x0008, 0xad7: 0x0008, 0xad8: 0x0008, 0xad9: 0x0008, 0xada: 0x062d, 0xadb: 0x064d, 0xadc: 0x0008, 0xadd: 0x0008, - 0xade: 0x1441, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, + 0xade: 0x04d9, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, 0xae4: 0xe00d, 0xae5: 0x0008, 0xae6: 0xe00d, 0xae7: 0x0008, 0xae8: 0xe00d, 0xae9: 0x0008, 0xaea: 0xe00d, 0xaeb: 0x0008, 0xaec: 0xe00d, 0xaed: 0x0008, 0xaee: 0xe00d, 0xaef: 0x0008, 0xaf0: 0xe00d, 0xaf1: 0x0008, 0xaf2: 0xe00d, 0xaf3: 0x0008, 0xaf4: 0xe00d, 0xaf5: 0x0008, @@ -1094,33 +1237,33 @@ var idnaValues = [8192]uint16{ 0xb1e: 0x0040, 0xb1f: 0xe045, 0xb20: 0x0008, 0xb21: 0x0008, 0xb22: 0x0008, 0xb23: 0x0008, 0xb24: 0x0008, 0xb25: 0x0008, 0xb26: 0x0008, 0xb27: 0x0008, 0xb28: 0xe045, 0xb29: 0xe045, 0xb2a: 0xe045, 0xb2b: 0xe045, 0xb2c: 0xe045, 0xb2d: 0xe045, 0xb2e: 0xe045, 0xb2f: 0xe045, - 0xb30: 0x0008, 0xb31: 0x1459, 0xb32: 0x0008, 0xb33: 0x1471, 0xb34: 0x0008, 0xb35: 0x1489, - 0xb36: 0x0008, 0xb37: 0x14a1, 0xb38: 0x0008, 0xb39: 0x14b9, 0xb3a: 0x0008, 0xb3b: 0x14d1, - 0xb3c: 0x0008, 0xb3d: 0x14e9, 0xb3e: 0x0040, 0xb3f: 0x0040, + 0xb30: 0x0008, 0xb31: 0x04e1, 0xb32: 0x0008, 0xb33: 0x04e9, 0xb34: 0x0008, 0xb35: 0x04f1, + 0xb36: 0x0008, 0xb37: 0x04f9, 0xb38: 0x0008, 0xb39: 0x0501, 0xb3a: 0x0008, 0xb3b: 0x0509, + 0xb3c: 0x0008, 0xb3d: 0x0511, 0xb3e: 0x0040, 0xb3f: 0x0040, // Block 0x2d, offset 0xb40 - 0xb40: 0x1501, 0xb41: 0x1531, 0xb42: 0x1561, 0xb43: 0x1591, 0xb44: 0x15c1, 0xb45: 0x15f1, - 0xb46: 0x1621, 0xb47: 0x1651, 0xb48: 0x1501, 0xb49: 0x1531, 0xb4a: 0x1561, 0xb4b: 0x1591, - 0xb4c: 0x15c1, 0xb4d: 0x15f1, 0xb4e: 0x1621, 0xb4f: 0x1651, 0xb50: 0x1681, 0xb51: 0x16b1, - 0xb52: 0x16e1, 0xb53: 0x1711, 0xb54: 0x1741, 0xb55: 0x1771, 0xb56: 0x17a1, 0xb57: 0x17d1, - 0xb58: 0x1681, 0xb59: 0x16b1, 0xb5a: 0x16e1, 0xb5b: 0x1711, 0xb5c: 0x1741, 0xb5d: 0x1771, - 0xb5e: 0x17a1, 0xb5f: 0x17d1, 0xb60: 0x1801, 0xb61: 0x1831, 0xb62: 0x1861, 0xb63: 0x1891, - 0xb64: 0x18c1, 0xb65: 0x18f1, 0xb66: 0x1921, 0xb67: 0x1951, 0xb68: 0x1801, 0xb69: 0x1831, - 0xb6a: 0x1861, 0xb6b: 0x1891, 0xb6c: 0x18c1, 0xb6d: 0x18f1, 0xb6e: 0x1921, 0xb6f: 0x1951, - 0xb70: 0x0008, 0xb71: 0x0008, 0xb72: 0x1981, 0xb73: 0x19b1, 0xb74: 0x19d9, 0xb75: 0x0040, - 0xb76: 0x0008, 0xb77: 0x1a01, 0xb78: 0xe045, 0xb79: 0xe045, 0xb7a: 0x0665, 0xb7b: 0x1459, - 0xb7c: 0x19b1, 0xb7d: 0x067e, 0xb7e: 0x1a31, 0xb7f: 0x069e, + 0xb40: 0x0519, 0xb41: 0x0521, 0xb42: 0x0529, 0xb43: 0x0531, 0xb44: 0x0539, 0xb45: 0x0541, + 0xb46: 0x0549, 0xb47: 0x0551, 0xb48: 0x0519, 0xb49: 0x0521, 0xb4a: 0x0529, 0xb4b: 0x0531, + 0xb4c: 0x0539, 0xb4d: 0x0541, 0xb4e: 0x0549, 0xb4f: 0x0551, 0xb50: 0x0559, 0xb51: 0x0561, + 0xb52: 0x0569, 0xb53: 0x0571, 0xb54: 0x0579, 0xb55: 0x0581, 0xb56: 0x0589, 0xb57: 0x0591, + 0xb58: 0x0559, 0xb59: 0x0561, 0xb5a: 0x0569, 0xb5b: 0x0571, 0xb5c: 0x0579, 0xb5d: 0x0581, + 0xb5e: 0x0589, 0xb5f: 0x0591, 0xb60: 0x0599, 0xb61: 0x05a1, 0xb62: 0x05a9, 0xb63: 0x05b1, + 0xb64: 0x05b9, 0xb65: 0x05c1, 0xb66: 0x05c9, 0xb67: 0x05d1, 0xb68: 0x0599, 0xb69: 0x05a1, + 0xb6a: 0x05a9, 0xb6b: 0x05b1, 0xb6c: 0x05b9, 0xb6d: 0x05c1, 0xb6e: 0x05c9, 0xb6f: 0x05d1, + 0xb70: 0x0008, 0xb71: 0x0008, 0xb72: 0x05d9, 0xb73: 0x05e1, 0xb74: 0x05e9, 0xb75: 0x0040, + 0xb76: 0x0008, 0xb77: 0x05f1, 0xb78: 0xe045, 0xb79: 0xe045, 0xb7a: 0x0665, 0xb7b: 0x04e1, + 0xb7c: 0x05e1, 0xb7d: 0x067e, 0xb7e: 0x05f9, 0xb7f: 0x069e, // Block 0x2e, offset 0xb80 - 0xb80: 0x06be, 0xb81: 0x1a4a, 0xb82: 0x1a79, 0xb83: 0x1aa9, 0xb84: 0x1ad1, 0xb85: 0x0040, - 0xb86: 0x0008, 0xb87: 0x1af9, 0xb88: 0x06dd, 0xb89: 0x1471, 0xb8a: 0x06f5, 0xb8b: 0x1489, - 0xb8c: 0x1aa9, 0xb8d: 0x1b2a, 0xb8e: 0x1b5a, 0xb8f: 0x1b8a, 0xb90: 0x0008, 0xb91: 0x0008, - 0xb92: 0x0008, 0xb93: 0x1bb9, 0xb94: 0x0040, 0xb95: 0x0040, 0xb96: 0x0008, 0xb97: 0x0008, - 0xb98: 0xe045, 0xb99: 0xe045, 0xb9a: 0x070d, 0xb9b: 0x14a1, 0xb9c: 0x0040, 0xb9d: 0x1bd2, - 0xb9e: 0x1c02, 0xb9f: 0x1c32, 0xba0: 0x0008, 0xba1: 0x0008, 0xba2: 0x0008, 0xba3: 0x1c61, + 0xb80: 0x06be, 0xb81: 0x0602, 0xb82: 0x0609, 0xb83: 0x0611, 0xb84: 0x0619, 0xb85: 0x0040, + 0xb86: 0x0008, 0xb87: 0x0621, 0xb88: 0x06dd, 0xb89: 0x04e9, 0xb8a: 0x06f5, 0xb8b: 0x04f1, + 0xb8c: 0x0611, 0xb8d: 0x062a, 0xb8e: 0x0632, 0xb8f: 0x063a, 0xb90: 0x0008, 0xb91: 0x0008, + 0xb92: 0x0008, 0xb93: 0x0641, 0xb94: 0x0040, 0xb95: 0x0040, 0xb96: 0x0008, 0xb97: 0x0008, + 0xb98: 0xe045, 0xb99: 0xe045, 0xb9a: 0x070d, 0xb9b: 0x04f9, 0xb9c: 0x0040, 0xb9d: 0x064a, + 0xb9e: 0x0652, 0xb9f: 0x065a, 0xba0: 0x0008, 0xba1: 0x0008, 0xba2: 0x0008, 0xba3: 0x0661, 0xba4: 0x0008, 0xba5: 0x0008, 0xba6: 0x0008, 0xba7: 0x0008, 0xba8: 0xe045, 0xba9: 0xe045, - 0xbaa: 0x0725, 0xbab: 0x14d1, 0xbac: 0xe04d, 0xbad: 0x1c7a, 0xbae: 0x03d2, 0xbaf: 0x1caa, - 0xbb0: 0x0040, 0xbb1: 0x0040, 0xbb2: 0x1cb9, 0xbb3: 0x1ce9, 0xbb4: 0x1d11, 0xbb5: 0x0040, - 0xbb6: 0x0008, 0xbb7: 0x1d39, 0xbb8: 0x073d, 0xbb9: 0x14b9, 0xbba: 0x0515, 0xbbb: 0x14e9, - 0xbbc: 0x1ce9, 0xbbd: 0x0756, 0xbbe: 0x0776, 0xbbf: 0x0040, + 0xbaa: 0x0725, 0xbab: 0x0509, 0xbac: 0xe04d, 0xbad: 0x066a, 0xbae: 0x012a, 0xbaf: 0x0672, + 0xbb0: 0x0040, 0xbb1: 0x0040, 0xbb2: 0x0679, 0xbb3: 0x0681, 0xbb4: 0x0689, 0xbb5: 0x0040, + 0xbb6: 0x0008, 0xbb7: 0x0691, 0xbb8: 0x073d, 0xbb9: 0x0501, 0xbba: 0x0515, 0xbbb: 0x0511, + 0xbbc: 0x0681, 0xbbd: 0x0756, 0xbbe: 0x0776, 0xbbf: 0x0040, // Block 0x2f, offset 0xbc0 0xbc0: 0x000a, 0xbc1: 0x000a, 0xbc2: 0x000a, 0xbc3: 0x000a, 0xbc4: 0x000a, 0xbc5: 0x000a, 0xbc6: 0x000a, 0xbc7: 0x000a, 0xbc8: 0x000a, 0xbc9: 0x000a, 0xbca: 0x000a, 0xbcb: 0x03c0, @@ -1130,72 +1273,72 @@ var idnaValues = [8192]uint16{ 0xbde: 0x0018, 0xbdf: 0x0018, 0xbe0: 0x0018, 0xbe1: 0x0018, 0xbe2: 0x0018, 0xbe3: 0x0018, 0xbe4: 0x0040, 0xbe5: 0x0040, 0xbe6: 0x0040, 0xbe7: 0x0018, 0xbe8: 0x0040, 0xbe9: 0x0040, 0xbea: 0x0340, 0xbeb: 0x0340, 0xbec: 0x0340, 0xbed: 0x0340, 0xbee: 0x0340, 0xbef: 0x000a, - 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x1d69, 0xbf4: 0x1da1, 0xbf5: 0x0018, - 0xbf6: 0x1df1, 0xbf7: 0x1e29, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, - 0xbfc: 0x1e7a, 0xbfd: 0x0018, 0xbfe: 0x07b6, 0xbff: 0x0018, + 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x0699, 0xbf4: 0x06a1, 0xbf5: 0x0018, + 0xbf6: 0x06a9, 0xbf7: 0x06b1, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, + 0xbfc: 0x06ba, 0xbfd: 0x0018, 0xbfe: 0x07b6, 0xbff: 0x0018, // Block 0x30, offset 0xc00 0xc00: 0x0018, 0xc01: 0x0018, 0xc02: 0x0018, 0xc03: 0x0018, 0xc04: 0x0018, 0xc05: 0x0018, - 0xc06: 0x0018, 0xc07: 0x1e92, 0xc08: 0x1eaa, 0xc09: 0x1ec2, 0xc0a: 0x0018, 0xc0b: 0x0018, + 0xc06: 0x0018, 0xc07: 0x06c2, 0xc08: 0x06ca, 0xc09: 0x06d2, 0xc0a: 0x0018, 0xc0b: 0x0018, 0xc0c: 0x0018, 0xc0d: 0x0018, 0xc0e: 0x0018, 0xc0f: 0x0018, 0xc10: 0x0018, 0xc11: 0x0018, - 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x1ed9, + 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x06d9, 0xc18: 0x0018, 0xc19: 0x0018, 0xc1a: 0x0018, 0xc1b: 0x0018, 0xc1c: 0x0018, 0xc1d: 0x0018, 0xc1e: 0x0018, 0xc1f: 0x000a, 0xc20: 0x03c0, 0xc21: 0x0340, 0xc22: 0x0340, 0xc23: 0x0340, 0xc24: 0x03c0, 0xc25: 0x0040, 0xc26: 0x0040, 0xc27: 0x0040, 0xc28: 0x0040, 0xc29: 0x0040, 0xc2a: 0x0340, 0xc2b: 0x0340, 0xc2c: 0x0340, 0xc2d: 0x0340, 0xc2e: 0x0340, 0xc2f: 0x0340, - 0xc30: 0x1f41, 0xc31: 0x0f41, 0xc32: 0x0040, 0xc33: 0x0040, 0xc34: 0x1f51, 0xc35: 0x1f61, - 0xc36: 0x1f71, 0xc37: 0x1f81, 0xc38: 0x1f91, 0xc39: 0x1fa1, 0xc3a: 0x1fb2, 0xc3b: 0x07d5, - 0xc3c: 0x1fc2, 0xc3d: 0x1fd2, 0xc3e: 0x1fe2, 0xc3f: 0x0f71, + 0xc30: 0x06e1, 0xc31: 0x0311, 0xc32: 0x0040, 0xc33: 0x0040, 0xc34: 0x06e9, 0xc35: 0x06f1, + 0xc36: 0x06f9, 0xc37: 0x0701, 0xc38: 0x0709, 0xc39: 0x0711, 0xc3a: 0x071a, 0xc3b: 0x07d5, + 0xc3c: 0x0722, 0xc3d: 0x072a, 0xc3e: 0x0732, 0xc3f: 0x0329, // Block 0x31, offset 0xc40 - 0xc40: 0x1f41, 0xc41: 0x00c9, 0xc42: 0x0069, 0xc43: 0x0079, 0xc44: 0x1f51, 0xc45: 0x1f61, - 0xc46: 0x1f71, 0xc47: 0x1f81, 0xc48: 0x1f91, 0xc49: 0x1fa1, 0xc4a: 0x1fb2, 0xc4b: 0x07ed, - 0xc4c: 0x1fc2, 0xc4d: 0x1fd2, 0xc4e: 0x1fe2, 0xc4f: 0x0040, 0xc50: 0x0039, 0xc51: 0x0f09, - 0xc52: 0x00d9, 0xc53: 0x0369, 0xc54: 0x0ff9, 0xc55: 0x0249, 0xc56: 0x0f51, 0xc57: 0x0359, - 0xc58: 0x0f61, 0xc59: 0x0f71, 0xc5a: 0x0f99, 0xc5b: 0x01d9, 0xc5c: 0x0fa9, 0xc5d: 0x0040, + 0xc40: 0x06e1, 0xc41: 0x0049, 0xc42: 0x0029, 0xc43: 0x0031, 0xc44: 0x06e9, 0xc45: 0x06f1, + 0xc46: 0x06f9, 0xc47: 0x0701, 0xc48: 0x0709, 0xc49: 0x0711, 0xc4a: 0x071a, 0xc4b: 0x07ed, + 0xc4c: 0x0722, 0xc4d: 0x072a, 0xc4e: 0x0732, 0xc4f: 0x0040, 0xc50: 0x0019, 0xc51: 0x02f9, + 0xc52: 0x0051, 0xc53: 0x0109, 0xc54: 0x0361, 0xc55: 0x00a9, 0xc56: 0x0319, 0xc57: 0x0101, + 0xc58: 0x0321, 0xc59: 0x0329, 0xc5a: 0x0339, 0xc5b: 0x0089, 0xc5c: 0x0341, 0xc5d: 0x0040, 0xc5e: 0x0040, 0xc5f: 0x0040, 0xc60: 0x0018, 0xc61: 0x0018, 0xc62: 0x0018, 0xc63: 0x0018, - 0xc64: 0x0018, 0xc65: 0x0018, 0xc66: 0x0018, 0xc67: 0x0018, 0xc68: 0x1ff1, 0xc69: 0x0018, + 0xc64: 0x0018, 0xc65: 0x0018, 0xc66: 0x0018, 0xc67: 0x0018, 0xc68: 0x0739, 0xc69: 0x0018, 0xc6a: 0x0018, 0xc6b: 0x0018, 0xc6c: 0x0018, 0xc6d: 0x0018, 0xc6e: 0x0018, 0xc6f: 0x0018, 0xc70: 0x0018, 0xc71: 0x0018, 0xc72: 0x0018, 0xc73: 0x0018, 0xc74: 0x0018, 0xc75: 0x0018, 0xc76: 0x0018, 0xc77: 0x0018, 0xc78: 0x0018, 0xc79: 0x0018, 0xc7a: 0x0018, 0xc7b: 0x0018, 0xc7c: 0x0018, 0xc7d: 0x0018, 0xc7e: 0x0018, 0xc7f: 0x0018, // Block 0x32, offset 0xc80 - 0xc80: 0x0806, 0xc81: 0x0826, 0xc82: 0x1159, 0xc83: 0x0845, 0xc84: 0x0018, 0xc85: 0x0866, - 0xc86: 0x0886, 0xc87: 0x1011, 0xc88: 0x0018, 0xc89: 0x08a5, 0xc8a: 0x0f31, 0xc8b: 0x0249, - 0xc8c: 0x0249, 0xc8d: 0x0249, 0xc8e: 0x0249, 0xc8f: 0x2009, 0xc90: 0x0f41, 0xc91: 0x0f41, - 0xc92: 0x0359, 0xc93: 0x0359, 0xc94: 0x0018, 0xc95: 0x0f71, 0xc96: 0x2021, 0xc97: 0x0018, - 0xc98: 0x0018, 0xc99: 0x0f99, 0xc9a: 0x2039, 0xc9b: 0x0269, 0xc9c: 0x0269, 0xc9d: 0x0269, - 0xc9e: 0x0018, 0xc9f: 0x0018, 0xca0: 0x2049, 0xca1: 0x08c5, 0xca2: 0x2061, 0xca3: 0x0018, - 0xca4: 0x13d1, 0xca5: 0x0018, 0xca6: 0x2079, 0xca7: 0x0018, 0xca8: 0x13d1, 0xca9: 0x0018, - 0xcaa: 0x0f51, 0xcab: 0x2091, 0xcac: 0x0ee9, 0xcad: 0x1159, 0xcae: 0x0018, 0xcaf: 0x0f09, - 0xcb0: 0x0f09, 0xcb1: 0x1199, 0xcb2: 0x0040, 0xcb3: 0x0f61, 0xcb4: 0x00d9, 0xcb5: 0x20a9, - 0xcb6: 0x20c1, 0xcb7: 0x20d9, 0xcb8: 0x20f1, 0xcb9: 0x0f41, 0xcba: 0x0018, 0xcbb: 0x08e5, - 0xcbc: 0x2109, 0xcbd: 0x10b1, 0xcbe: 0x10b1, 0xcbf: 0x2109, + 0xc80: 0x0806, 0xc81: 0x0826, 0xc82: 0x03d9, 0xc83: 0x0845, 0xc84: 0x0018, 0xc85: 0x0866, + 0xc86: 0x0886, 0xc87: 0x0369, 0xc88: 0x0018, 0xc89: 0x08a5, 0xc8a: 0x0309, 0xc8b: 0x00a9, + 0xc8c: 0x00a9, 0xc8d: 0x00a9, 0xc8e: 0x00a9, 0xc8f: 0x0741, 0xc90: 0x0311, 0xc91: 0x0311, + 0xc92: 0x0101, 0xc93: 0x0101, 0xc94: 0x0018, 0xc95: 0x0329, 0xc96: 0x0749, 0xc97: 0x0018, + 0xc98: 0x0018, 0xc99: 0x0339, 0xc9a: 0x0751, 0xc9b: 0x00b9, 0xc9c: 0x00b9, 0xc9d: 0x00b9, + 0xc9e: 0x0018, 0xc9f: 0x0018, 0xca0: 0x0759, 0xca1: 0x08c5, 0xca2: 0x0761, 0xca3: 0x0018, + 0xca4: 0x04b1, 0xca5: 0x0018, 0xca6: 0x0769, 0xca7: 0x0018, 0xca8: 0x04b1, 0xca9: 0x0018, + 0xcaa: 0x0319, 0xcab: 0x0771, 0xcac: 0x02e9, 0xcad: 0x03d9, 0xcae: 0x0018, 0xcaf: 0x02f9, + 0xcb0: 0x02f9, 0xcb1: 0x03f1, 0xcb2: 0x0040, 0xcb3: 0x0321, 0xcb4: 0x0051, 0xcb5: 0x0779, + 0xcb6: 0x0781, 0xcb7: 0x0789, 0xcb8: 0x0791, 0xcb9: 0x0311, 0xcba: 0x0018, 0xcbb: 0x08e5, + 0xcbc: 0x0799, 0xcbd: 0x03a1, 0xcbe: 0x03a1, 0xcbf: 0x0799, // Block 0x33, offset 0xcc0 - 0xcc0: 0x0905, 0xcc1: 0x0018, 0xcc2: 0x0018, 0xcc3: 0x0018, 0xcc4: 0x0018, 0xcc5: 0x0ef9, - 0xcc6: 0x0ef9, 0xcc7: 0x0f09, 0xcc8: 0x0f41, 0xcc9: 0x0259, 0xcca: 0x0018, 0xccb: 0x0018, - 0xccc: 0x0018, 0xccd: 0x0018, 0xcce: 0x0008, 0xccf: 0x0018, 0xcd0: 0x2121, 0xcd1: 0x2151, - 0xcd2: 0x2181, 0xcd3: 0x21b9, 0xcd4: 0x21e9, 0xcd5: 0x2219, 0xcd6: 0x2249, 0xcd7: 0x2279, - 0xcd8: 0x22a9, 0xcd9: 0x22d9, 0xcda: 0x2309, 0xcdb: 0x2339, 0xcdc: 0x2369, 0xcdd: 0x2399, - 0xcde: 0x23c9, 0xcdf: 0x23f9, 0xce0: 0x0f41, 0xce1: 0x2421, 0xce2: 0x091d, 0xce3: 0x2439, - 0xce4: 0x1089, 0xce5: 0x2451, 0xce6: 0x093d, 0xce7: 0x2469, 0xce8: 0x2491, 0xce9: 0x0369, - 0xcea: 0x24a9, 0xceb: 0x095d, 0xcec: 0x0359, 0xced: 0x1159, 0xcee: 0x0ef9, 0xcef: 0x0f61, - 0xcf0: 0x0f41, 0xcf1: 0x2421, 0xcf2: 0x097d, 0xcf3: 0x2439, 0xcf4: 0x1089, 0xcf5: 0x2451, - 0xcf6: 0x099d, 0xcf7: 0x2469, 0xcf8: 0x2491, 0xcf9: 0x0369, 0xcfa: 0x24a9, 0xcfb: 0x09bd, - 0xcfc: 0x0359, 0xcfd: 0x1159, 0xcfe: 0x0ef9, 0xcff: 0x0f61, + 0xcc0: 0x0905, 0xcc1: 0x0018, 0xcc2: 0x0018, 0xcc3: 0x0018, 0xcc4: 0x0018, 0xcc5: 0x02f1, + 0xcc6: 0x02f1, 0xcc7: 0x02f9, 0xcc8: 0x0311, 0xcc9: 0x00b1, 0xcca: 0x0018, 0xccb: 0x0018, + 0xccc: 0x0018, 0xccd: 0x0018, 0xcce: 0x0008, 0xccf: 0x0018, 0xcd0: 0x07a1, 0xcd1: 0x07a9, + 0xcd2: 0x07b1, 0xcd3: 0x07b9, 0xcd4: 0x07c1, 0xcd5: 0x07c9, 0xcd6: 0x07d1, 0xcd7: 0x07d9, + 0xcd8: 0x07e1, 0xcd9: 0x07e9, 0xcda: 0x07f1, 0xcdb: 0x07f9, 0xcdc: 0x0801, 0xcdd: 0x0809, + 0xcde: 0x0811, 0xcdf: 0x0819, 0xce0: 0x0311, 0xce1: 0x0821, 0xce2: 0x091d, 0xce3: 0x0829, + 0xce4: 0x0391, 0xce5: 0x0831, 0xce6: 0x093d, 0xce7: 0x0839, 0xce8: 0x0841, 0xce9: 0x0109, + 0xcea: 0x0849, 0xceb: 0x095d, 0xcec: 0x0101, 0xced: 0x03d9, 0xcee: 0x02f1, 0xcef: 0x0321, + 0xcf0: 0x0311, 0xcf1: 0x0821, 0xcf2: 0x097d, 0xcf3: 0x0829, 0xcf4: 0x0391, 0xcf5: 0x0831, + 0xcf6: 0x099d, 0xcf7: 0x0839, 0xcf8: 0x0841, 0xcf9: 0x0109, 0xcfa: 0x0849, 0xcfb: 0x09bd, + 0xcfc: 0x0101, 0xcfd: 0x03d9, 0xcfe: 0x02f1, 0xcff: 0x0321, // Block 0x34, offset 0xd00 0xd00: 0x0018, 0xd01: 0x0018, 0xd02: 0x0018, 0xd03: 0x0018, 0xd04: 0x0018, 0xd05: 0x0018, 0xd06: 0x0018, 0xd07: 0x0018, 0xd08: 0x0018, 0xd09: 0x0018, 0xd0a: 0x0018, 0xd0b: 0x0040, 0xd0c: 0x0040, 0xd0d: 0x0040, 0xd0e: 0x0040, 0xd0f: 0x0040, 0xd10: 0x0040, 0xd11: 0x0040, 0xd12: 0x0040, 0xd13: 0x0040, 0xd14: 0x0040, 0xd15: 0x0040, 0xd16: 0x0040, 0xd17: 0x0040, 0xd18: 0x0040, 0xd19: 0x0040, 0xd1a: 0x0040, 0xd1b: 0x0040, 0xd1c: 0x0040, 0xd1d: 0x0040, - 0xd1e: 0x0040, 0xd1f: 0x0040, 0xd20: 0x00c9, 0xd21: 0x0069, 0xd22: 0x0079, 0xd23: 0x1f51, - 0xd24: 0x1f61, 0xd25: 0x1f71, 0xd26: 0x1f81, 0xd27: 0x1f91, 0xd28: 0x1fa1, 0xd29: 0x2601, - 0xd2a: 0x2619, 0xd2b: 0x2631, 0xd2c: 0x2649, 0xd2d: 0x2661, 0xd2e: 0x2679, 0xd2f: 0x2691, - 0xd30: 0x26a9, 0xd31: 0x26c1, 0xd32: 0x26d9, 0xd33: 0x26f1, 0xd34: 0x0a1e, 0xd35: 0x0a3e, + 0xd1e: 0x0040, 0xd1f: 0x0040, 0xd20: 0x0049, 0xd21: 0x0029, 0xd22: 0x0031, 0xd23: 0x06e9, + 0xd24: 0x06f1, 0xd25: 0x06f9, 0xd26: 0x0701, 0xd27: 0x0709, 0xd28: 0x0711, 0xd29: 0x0879, + 0xd2a: 0x0881, 0xd2b: 0x0889, 0xd2c: 0x0891, 0xd2d: 0x0899, 0xd2e: 0x08a1, 0xd2f: 0x08a9, + 0xd30: 0x08b1, 0xd31: 0x08b9, 0xd32: 0x08c1, 0xd33: 0x08c9, 0xd34: 0x0a1e, 0xd35: 0x0a3e, 0xd36: 0x0a5e, 0xd37: 0x0a7e, 0xd38: 0x0a9e, 0xd39: 0x0abe, 0xd3a: 0x0ade, 0xd3b: 0x0afe, - 0xd3c: 0x0b1e, 0xd3d: 0x270a, 0xd3e: 0x2732, 0xd3f: 0x275a, + 0xd3c: 0x0b1e, 0xd3d: 0x08d2, 0xd3e: 0x08da, 0xd3f: 0x08e2, // Block 0x35, offset 0xd40 - 0xd40: 0x2782, 0xd41: 0x27aa, 0xd42: 0x27d2, 0xd43: 0x27fa, 0xd44: 0x2822, 0xd45: 0x284a, - 0xd46: 0x2872, 0xd47: 0x289a, 0xd48: 0x0040, 0xd49: 0x0040, 0xd4a: 0x0040, 0xd4b: 0x0040, + 0xd40: 0x08ea, 0xd41: 0x08f2, 0xd42: 0x08fa, 0xd43: 0x0902, 0xd44: 0x090a, 0xd45: 0x0912, + 0xd46: 0x091a, 0xd47: 0x0922, 0xd48: 0x0040, 0xd49: 0x0040, 0xd4a: 0x0040, 0xd4b: 0x0040, 0xd4c: 0x0040, 0xd4d: 0x0040, 0xd4e: 0x0040, 0xd4f: 0x0040, 0xd50: 0x0040, 0xd51: 0x0040, 0xd52: 0x0040, 0xd53: 0x0040, 0xd54: 0x0040, 0xd55: 0x0040, 0xd56: 0x0040, 0xd57: 0x0040, 0xd58: 0x0040, 0xd59: 0x0040, 0xd5a: 0x0040, 0xd5b: 0x0040, 0xd5c: 0x0b3e, 0xd5d: 0x0b5e, @@ -1203,17 +1346,17 @@ var idnaValues = [8192]uint16{ 0xd64: 0x0c3e, 0xd65: 0x0c5e, 0xd66: 0x0c7e, 0xd67: 0x0c9e, 0xd68: 0x0cbe, 0xd69: 0x0cde, 0xd6a: 0x0cfe, 0xd6b: 0x0d1e, 0xd6c: 0x0d3e, 0xd6d: 0x0d5e, 0xd6e: 0x0d7e, 0xd6f: 0x0d9e, 0xd70: 0x0dbe, 0xd71: 0x0dde, 0xd72: 0x0dfe, 0xd73: 0x0e1e, 0xd74: 0x0e3e, 0xd75: 0x0e5e, - 0xd76: 0x0039, 0xd77: 0x0ee9, 0xd78: 0x1159, 0xd79: 0x0ef9, 0xd7a: 0x0f09, 0xd7b: 0x1199, - 0xd7c: 0x0f31, 0xd7d: 0x0249, 0xd7e: 0x0f41, 0xd7f: 0x0259, + 0xd76: 0x0019, 0xd77: 0x02e9, 0xd78: 0x03d9, 0xd79: 0x02f1, 0xd7a: 0x02f9, 0xd7b: 0x03f1, + 0xd7c: 0x0309, 0xd7d: 0x00a9, 0xd7e: 0x0311, 0xd7f: 0x00b1, // Block 0x36, offset 0xd80 - 0xd80: 0x0f51, 0xd81: 0x0359, 0xd82: 0x0f61, 0xd83: 0x0f71, 0xd84: 0x00d9, 0xd85: 0x0f99, - 0xd86: 0x2039, 0xd87: 0x0269, 0xd88: 0x01d9, 0xd89: 0x0fa9, 0xd8a: 0x0fb9, 0xd8b: 0x1089, - 0xd8c: 0x0279, 0xd8d: 0x0369, 0xd8e: 0x0289, 0xd8f: 0x13d1, 0xd90: 0x0039, 0xd91: 0x0ee9, - 0xd92: 0x1159, 0xd93: 0x0ef9, 0xd94: 0x0f09, 0xd95: 0x1199, 0xd96: 0x0f31, 0xd97: 0x0249, - 0xd98: 0x0f41, 0xd99: 0x0259, 0xd9a: 0x0f51, 0xd9b: 0x0359, 0xd9c: 0x0f61, 0xd9d: 0x0f71, - 0xd9e: 0x00d9, 0xd9f: 0x0f99, 0xda0: 0x2039, 0xda1: 0x0269, 0xda2: 0x01d9, 0xda3: 0x0fa9, - 0xda4: 0x0fb9, 0xda5: 0x1089, 0xda6: 0x0279, 0xda7: 0x0369, 0xda8: 0x0289, 0xda9: 0x13d1, - 0xdaa: 0x1f41, 0xdab: 0x0018, 0xdac: 0x0018, 0xdad: 0x0018, 0xdae: 0x0018, 0xdaf: 0x0018, + 0xd80: 0x0319, 0xd81: 0x0101, 0xd82: 0x0321, 0xd83: 0x0329, 0xd84: 0x0051, 0xd85: 0x0339, + 0xd86: 0x0751, 0xd87: 0x00b9, 0xd88: 0x0089, 0xd89: 0x0341, 0xd8a: 0x0349, 0xd8b: 0x0391, + 0xd8c: 0x00c1, 0xd8d: 0x0109, 0xd8e: 0x00c9, 0xd8f: 0x04b1, 0xd90: 0x0019, 0xd91: 0x02e9, + 0xd92: 0x03d9, 0xd93: 0x02f1, 0xd94: 0x02f9, 0xd95: 0x03f1, 0xd96: 0x0309, 0xd97: 0x00a9, + 0xd98: 0x0311, 0xd99: 0x00b1, 0xd9a: 0x0319, 0xd9b: 0x0101, 0xd9c: 0x0321, 0xd9d: 0x0329, + 0xd9e: 0x0051, 0xd9f: 0x0339, 0xda0: 0x0751, 0xda1: 0x00b9, 0xda2: 0x0089, 0xda3: 0x0341, + 0xda4: 0x0349, 0xda5: 0x0391, 0xda6: 0x00c1, 0xda7: 0x0109, 0xda8: 0x00c9, 0xda9: 0x04b1, + 0xdaa: 0x06e1, 0xdab: 0x0018, 0xdac: 0x0018, 0xdad: 0x0018, 0xdae: 0x0018, 0xdaf: 0x0018, 0xdb0: 0x0018, 0xdb1: 0x0018, 0xdb2: 0x0018, 0xdb3: 0x0018, 0xdb4: 0x0018, 0xdb5: 0x0018, 0xdb6: 0x0018, 0xdb7: 0x0018, 0xdb8: 0x0018, 0xdb9: 0x0018, 0xdba: 0x0018, 0xdbb: 0x0018, 0xdbc: 0x0018, 0xdbd: 0x0018, 0xdbe: 0x0018, 0xdbf: 0x0018, @@ -1223,12 +1366,12 @@ var idnaValues = [8192]uint16{ 0xdcc: 0x0008, 0xdcd: 0x0008, 0xdce: 0x0008, 0xdcf: 0x0008, 0xdd0: 0x0008, 0xdd1: 0x0008, 0xdd2: 0x0008, 0xdd3: 0x0008, 0xdd4: 0x0008, 0xdd5: 0x0008, 0xdd6: 0x0008, 0xdd7: 0x0008, 0xdd8: 0x0008, 0xdd9: 0x0008, 0xdda: 0x0008, 0xddb: 0x0008, 0xddc: 0x0008, 0xddd: 0x0008, - 0xdde: 0x0008, 0xddf: 0x0040, 0xde0: 0xe00d, 0xde1: 0x0008, 0xde2: 0x2971, 0xde3: 0x0ed5, - 0xde4: 0x2989, 0xde5: 0x0008, 0xde6: 0x0008, 0xde7: 0xe07d, 0xde8: 0x0008, 0xde9: 0xe01d, - 0xdea: 0x0008, 0xdeb: 0xe03d, 0xdec: 0x0008, 0xded: 0x0fe1, 0xdee: 0x1281, 0xdef: 0x0fc9, - 0xdf0: 0x1141, 0xdf1: 0x0008, 0xdf2: 0xe00d, 0xdf3: 0x0008, 0xdf4: 0x0008, 0xdf5: 0xe01d, + 0xdde: 0x0008, 0xddf: 0x0040, 0xde0: 0xe00d, 0xde1: 0x0008, 0xde2: 0x0941, 0xde3: 0x0ed5, + 0xde4: 0x0949, 0xde5: 0x0008, 0xde6: 0x0008, 0xde7: 0xe07d, 0xde8: 0x0008, 0xde9: 0xe01d, + 0xdea: 0x0008, 0xdeb: 0xe03d, 0xdec: 0x0008, 0xded: 0x0359, 0xdee: 0x0441, 0xdef: 0x0351, + 0xdf0: 0x03d1, 0xdf1: 0x0008, 0xdf2: 0xe00d, 0xdf3: 0x0008, 0xdf4: 0x0008, 0xdf5: 0xe01d, 0xdf6: 0x0008, 0xdf7: 0x0008, 0xdf8: 0x0008, 0xdf9: 0x0008, 0xdfa: 0x0008, 0xdfb: 0x0008, - 0xdfc: 0x0259, 0xdfd: 0x1089, 0xdfe: 0x29a1, 0xdff: 0x29b9, + 0xdfc: 0x00b1, 0xdfd: 0x0391, 0xdfe: 0x0951, 0xdff: 0x0959, // Block 0x38, offset 0xe00 0xe00: 0xe00d, 0xe01: 0x0008, 0xe02: 0xe00d, 0xe03: 0x0008, 0xe04: 0xe00d, 0xe05: 0x0008, 0xe06: 0xe00d, 0xe07: 0x0008, 0xe08: 0xe00d, 0xe09: 0x0008, 0xe0a: 0xe00d, 0xe0b: 0x0008, @@ -1254,7 +1397,7 @@ var idnaValues = [8192]uint16{ 0xe76: 0x0040, 0xe77: 0x0040, 0xe78: 0x0040, 0xe79: 0x0040, 0xe7a: 0x0040, 0xe7b: 0x0040, 0xe7c: 0x0040, 0xe7d: 0x0040, 0xe7e: 0x0040, 0xe7f: 0x0040, // Block 0x3a, offset 0xe80 - 0xe80: 0x000a, 0xe81: 0x0018, 0xe82: 0x29d1, 0xe83: 0x0018, 0xe84: 0x0018, 0xe85: 0x0008, + 0xe80: 0x000a, 0xe81: 0x0018, 0xe82: 0x0961, 0xe83: 0x0018, 0xe84: 0x0018, 0xe85: 0x0008, 0xe86: 0x0008, 0xe87: 0x0008, 0xe88: 0x0018, 0xe89: 0x0018, 0xe8a: 0x0018, 0xe8b: 0x0018, 0xe8c: 0x0018, 0xe8d: 0x0018, 0xe8e: 0x0018, 0xe8f: 0x0018, 0xe90: 0x0018, 0xe91: 0x0018, 0xe92: 0x0018, 0xe93: 0x0018, 0xe94: 0x0018, 0xe95: 0x0018, 0xe96: 0x0018, 0xe97: 0x0018, @@ -1290,17 +1433,17 @@ var idnaValues = [8192]uint16{ 0xf36: 0x0008, 0xf37: 0x0008, 0xf38: 0x0008, 0xf39: 0x0008, 0xf3a: 0x0008, 0xf3b: 0x0008, 0xf3c: 0x0008, 0xf3d: 0x0008, 0xf3e: 0x0008, 0xf3f: 0x0008, // Block 0x3d, offset 0xf40 - 0xf40: 0x36a2, 0xf41: 0x36d2, 0xf42: 0x3702, 0xf43: 0x3732, 0xf44: 0x32d5, 0xf45: 0x32f5, + 0xf40: 0x0b82, 0xf41: 0x0b8a, 0xf42: 0x0b92, 0xf43: 0x0b9a, 0xf44: 0x32d5, 0xf45: 0x32f5, 0xf46: 0x3315, 0xf47: 0x3335, 0xf48: 0x0018, 0xf49: 0x0018, 0xf4a: 0x0018, 0xf4b: 0x0018, - 0xf4c: 0x0018, 0xf4d: 0x0018, 0xf4e: 0x0018, 0xf4f: 0x0018, 0xf50: 0x3355, 0xf51: 0x3761, - 0xf52: 0x3779, 0xf53: 0x3791, 0xf54: 0x37a9, 0xf55: 0x37c1, 0xf56: 0x37d9, 0xf57: 0x37f1, - 0xf58: 0x3809, 0xf59: 0x3821, 0xf5a: 0x3839, 0xf5b: 0x3851, 0xf5c: 0x3869, 0xf5d: 0x3881, - 0xf5e: 0x3899, 0xf5f: 0x38b1, 0xf60: 0x3375, 0xf61: 0x3395, 0xf62: 0x33b5, 0xf63: 0x33d5, + 0xf4c: 0x0018, 0xf4d: 0x0018, 0xf4e: 0x0018, 0xf4f: 0x0018, 0xf50: 0x3355, 0xf51: 0x0ba1, + 0xf52: 0x0ba9, 0xf53: 0x0bb1, 0xf54: 0x0bb9, 0xf55: 0x0bc1, 0xf56: 0x0bc9, 0xf57: 0x0bd1, + 0xf58: 0x0bd9, 0xf59: 0x0be1, 0xf5a: 0x0be9, 0xf5b: 0x0bf1, 0xf5c: 0x0bf9, 0xf5d: 0x0c01, + 0xf5e: 0x0c09, 0xf5f: 0x0c11, 0xf60: 0x3375, 0xf61: 0x3395, 0xf62: 0x33b5, 0xf63: 0x33d5, 0xf64: 0x33f5, 0xf65: 0x33f5, 0xf66: 0x3415, 0xf67: 0x3435, 0xf68: 0x3455, 0xf69: 0x3475, 0xf6a: 0x3495, 0xf6b: 0x34b5, 0xf6c: 0x34d5, 0xf6d: 0x34f5, 0xf6e: 0x3515, 0xf6f: 0x3535, 0xf70: 0x3555, 0xf71: 0x3575, 0xf72: 0x3595, 0xf73: 0x35b5, 0xf74: 0x35d5, 0xf75: 0x35f5, 0xf76: 0x3615, 0xf77: 0x3635, 0xf78: 0x3655, 0xf79: 0x3675, 0xf7a: 0x3695, 0xf7b: 0x36b5, - 0xf7c: 0x38c9, 0xf7d: 0x3901, 0xf7e: 0x36d5, 0xf7f: 0x0018, + 0xf7c: 0x0c19, 0xf7d: 0x0c21, 0xf7e: 0x36d5, 0xf7f: 0x0018, // Block 0x3e, offset 0xf80 0xf80: 0x36f5, 0xf81: 0x3715, 0xf82: 0x3735, 0xf83: 0x3755, 0xf84: 0x3775, 0xf85: 0x3795, 0xf86: 0x37b5, 0xf87: 0x37d5, 0xf88: 0x37f5, 0xf89: 0x3815, 0xf8a: 0x3835, 0xf8b: 0x3855, @@ -1310,13 +1453,13 @@ var idnaValues = [8192]uint16{ 0xf9e: 0x3ab5, 0xf9f: 0x3ad5, 0xfa0: 0x3af5, 0xfa1: 0x3b15, 0xfa2: 0x3b35, 0xfa3: 0x3b55, 0xfa4: 0x3b75, 0xfa5: 0x3b95, 0xfa6: 0x1295, 0xfa7: 0x3bb5, 0xfa8: 0x3bd5, 0xfa9: 0x3bf5, 0xfaa: 0x3c15, 0xfab: 0x3c35, 0xfac: 0x3c55, 0xfad: 0x3c75, 0xfae: 0x23b5, 0xfaf: 0x3c95, - 0xfb0: 0x3cb5, 0xfb1: 0x3939, 0xfb2: 0x3951, 0xfb3: 0x3969, 0xfb4: 0x3981, 0xfb5: 0x3999, - 0xfb6: 0x39b1, 0xfb7: 0x39c9, 0xfb8: 0x39e1, 0xfb9: 0x39f9, 0xfba: 0x3a11, 0xfbb: 0x3a29, - 0xfbc: 0x3a41, 0xfbd: 0x3a59, 0xfbe: 0x3a71, 0xfbf: 0x3a89, + 0xfb0: 0x3cb5, 0xfb1: 0x0c29, 0xfb2: 0x0c31, 0xfb3: 0x0c39, 0xfb4: 0x0c41, 0xfb5: 0x0c49, + 0xfb6: 0x0c51, 0xfb7: 0x0c59, 0xfb8: 0x0c61, 0xfb9: 0x0c69, 0xfba: 0x0c71, 0xfbb: 0x0c79, + 0xfbc: 0x0c81, 0xfbd: 0x0c89, 0xfbe: 0x0c91, 0xfbf: 0x0c99, // Block 0x3f, offset 0xfc0 - 0xfc0: 0x3aa1, 0xfc1: 0x3ac9, 0xfc2: 0x3af1, 0xfc3: 0x3b19, 0xfc4: 0x3b41, 0xfc5: 0x3b69, - 0xfc6: 0x3b91, 0xfc7: 0x3bb9, 0xfc8: 0x3be1, 0xfc9: 0x3c09, 0xfca: 0x3c39, 0xfcb: 0x3c69, - 0xfcc: 0x3c99, 0xfcd: 0x3cd5, 0xfce: 0x3cb1, 0xfcf: 0x3cf5, 0xfd0: 0x3d15, 0xfd1: 0x3d2d, + 0xfc0: 0x0ca1, 0xfc1: 0x0ca9, 0xfc2: 0x0cb1, 0xfc3: 0x0cb9, 0xfc4: 0x0cc1, 0xfc5: 0x0cc9, + 0xfc6: 0x0cd1, 0xfc7: 0x0cd9, 0xfc8: 0x0ce1, 0xfc9: 0x0ce9, 0xfca: 0x0cf1, 0xfcb: 0x0cf9, + 0xfcc: 0x0d01, 0xfcd: 0x3cd5, 0xfce: 0x0d09, 0xfcf: 0x3cf5, 0xfd0: 0x3d15, 0xfd1: 0x3d2d, 0xfd2: 0x3d45, 0xfd3: 0x3d5d, 0xfd4: 0x3d75, 0xfd5: 0x3d75, 0xfd6: 0x3d5d, 0xfd7: 0x3d8d, 0xfd8: 0x07d5, 0xfd9: 0x3da5, 0xfda: 0x3dbd, 0xfdb: 0x3dd5, 0xfdc: 0x3ded, 0xfdd: 0x3e05, 0xfde: 0x3e1d, 0xfdf: 0x3e35, 0xfe0: 0x3e4d, 0xfe1: 0x3e65, 0xfe2: 0x3e7d, 0xfe3: 0x3e95, @@ -1324,769 +1467,769 @@ var idnaValues = [8192]uint16{ 0xfea: 0x3ef5, 0xfeb: 0x3f0d, 0xfec: 0x3f25, 0xfed: 0x3f3d, 0xfee: 0x3f55, 0xfef: 0x3f55, 0xff0: 0x3f6d, 0xff1: 0x3f6d, 0xff2: 0x3f6d, 0xff3: 0x3f85, 0xff4: 0x3f9d, 0xff5: 0x3fb5, 0xff6: 0x3fcd, 0xff7: 0x3fb5, 0xff8: 0x3fe5, 0xff9: 0x3ffd, 0xffa: 0x3f85, 0xffb: 0x4015, - 0xffc: 0x402d, 0xffd: 0x402d, 0xffe: 0x402d, 0xfff: 0x3cc9, + 0xffc: 0x402d, 0xffd: 0x402d, 0xffe: 0x402d, 0xfff: 0x0d11, // Block 0x40, offset 0x1000 - 0x1000: 0x3d01, 0x1001: 0x3d69, 0x1002: 0x3dd1, 0x1003: 0x3e39, 0x1004: 0x3e89, 0x1005: 0x3ef1, - 0x1006: 0x3f41, 0x1007: 0x3f91, 0x1008: 0x4011, 0x1009: 0x4079, 0x100a: 0x40c9, 0x100b: 0x4119, - 0x100c: 0x4169, 0x100d: 0x41d1, 0x100e: 0x4239, 0x100f: 0x4289, 0x1010: 0x42d9, 0x1011: 0x4311, - 0x1012: 0x4361, 0x1013: 0x43c9, 0x1014: 0x4431, 0x1015: 0x4469, 0x1016: 0x44e9, 0x1017: 0x4581, - 0x1018: 0x4601, 0x1019: 0x4651, 0x101a: 0x46d1, 0x101b: 0x4751, 0x101c: 0x47b9, 0x101d: 0x4809, - 0x101e: 0x4859, 0x101f: 0x48a9, 0x1020: 0x4911, 0x1021: 0x4991, 0x1022: 0x49f9, 0x1023: 0x4a49, - 0x1024: 0x4a99, 0x1025: 0x4ae9, 0x1026: 0x4b21, 0x1027: 0x4b59, 0x1028: 0x4b91, 0x1029: 0x4bc9, - 0x102a: 0x4c19, 0x102b: 0x4c69, 0x102c: 0x4ce9, 0x102d: 0x4d39, 0x102e: 0x4da1, 0x102f: 0x4e21, - 0x1030: 0x4e71, 0x1031: 0x4ea9, 0x1032: 0x4ee1, 0x1033: 0x4f61, 0x1034: 0x4fc9, 0x1035: 0x5049, - 0x1036: 0x5099, 0x1037: 0x5119, 0x1038: 0x5151, 0x1039: 0x51a1, 0x103a: 0x51f1, 0x103b: 0x5241, - 0x103c: 0x5291, 0x103d: 0x52e1, 0x103e: 0x5349, 0x103f: 0x5399, + 0x1000: 0x10f9, 0x1001: 0x1101, 0x1002: 0x40a5, 0x1003: 0x1109, 0x1004: 0x1111, 0x1005: 0x1119, + 0x1006: 0x1121, 0x1007: 0x1129, 0x1008: 0x40c5, 0x1009: 0x1131, 0x100a: 0x1139, 0x100b: 0x1141, + 0x100c: 0x40e5, 0x100d: 0x40e5, 0x100e: 0x1149, 0x100f: 0x1151, 0x1010: 0x1159, 0x1011: 0x4105, + 0x1012: 0x4125, 0x1013: 0x4145, 0x1014: 0x4165, 0x1015: 0x4185, 0x1016: 0x1161, 0x1017: 0x1169, + 0x1018: 0x1171, 0x1019: 0x1179, 0x101a: 0x1181, 0x101b: 0x41a5, 0x101c: 0x1189, 0x101d: 0x1191, + 0x101e: 0x1199, 0x101f: 0x41c5, 0x1020: 0x41e5, 0x1021: 0x11a1, 0x1022: 0x4205, 0x1023: 0x4225, + 0x1024: 0x4245, 0x1025: 0x11a9, 0x1026: 0x4265, 0x1027: 0x11b1, 0x1028: 0x11b9, 0x1029: 0x10f9, + 0x102a: 0x4285, 0x102b: 0x42a5, 0x102c: 0x42c5, 0x102d: 0x42e5, 0x102e: 0x11c1, 0x102f: 0x11c9, + 0x1030: 0x11d1, 0x1031: 0x11d9, 0x1032: 0x4305, 0x1033: 0x11e1, 0x1034: 0x11e9, 0x1035: 0x11f1, + 0x1036: 0x4325, 0x1037: 0x11f9, 0x1038: 0x1201, 0x1039: 0x11f9, 0x103a: 0x1209, 0x103b: 0x1211, + 0x103c: 0x4345, 0x103d: 0x1219, 0x103e: 0x1221, 0x103f: 0x1219, // Block 0x41, offset 0x1040 - 0x1040: 0x53d1, 0x1041: 0x5421, 0x1042: 0x5471, 0x1043: 0x54c1, 0x1044: 0x5529, 0x1045: 0x5579, - 0x1046: 0x55c9, 0x1047: 0x5619, 0x1048: 0x5699, 0x1049: 0x5701, 0x104a: 0x5739, 0x104b: 0x57b9, - 0x104c: 0x57f1, 0x104d: 0x5859, 0x104e: 0x58c1, 0x104f: 0x5911, 0x1050: 0x5961, 0x1051: 0x59b1, - 0x1052: 0x5a19, 0x1053: 0x5a51, 0x1054: 0x5aa1, 0x1055: 0x5b09, 0x1056: 0x5b41, 0x1057: 0x5bc1, - 0x1058: 0x5c11, 0x1059: 0x5c39, 0x105a: 0x5c61, 0x105b: 0x5c89, 0x105c: 0x5cb1, 0x105d: 0x5cd9, - 0x105e: 0x5d01, 0x105f: 0x5d29, 0x1060: 0x5d51, 0x1061: 0x5d79, 0x1062: 0x5da1, 0x1063: 0x5dd1, - 0x1064: 0x5e01, 0x1065: 0x5e31, 0x1066: 0x5e61, 0x1067: 0x5e91, 0x1068: 0x5ec1, 0x1069: 0x5ef1, - 0x106a: 0x5f21, 0x106b: 0x5f51, 0x106c: 0x5f81, 0x106d: 0x5fb1, 0x106e: 0x5fe1, 0x106f: 0x6011, - 0x1070: 0x6041, 0x1071: 0x4045, 0x1072: 0x6071, 0x1073: 0x6089, 0x1074: 0x4065, 0x1075: 0x60a1, - 0x1076: 0x60b9, 0x1077: 0x60d1, 0x1078: 0x4085, 0x1079: 0x4085, 0x107a: 0x60e9, 0x107b: 0x6101, - 0x107c: 0x6139, 0x107d: 0x6171, 0x107e: 0x61a9, 0x107f: 0x61e1, + 0x1040: 0x4365, 0x1041: 0x4385, 0x1042: 0x0040, 0x1043: 0x1229, 0x1044: 0x1231, 0x1045: 0x1239, + 0x1046: 0x1241, 0x1047: 0x0040, 0x1048: 0x1249, 0x1049: 0x1251, 0x104a: 0x1259, 0x104b: 0x1261, + 0x104c: 0x1269, 0x104d: 0x1271, 0x104e: 0x1199, 0x104f: 0x1279, 0x1050: 0x1281, 0x1051: 0x1289, + 0x1052: 0x43a5, 0x1053: 0x1291, 0x1054: 0x1121, 0x1055: 0x43c5, 0x1056: 0x43e5, 0x1057: 0x1299, + 0x1058: 0x0040, 0x1059: 0x4405, 0x105a: 0x12a1, 0x105b: 0x12a9, 0x105c: 0x12b1, 0x105d: 0x12b9, + 0x105e: 0x12c1, 0x105f: 0x12c9, 0x1060: 0x12d1, 0x1061: 0x12d9, 0x1062: 0x12e1, 0x1063: 0x12e9, + 0x1064: 0x12f1, 0x1065: 0x12f9, 0x1066: 0x1301, 0x1067: 0x1309, 0x1068: 0x1311, 0x1069: 0x1319, + 0x106a: 0x1321, 0x106b: 0x1329, 0x106c: 0x1331, 0x106d: 0x1339, 0x106e: 0x1341, 0x106f: 0x1349, + 0x1070: 0x1351, 0x1071: 0x1359, 0x1072: 0x1361, 0x1073: 0x1369, 0x1074: 0x1371, 0x1075: 0x1379, + 0x1076: 0x1381, 0x1077: 0x1389, 0x1078: 0x1391, 0x1079: 0x1399, 0x107a: 0x13a1, 0x107b: 0x13a9, + 0x107c: 0x13b1, 0x107d: 0x13b9, 0x107e: 0x13c1, 0x107f: 0x4425, // Block 0x42, offset 0x1080 - 0x1080: 0x6249, 0x1081: 0x6261, 0x1082: 0x40a5, 0x1083: 0x6279, 0x1084: 0x6291, 0x1085: 0x62a9, - 0x1086: 0x62c1, 0x1087: 0x62d9, 0x1088: 0x40c5, 0x1089: 0x62f1, 0x108a: 0x6319, 0x108b: 0x6331, - 0x108c: 0x40e5, 0x108d: 0x40e5, 0x108e: 0x6349, 0x108f: 0x6361, 0x1090: 0x6379, 0x1091: 0x4105, - 0x1092: 0x4125, 0x1093: 0x4145, 0x1094: 0x4165, 0x1095: 0x4185, 0x1096: 0x6391, 0x1097: 0x63a9, - 0x1098: 0x63c1, 0x1099: 0x63d9, 0x109a: 0x63f1, 0x109b: 0x41a5, 0x109c: 0x6409, 0x109d: 0x6421, - 0x109e: 0x6439, 0x109f: 0x41c5, 0x10a0: 0x41e5, 0x10a1: 0x6451, 0x10a2: 0x4205, 0x10a3: 0x4225, - 0x10a4: 0x4245, 0x10a5: 0x6469, 0x10a6: 0x4265, 0x10a7: 0x6481, 0x10a8: 0x64b1, 0x10a9: 0x6249, - 0x10aa: 0x4285, 0x10ab: 0x42a5, 0x10ac: 0x42c5, 0x10ad: 0x42e5, 0x10ae: 0x64e9, 0x10af: 0x6529, - 0x10b0: 0x6571, 0x10b1: 0x6589, 0x10b2: 0x4305, 0x10b3: 0x65a1, 0x10b4: 0x65b9, 0x10b5: 0x65d1, - 0x10b6: 0x4325, 0x10b7: 0x65e9, 0x10b8: 0x6601, 0x10b9: 0x65e9, 0x10ba: 0x6619, 0x10bb: 0x6631, - 0x10bc: 0x4345, 0x10bd: 0x6649, 0x10be: 0x6661, 0x10bf: 0x6649, + 0x1080: 0xe00d, 0x1081: 0x0008, 0x1082: 0xe00d, 0x1083: 0x0008, 0x1084: 0xe00d, 0x1085: 0x0008, + 0x1086: 0xe00d, 0x1087: 0x0008, 0x1088: 0xe00d, 0x1089: 0x0008, 0x108a: 0xe00d, 0x108b: 0x0008, + 0x108c: 0xe00d, 0x108d: 0x0008, 0x108e: 0xe00d, 0x108f: 0x0008, 0x1090: 0xe00d, 0x1091: 0x0008, + 0x1092: 0xe00d, 0x1093: 0x0008, 0x1094: 0xe00d, 0x1095: 0x0008, 0x1096: 0xe00d, 0x1097: 0x0008, + 0x1098: 0xe00d, 0x1099: 0x0008, 0x109a: 0xe00d, 0x109b: 0x0008, 0x109c: 0xe00d, 0x109d: 0x0008, + 0x109e: 0xe00d, 0x109f: 0x0008, 0x10a0: 0xe00d, 0x10a1: 0x0008, 0x10a2: 0xe00d, 0x10a3: 0x0008, + 0x10a4: 0xe00d, 0x10a5: 0x0008, 0x10a6: 0xe00d, 0x10a7: 0x0008, 0x10a8: 0xe00d, 0x10a9: 0x0008, + 0x10aa: 0xe00d, 0x10ab: 0x0008, 0x10ac: 0xe00d, 0x10ad: 0x0008, 0x10ae: 0x0008, 0x10af: 0x3308, + 0x10b0: 0x3318, 0x10b1: 0x3318, 0x10b2: 0x3318, 0x10b3: 0x0018, 0x10b4: 0x3308, 0x10b5: 0x3308, + 0x10b6: 0x3308, 0x10b7: 0x3308, 0x10b8: 0x3308, 0x10b9: 0x3308, 0x10ba: 0x3308, 0x10bb: 0x3308, + 0x10bc: 0x3308, 0x10bd: 0x3308, 0x10be: 0x0018, 0x10bf: 0x0008, // Block 0x43, offset 0x10c0 - 0x10c0: 0x4365, 0x10c1: 0x4385, 0x10c2: 0x0040, 0x10c3: 0x6679, 0x10c4: 0x6691, 0x10c5: 0x66a9, - 0x10c6: 0x66c1, 0x10c7: 0x0040, 0x10c8: 0x66f9, 0x10c9: 0x6711, 0x10ca: 0x6729, 0x10cb: 0x6741, - 0x10cc: 0x6759, 0x10cd: 0x6771, 0x10ce: 0x6439, 0x10cf: 0x6789, 0x10d0: 0x67a1, 0x10d1: 0x67b9, - 0x10d2: 0x43a5, 0x10d3: 0x67d1, 0x10d4: 0x62c1, 0x10d5: 0x43c5, 0x10d6: 0x43e5, 0x10d7: 0x67e9, - 0x10d8: 0x0040, 0x10d9: 0x4405, 0x10da: 0x6801, 0x10db: 0x6819, 0x10dc: 0x6831, 0x10dd: 0x6849, - 0x10de: 0x6861, 0x10df: 0x6891, 0x10e0: 0x68c1, 0x10e1: 0x68e9, 0x10e2: 0x6911, 0x10e3: 0x6939, - 0x10e4: 0x6961, 0x10e5: 0x6989, 0x10e6: 0x69b1, 0x10e7: 0x69d9, 0x10e8: 0x6a01, 0x10e9: 0x6a29, - 0x10ea: 0x6a59, 0x10eb: 0x6a89, 0x10ec: 0x6ab9, 0x10ed: 0x6ae9, 0x10ee: 0x6b19, 0x10ef: 0x6b49, - 0x10f0: 0x6b79, 0x10f1: 0x6ba9, 0x10f2: 0x6bd9, 0x10f3: 0x6c09, 0x10f4: 0x6c39, 0x10f5: 0x6c69, - 0x10f6: 0x6c99, 0x10f7: 0x6cc9, 0x10f8: 0x6cf9, 0x10f9: 0x6d29, 0x10fa: 0x6d59, 0x10fb: 0x6d89, - 0x10fc: 0x6db9, 0x10fd: 0x6de9, 0x10fe: 0x6e19, 0x10ff: 0x4425, + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0x02d1, 0x10dd: 0x13c9, + 0x10de: 0x3308, 0x10df: 0x3308, 0x10e0: 0x0008, 0x10e1: 0x0008, 0x10e2: 0x0008, 0x10e3: 0x0008, + 0x10e4: 0x0008, 0x10e5: 0x0008, 0x10e6: 0x0008, 0x10e7: 0x0008, 0x10e8: 0x0008, 0x10e9: 0x0008, + 0x10ea: 0x0008, 0x10eb: 0x0008, 0x10ec: 0x0008, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x0008, + 0x10f0: 0x0008, 0x10f1: 0x0008, 0x10f2: 0x0008, 0x10f3: 0x0008, 0x10f4: 0x0008, 0x10f5: 0x0008, + 0x10f6: 0x0008, 0x10f7: 0x0008, 0x10f8: 0x0008, 0x10f9: 0x0008, 0x10fa: 0x0008, 0x10fb: 0x0008, + 0x10fc: 0x0008, 0x10fd: 0x0008, 0x10fe: 0x0008, 0x10ff: 0x0008, // Block 0x44, offset 0x1100 - 0x1100: 0xe00d, 0x1101: 0x0008, 0x1102: 0xe00d, 0x1103: 0x0008, 0x1104: 0xe00d, 0x1105: 0x0008, - 0x1106: 0xe00d, 0x1107: 0x0008, 0x1108: 0xe00d, 0x1109: 0x0008, 0x110a: 0xe00d, 0x110b: 0x0008, - 0x110c: 0xe00d, 0x110d: 0x0008, 0x110e: 0xe00d, 0x110f: 0x0008, 0x1110: 0xe00d, 0x1111: 0x0008, - 0x1112: 0xe00d, 0x1113: 0x0008, 0x1114: 0xe00d, 0x1115: 0x0008, 0x1116: 0xe00d, 0x1117: 0x0008, - 0x1118: 0xe00d, 0x1119: 0x0008, 0x111a: 0xe00d, 0x111b: 0x0008, 0x111c: 0xe00d, 0x111d: 0x0008, - 0x111e: 0xe00d, 0x111f: 0x0008, 0x1120: 0xe00d, 0x1121: 0x0008, 0x1122: 0xe00d, 0x1123: 0x0008, + 0x1100: 0x0018, 0x1101: 0x0018, 0x1102: 0x0018, 0x1103: 0x0018, 0x1104: 0x0018, 0x1105: 0x0018, + 0x1106: 0x0018, 0x1107: 0x0018, 0x1108: 0x0018, 0x1109: 0x0018, 0x110a: 0x0018, 0x110b: 0x0018, + 0x110c: 0x0018, 0x110d: 0x0018, 0x110e: 0x0018, 0x110f: 0x0018, 0x1110: 0x0018, 0x1111: 0x0018, + 0x1112: 0x0018, 0x1113: 0x0018, 0x1114: 0x0018, 0x1115: 0x0018, 0x1116: 0x0018, 0x1117: 0x0008, + 0x1118: 0x0008, 0x1119: 0x0008, 0x111a: 0x0008, 0x111b: 0x0008, 0x111c: 0x0008, 0x111d: 0x0008, + 0x111e: 0x0008, 0x111f: 0x0008, 0x1120: 0x0018, 0x1121: 0x0018, 0x1122: 0xe00d, 0x1123: 0x0008, 0x1124: 0xe00d, 0x1125: 0x0008, 0x1126: 0xe00d, 0x1127: 0x0008, 0x1128: 0xe00d, 0x1129: 0x0008, - 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0x0008, 0x112f: 0x3308, - 0x1130: 0x3318, 0x1131: 0x3318, 0x1132: 0x3318, 0x1133: 0x0018, 0x1134: 0x3308, 0x1135: 0x3308, - 0x1136: 0x3308, 0x1137: 0x3308, 0x1138: 0x3308, 0x1139: 0x3308, 0x113a: 0x3308, 0x113b: 0x3308, - 0x113c: 0x3308, 0x113d: 0x3308, 0x113e: 0x0018, 0x113f: 0x0008, + 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0xe00d, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0xe00d, 0x1133: 0x0008, 0x1134: 0xe00d, 0x1135: 0x0008, + 0x1136: 0xe00d, 0x1137: 0x0008, 0x1138: 0xe00d, 0x1139: 0x0008, 0x113a: 0xe00d, 0x113b: 0x0008, + 0x113c: 0xe00d, 0x113d: 0x0008, 0x113e: 0xe00d, 0x113f: 0x0008, // Block 0x45, offset 0x1140 0x1140: 0xe00d, 0x1141: 0x0008, 0x1142: 0xe00d, 0x1143: 0x0008, 0x1144: 0xe00d, 0x1145: 0x0008, 0x1146: 0xe00d, 0x1147: 0x0008, 0x1148: 0xe00d, 0x1149: 0x0008, 0x114a: 0xe00d, 0x114b: 0x0008, 0x114c: 0xe00d, 0x114d: 0x0008, 0x114e: 0xe00d, 0x114f: 0x0008, 0x1150: 0xe00d, 0x1151: 0x0008, 0x1152: 0xe00d, 0x1153: 0x0008, 0x1154: 0xe00d, 0x1155: 0x0008, 0x1156: 0xe00d, 0x1157: 0x0008, - 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0x0ea1, 0x115d: 0x6e49, - 0x115e: 0x3308, 0x115f: 0x3308, 0x1160: 0x0008, 0x1161: 0x0008, 0x1162: 0x0008, 0x1163: 0x0008, - 0x1164: 0x0008, 0x1165: 0x0008, 0x1166: 0x0008, 0x1167: 0x0008, 0x1168: 0x0008, 0x1169: 0x0008, - 0x116a: 0x0008, 0x116b: 0x0008, 0x116c: 0x0008, 0x116d: 0x0008, 0x116e: 0x0008, 0x116f: 0x0008, - 0x1170: 0x0008, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, - 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0x0008, 0x117a: 0x0008, 0x117b: 0x0008, - 0x117c: 0x0008, 0x117d: 0x0008, 0x117e: 0x0008, 0x117f: 0x0008, + 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0xe00d, 0x115d: 0x0008, + 0x115e: 0xe00d, 0x115f: 0x0008, 0x1160: 0xe00d, 0x1161: 0x0008, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0xe0fd, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, + 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0xe01d, 0x117a: 0x0008, 0x117b: 0xe03d, + 0x117c: 0x0008, 0x117d: 0x4445, 0x117e: 0xe00d, 0x117f: 0x0008, // Block 0x46, offset 0x1180 - 0x1180: 0x0018, 0x1181: 0x0018, 0x1182: 0x0018, 0x1183: 0x0018, 0x1184: 0x0018, 0x1185: 0x0018, - 0x1186: 0x0018, 0x1187: 0x0018, 0x1188: 0x0018, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0x0018, - 0x118c: 0x0018, 0x118d: 0x0018, 0x118e: 0x0018, 0x118f: 0x0018, 0x1190: 0x0018, 0x1191: 0x0018, - 0x1192: 0x0018, 0x1193: 0x0018, 0x1194: 0x0018, 0x1195: 0x0018, 0x1196: 0x0018, 0x1197: 0x0008, - 0x1198: 0x0008, 0x1199: 0x0008, 0x119a: 0x0008, 0x119b: 0x0008, 0x119c: 0x0008, 0x119d: 0x0008, - 0x119e: 0x0008, 0x119f: 0x0008, 0x11a0: 0x0018, 0x11a1: 0x0018, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0x0008, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0xe03d, + 0x118c: 0x0008, 0x118d: 0x0409, 0x118e: 0x0008, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0x0008, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, - 0x11aa: 0xe00d, 0x11ab: 0x0008, 0x11ac: 0xe00d, 0x11ad: 0x0008, 0x11ae: 0xe00d, 0x11af: 0x0008, - 0x11b0: 0x0008, 0x11b1: 0x0008, 0x11b2: 0xe00d, 0x11b3: 0x0008, 0x11b4: 0xe00d, 0x11b5: 0x0008, + 0x11aa: 0x13d1, 0x11ab: 0x0371, 0x11ac: 0x0401, 0x11ad: 0x13d9, 0x11ae: 0x0421, 0x11af: 0x0008, + 0x11b0: 0x13e1, 0x11b1: 0x13e9, 0x11b2: 0x0429, 0x11b3: 0x4465, 0x11b4: 0xe00d, 0x11b5: 0x0008, 0x11b6: 0xe00d, 0x11b7: 0x0008, 0x11b8: 0xe00d, 0x11b9: 0x0008, 0x11ba: 0xe00d, 0x11bb: 0x0008, 0x11bc: 0xe00d, 0x11bd: 0x0008, 0x11be: 0xe00d, 0x11bf: 0x0008, // Block 0x47, offset 0x11c0 - 0x11c0: 0xe00d, 0x11c1: 0x0008, 0x11c2: 0xe00d, 0x11c3: 0x0008, 0x11c4: 0xe00d, 0x11c5: 0x0008, - 0x11c6: 0xe00d, 0x11c7: 0x0008, 0x11c8: 0xe00d, 0x11c9: 0x0008, 0x11ca: 0xe00d, 0x11cb: 0x0008, - 0x11cc: 0xe00d, 0x11cd: 0x0008, 0x11ce: 0xe00d, 0x11cf: 0x0008, 0x11d0: 0xe00d, 0x11d1: 0x0008, - 0x11d2: 0xe00d, 0x11d3: 0x0008, 0x11d4: 0xe00d, 0x11d5: 0x0008, 0x11d6: 0xe00d, 0x11d7: 0x0008, - 0x11d8: 0xe00d, 0x11d9: 0x0008, 0x11da: 0xe00d, 0x11db: 0x0008, 0x11dc: 0xe00d, 0x11dd: 0x0008, - 0x11de: 0xe00d, 0x11df: 0x0008, 0x11e0: 0xe00d, 0x11e1: 0x0008, 0x11e2: 0xe00d, 0x11e3: 0x0008, - 0x11e4: 0xe00d, 0x11e5: 0x0008, 0x11e6: 0xe00d, 0x11e7: 0x0008, 0x11e8: 0xe00d, 0x11e9: 0x0008, - 0x11ea: 0xe00d, 0x11eb: 0x0008, 0x11ec: 0xe00d, 0x11ed: 0x0008, 0x11ee: 0xe00d, 0x11ef: 0x0008, - 0x11f0: 0xe0fd, 0x11f1: 0x0008, 0x11f2: 0x0008, 0x11f3: 0x0008, 0x11f4: 0x0008, 0x11f5: 0x0008, - 0x11f6: 0x0008, 0x11f7: 0x0008, 0x11f8: 0x0008, 0x11f9: 0xe01d, 0x11fa: 0x0008, 0x11fb: 0xe03d, - 0x11fc: 0x0008, 0x11fd: 0x4445, 0x11fe: 0xe00d, 0x11ff: 0x0008, + 0x11c0: 0x650d, 0x11c1: 0x652d, 0x11c2: 0x654d, 0x11c3: 0x656d, 0x11c4: 0x658d, 0x11c5: 0x65ad, + 0x11c6: 0x65cd, 0x11c7: 0x65ed, 0x11c8: 0x660d, 0x11c9: 0x662d, 0x11ca: 0x664d, 0x11cb: 0x666d, + 0x11cc: 0x668d, 0x11cd: 0x66ad, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0x66cd, 0x11d1: 0x0008, + 0x11d2: 0x66ed, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x670d, 0x11d6: 0x672d, 0x11d7: 0x674d, + 0x11d8: 0x676d, 0x11d9: 0x678d, 0x11da: 0x67ad, 0x11db: 0x67cd, 0x11dc: 0x67ed, 0x11dd: 0x680d, + 0x11de: 0x682d, 0x11df: 0x0008, 0x11e0: 0x684d, 0x11e1: 0x0008, 0x11e2: 0x686d, 0x11e3: 0x0008, + 0x11e4: 0x0008, 0x11e5: 0x688d, 0x11e6: 0x68ad, 0x11e7: 0x0008, 0x11e8: 0x0008, 0x11e9: 0x0008, + 0x11ea: 0x68cd, 0x11eb: 0x68ed, 0x11ec: 0x690d, 0x11ed: 0x692d, 0x11ee: 0x694d, 0x11ef: 0x696d, + 0x11f0: 0x698d, 0x11f1: 0x69ad, 0x11f2: 0x69cd, 0x11f3: 0x69ed, 0x11f4: 0x6a0d, 0x11f5: 0x6a2d, + 0x11f6: 0x6a4d, 0x11f7: 0x6a6d, 0x11f8: 0x6a8d, 0x11f9: 0x6aad, 0x11fa: 0x6acd, 0x11fb: 0x6aed, + 0x11fc: 0x6b0d, 0x11fd: 0x6b2d, 0x11fe: 0x6b4d, 0x11ff: 0x6b6d, // Block 0x48, offset 0x1200 - 0x1200: 0xe00d, 0x1201: 0x0008, 0x1202: 0xe00d, 0x1203: 0x0008, 0x1204: 0xe00d, 0x1205: 0x0008, - 0x1206: 0xe00d, 0x1207: 0x0008, 0x1208: 0x0008, 0x1209: 0x0018, 0x120a: 0x0018, 0x120b: 0xe03d, - 0x120c: 0x0008, 0x120d: 0x11d9, 0x120e: 0x0008, 0x120f: 0x0008, 0x1210: 0xe00d, 0x1211: 0x0008, - 0x1212: 0xe00d, 0x1213: 0x0008, 0x1214: 0x0008, 0x1215: 0x0008, 0x1216: 0xe00d, 0x1217: 0x0008, - 0x1218: 0xe00d, 0x1219: 0x0008, 0x121a: 0xe00d, 0x121b: 0x0008, 0x121c: 0xe00d, 0x121d: 0x0008, - 0x121e: 0xe00d, 0x121f: 0x0008, 0x1220: 0xe00d, 0x1221: 0x0008, 0x1222: 0xe00d, 0x1223: 0x0008, - 0x1224: 0xe00d, 0x1225: 0x0008, 0x1226: 0xe00d, 0x1227: 0x0008, 0x1228: 0xe00d, 0x1229: 0x0008, - 0x122a: 0x6e61, 0x122b: 0x1029, 0x122c: 0x11c1, 0x122d: 0x6e79, 0x122e: 0x1221, 0x122f: 0x0008, - 0x1230: 0x6e91, 0x1231: 0x6ea9, 0x1232: 0x1239, 0x1233: 0x4465, 0x1234: 0xe00d, 0x1235: 0x0008, - 0x1236: 0xe00d, 0x1237: 0x0008, 0x1238: 0xe00d, 0x1239: 0x0008, 0x123a: 0xe00d, 0x123b: 0x0008, - 0x123c: 0xe00d, 0x123d: 0x0008, 0x123e: 0xe00d, 0x123f: 0x0008, + 0x1200: 0x7acd, 0x1201: 0x7aed, 0x1202: 0x7b0d, 0x1203: 0x7b2d, 0x1204: 0x7b4d, 0x1205: 0x7b6d, + 0x1206: 0x7b8d, 0x1207: 0x7bad, 0x1208: 0x7bcd, 0x1209: 0x7bed, 0x120a: 0x7c0d, 0x120b: 0x7c2d, + 0x120c: 0x7c4d, 0x120d: 0x7c6d, 0x120e: 0x7c8d, 0x120f: 0x1409, 0x1210: 0x1411, 0x1211: 0x1419, + 0x1212: 0x7cad, 0x1213: 0x7ccd, 0x1214: 0x7ced, 0x1215: 0x1421, 0x1216: 0x1429, 0x1217: 0x1431, + 0x1218: 0x7d0d, 0x1219: 0x7d2d, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x0040, 0x1233: 0x0040, 0x1234: 0x0040, 0x1235: 0x0040, + 0x1236: 0x0040, 0x1237: 0x0040, 0x1238: 0x0040, 0x1239: 0x0040, 0x123a: 0x0040, 0x123b: 0x0040, + 0x123c: 0x0040, 0x123d: 0x0040, 0x123e: 0x0040, 0x123f: 0x0040, // Block 0x49, offset 0x1240 - 0x1240: 0x650d, 0x1241: 0x652d, 0x1242: 0x654d, 0x1243: 0x656d, 0x1244: 0x658d, 0x1245: 0x65ad, - 0x1246: 0x65cd, 0x1247: 0x65ed, 0x1248: 0x660d, 0x1249: 0x662d, 0x124a: 0x664d, 0x124b: 0x666d, - 0x124c: 0x668d, 0x124d: 0x66ad, 0x124e: 0x0008, 0x124f: 0x0008, 0x1250: 0x66cd, 0x1251: 0x0008, - 0x1252: 0x66ed, 0x1253: 0x0008, 0x1254: 0x0008, 0x1255: 0x670d, 0x1256: 0x672d, 0x1257: 0x674d, - 0x1258: 0x676d, 0x1259: 0x678d, 0x125a: 0x67ad, 0x125b: 0x67cd, 0x125c: 0x67ed, 0x125d: 0x680d, - 0x125e: 0x682d, 0x125f: 0x0008, 0x1260: 0x684d, 0x1261: 0x0008, 0x1262: 0x686d, 0x1263: 0x0008, - 0x1264: 0x0008, 0x1265: 0x688d, 0x1266: 0x68ad, 0x1267: 0x0008, 0x1268: 0x0008, 0x1269: 0x0008, - 0x126a: 0x68cd, 0x126b: 0x68ed, 0x126c: 0x690d, 0x126d: 0x692d, 0x126e: 0x694d, 0x126f: 0x696d, - 0x1270: 0x698d, 0x1271: 0x69ad, 0x1272: 0x69cd, 0x1273: 0x69ed, 0x1274: 0x6a0d, 0x1275: 0x6a2d, - 0x1276: 0x6a4d, 0x1277: 0x6a6d, 0x1278: 0x6a8d, 0x1279: 0x6aad, 0x127a: 0x6acd, 0x127b: 0x6aed, - 0x127c: 0x6b0d, 0x127d: 0x6b2d, 0x127e: 0x6b4d, 0x127f: 0x6b6d, + 0x1240: 0x1439, 0x1241: 0x1441, 0x1242: 0x1449, 0x1243: 0x7d4d, 0x1244: 0x7d6d, 0x1245: 0x1451, + 0x1246: 0x1451, 0x1247: 0x0040, 0x1248: 0x0040, 0x1249: 0x0040, 0x124a: 0x0040, 0x124b: 0x0040, + 0x124c: 0x0040, 0x124d: 0x0040, 0x124e: 0x0040, 0x124f: 0x0040, 0x1250: 0x0040, 0x1251: 0x0040, + 0x1252: 0x0040, 0x1253: 0x1459, 0x1254: 0x1461, 0x1255: 0x1469, 0x1256: 0x1471, 0x1257: 0x1479, + 0x1258: 0x0040, 0x1259: 0x0040, 0x125a: 0x0040, 0x125b: 0x0040, 0x125c: 0x0040, 0x125d: 0x1481, + 0x125e: 0x3308, 0x125f: 0x1489, 0x1260: 0x1491, 0x1261: 0x0779, 0x1262: 0x0791, 0x1263: 0x1499, + 0x1264: 0x14a1, 0x1265: 0x14a9, 0x1266: 0x14b1, 0x1267: 0x14b9, 0x1268: 0x14c1, 0x1269: 0x071a, + 0x126a: 0x14c9, 0x126b: 0x14d1, 0x126c: 0x14d9, 0x126d: 0x14e1, 0x126e: 0x14e9, 0x126f: 0x14f1, + 0x1270: 0x14f9, 0x1271: 0x1501, 0x1272: 0x1509, 0x1273: 0x1511, 0x1274: 0x1519, 0x1275: 0x1521, + 0x1276: 0x1529, 0x1277: 0x0040, 0x1278: 0x1531, 0x1279: 0x1539, 0x127a: 0x1541, 0x127b: 0x1549, + 0x127c: 0x1551, 0x127d: 0x0040, 0x127e: 0x1559, 0x127f: 0x0040, // Block 0x4a, offset 0x1280 - 0x1280: 0x7acd, 0x1281: 0x7aed, 0x1282: 0x7b0d, 0x1283: 0x7b2d, 0x1284: 0x7b4d, 0x1285: 0x7b6d, - 0x1286: 0x7b8d, 0x1287: 0x7bad, 0x1288: 0x7bcd, 0x1289: 0x7bed, 0x128a: 0x7c0d, 0x128b: 0x7c2d, - 0x128c: 0x7c4d, 0x128d: 0x7c6d, 0x128e: 0x7c8d, 0x128f: 0x6f19, 0x1290: 0x6f41, 0x1291: 0x6f69, - 0x1292: 0x7cad, 0x1293: 0x7ccd, 0x1294: 0x7ced, 0x1295: 0x6f91, 0x1296: 0x6fb9, 0x1297: 0x6fe1, - 0x1298: 0x7d0d, 0x1299: 0x7d2d, 0x129a: 0x0040, 0x129b: 0x0040, 0x129c: 0x0040, 0x129d: 0x0040, - 0x129e: 0x0040, 0x129f: 0x0040, 0x12a0: 0x0040, 0x12a1: 0x0040, 0x12a2: 0x0040, 0x12a3: 0x0040, - 0x12a4: 0x0040, 0x12a5: 0x0040, 0x12a6: 0x0040, 0x12a7: 0x0040, 0x12a8: 0x0040, 0x12a9: 0x0040, - 0x12aa: 0x0040, 0x12ab: 0x0040, 0x12ac: 0x0040, 0x12ad: 0x0040, 0x12ae: 0x0040, 0x12af: 0x0040, - 0x12b0: 0x0040, 0x12b1: 0x0040, 0x12b2: 0x0040, 0x12b3: 0x0040, 0x12b4: 0x0040, 0x12b5: 0x0040, - 0x12b6: 0x0040, 0x12b7: 0x0040, 0x12b8: 0x0040, 0x12b9: 0x0040, 0x12ba: 0x0040, 0x12bb: 0x0040, - 0x12bc: 0x0040, 0x12bd: 0x0040, 0x12be: 0x0040, 0x12bf: 0x0040, + 0x1280: 0x1561, 0x1281: 0x1569, 0x1282: 0x0040, 0x1283: 0x1571, 0x1284: 0x1579, 0x1285: 0x0040, + 0x1286: 0x1581, 0x1287: 0x1589, 0x1288: 0x1591, 0x1289: 0x1599, 0x128a: 0x15a1, 0x128b: 0x15a9, + 0x128c: 0x15b1, 0x128d: 0x15b9, 0x128e: 0x15c1, 0x128f: 0x15c9, 0x1290: 0x15d1, 0x1291: 0x15d1, + 0x1292: 0x15d9, 0x1293: 0x15d9, 0x1294: 0x15d9, 0x1295: 0x15d9, 0x1296: 0x15e1, 0x1297: 0x15e1, + 0x1298: 0x15e1, 0x1299: 0x15e1, 0x129a: 0x15e9, 0x129b: 0x15e9, 0x129c: 0x15e9, 0x129d: 0x15e9, + 0x129e: 0x15f1, 0x129f: 0x15f1, 0x12a0: 0x15f1, 0x12a1: 0x15f1, 0x12a2: 0x15f9, 0x12a3: 0x15f9, + 0x12a4: 0x15f9, 0x12a5: 0x15f9, 0x12a6: 0x1601, 0x12a7: 0x1601, 0x12a8: 0x1601, 0x12a9: 0x1601, + 0x12aa: 0x1609, 0x12ab: 0x1609, 0x12ac: 0x1609, 0x12ad: 0x1609, 0x12ae: 0x1611, 0x12af: 0x1611, + 0x12b0: 0x1611, 0x12b1: 0x1611, 0x12b2: 0x1619, 0x12b3: 0x1619, 0x12b4: 0x1619, 0x12b5: 0x1619, + 0x12b6: 0x1621, 0x12b7: 0x1621, 0x12b8: 0x1621, 0x12b9: 0x1621, 0x12ba: 0x1629, 0x12bb: 0x1629, + 0x12bc: 0x1629, 0x12bd: 0x1629, 0x12be: 0x1631, 0x12bf: 0x1631, // Block 0x4b, offset 0x12c0 - 0x12c0: 0x7009, 0x12c1: 0x7021, 0x12c2: 0x7039, 0x12c3: 0x7d4d, 0x12c4: 0x7d6d, 0x12c5: 0x7051, - 0x12c6: 0x7051, 0x12c7: 0x0040, 0x12c8: 0x0040, 0x12c9: 0x0040, 0x12ca: 0x0040, 0x12cb: 0x0040, - 0x12cc: 0x0040, 0x12cd: 0x0040, 0x12ce: 0x0040, 0x12cf: 0x0040, 0x12d0: 0x0040, 0x12d1: 0x0040, - 0x12d2: 0x0040, 0x12d3: 0x7069, 0x12d4: 0x7091, 0x12d5: 0x70b9, 0x12d6: 0x70e1, 0x12d7: 0x7109, - 0x12d8: 0x0040, 0x12d9: 0x0040, 0x12da: 0x0040, 0x12db: 0x0040, 0x12dc: 0x0040, 0x12dd: 0x7131, - 0x12de: 0x3308, 0x12df: 0x7159, 0x12e0: 0x7181, 0x12e1: 0x20a9, 0x12e2: 0x20f1, 0x12e3: 0x7199, - 0x12e4: 0x71b1, 0x12e5: 0x71c9, 0x12e6: 0x71e1, 0x12e7: 0x71f9, 0x12e8: 0x7211, 0x12e9: 0x1fb2, - 0x12ea: 0x7229, 0x12eb: 0x7251, 0x12ec: 0x7279, 0x12ed: 0x72b1, 0x12ee: 0x72e9, 0x12ef: 0x7311, - 0x12f0: 0x7339, 0x12f1: 0x7361, 0x12f2: 0x7389, 0x12f3: 0x73b1, 0x12f4: 0x73d9, 0x12f5: 0x7401, - 0x12f6: 0x7429, 0x12f7: 0x0040, 0x12f8: 0x7451, 0x12f9: 0x7479, 0x12fa: 0x74a1, 0x12fb: 0x74c9, - 0x12fc: 0x74f1, 0x12fd: 0x0040, 0x12fe: 0x7519, 0x12ff: 0x0040, + 0x12c0: 0x1631, 0x12c1: 0x1631, 0x12c2: 0x1639, 0x12c3: 0x1639, 0x12c4: 0x1641, 0x12c5: 0x1641, + 0x12c6: 0x1649, 0x12c7: 0x1649, 0x12c8: 0x1651, 0x12c9: 0x1651, 0x12ca: 0x1659, 0x12cb: 0x1659, + 0x12cc: 0x1661, 0x12cd: 0x1661, 0x12ce: 0x1669, 0x12cf: 0x1669, 0x12d0: 0x1669, 0x12d1: 0x1669, + 0x12d2: 0x1671, 0x12d3: 0x1671, 0x12d4: 0x1671, 0x12d5: 0x1671, 0x12d6: 0x1679, 0x12d7: 0x1679, + 0x12d8: 0x1679, 0x12d9: 0x1679, 0x12da: 0x1681, 0x12db: 0x1681, 0x12dc: 0x1681, 0x12dd: 0x1681, + 0x12de: 0x1689, 0x12df: 0x1689, 0x12e0: 0x1691, 0x12e1: 0x1691, 0x12e2: 0x1691, 0x12e3: 0x1691, + 0x12e4: 0x1699, 0x12e5: 0x1699, 0x12e6: 0x16a1, 0x12e7: 0x16a1, 0x12e8: 0x16a1, 0x12e9: 0x16a1, + 0x12ea: 0x16a9, 0x12eb: 0x16a9, 0x12ec: 0x16a9, 0x12ed: 0x16a9, 0x12ee: 0x16b1, 0x12ef: 0x16b1, + 0x12f0: 0x16b9, 0x12f1: 0x16b9, 0x12f2: 0x0818, 0x12f3: 0x0818, 0x12f4: 0x0818, 0x12f5: 0x0818, + 0x12f6: 0x0818, 0x12f7: 0x0818, 0x12f8: 0x0818, 0x12f9: 0x0818, 0x12fa: 0x0818, 0x12fb: 0x0818, + 0x12fc: 0x0818, 0x12fd: 0x0818, 0x12fe: 0x0818, 0x12ff: 0x0818, // Block 0x4c, offset 0x1300 - 0x1300: 0x7541, 0x1301: 0x7569, 0x1302: 0x0040, 0x1303: 0x7591, 0x1304: 0x75b9, 0x1305: 0x0040, - 0x1306: 0x75e1, 0x1307: 0x7609, 0x1308: 0x7631, 0x1309: 0x7659, 0x130a: 0x7681, 0x130b: 0x76a9, - 0x130c: 0x76d1, 0x130d: 0x76f9, 0x130e: 0x7721, 0x130f: 0x7749, 0x1310: 0x7771, 0x1311: 0x7771, - 0x1312: 0x7789, 0x1313: 0x7789, 0x1314: 0x7789, 0x1315: 0x7789, 0x1316: 0x77a1, 0x1317: 0x77a1, - 0x1318: 0x77a1, 0x1319: 0x77a1, 0x131a: 0x77b9, 0x131b: 0x77b9, 0x131c: 0x77b9, 0x131d: 0x77b9, - 0x131e: 0x77d1, 0x131f: 0x77d1, 0x1320: 0x77d1, 0x1321: 0x77d1, 0x1322: 0x77e9, 0x1323: 0x77e9, - 0x1324: 0x77e9, 0x1325: 0x77e9, 0x1326: 0x7801, 0x1327: 0x7801, 0x1328: 0x7801, 0x1329: 0x7801, - 0x132a: 0x7819, 0x132b: 0x7819, 0x132c: 0x7819, 0x132d: 0x7819, 0x132e: 0x7831, 0x132f: 0x7831, - 0x1330: 0x7831, 0x1331: 0x7831, 0x1332: 0x7849, 0x1333: 0x7849, 0x1334: 0x7849, 0x1335: 0x7849, - 0x1336: 0x7861, 0x1337: 0x7861, 0x1338: 0x7861, 0x1339: 0x7861, 0x133a: 0x7879, 0x133b: 0x7879, - 0x133c: 0x7879, 0x133d: 0x7879, 0x133e: 0x7891, 0x133f: 0x7891, + 0x1300: 0x0818, 0x1301: 0x0818, 0x1302: 0x0040, 0x1303: 0x0040, 0x1304: 0x0040, 0x1305: 0x0040, + 0x1306: 0x0040, 0x1307: 0x0040, 0x1308: 0x0040, 0x1309: 0x0040, 0x130a: 0x0040, 0x130b: 0x0040, + 0x130c: 0x0040, 0x130d: 0x0040, 0x130e: 0x0040, 0x130f: 0x0040, 0x1310: 0x0040, 0x1311: 0x0040, + 0x1312: 0x0040, 0x1313: 0x16c1, 0x1314: 0x16c1, 0x1315: 0x16c1, 0x1316: 0x16c1, 0x1317: 0x16c9, + 0x1318: 0x16c9, 0x1319: 0x16d1, 0x131a: 0x16d1, 0x131b: 0x16d9, 0x131c: 0x16d9, 0x131d: 0x0149, + 0x131e: 0x16e1, 0x131f: 0x16e1, 0x1320: 0x16e9, 0x1321: 0x16e9, 0x1322: 0x16f1, 0x1323: 0x16f1, + 0x1324: 0x16f9, 0x1325: 0x16f9, 0x1326: 0x16f9, 0x1327: 0x16f9, 0x1328: 0x1701, 0x1329: 0x1701, + 0x132a: 0x1709, 0x132b: 0x1709, 0x132c: 0x1711, 0x132d: 0x1711, 0x132e: 0x1719, 0x132f: 0x1719, + 0x1330: 0x1721, 0x1331: 0x1721, 0x1332: 0x1729, 0x1333: 0x1729, 0x1334: 0x1731, 0x1335: 0x1731, + 0x1336: 0x1739, 0x1337: 0x1739, 0x1338: 0x1739, 0x1339: 0x1741, 0x133a: 0x1741, 0x133b: 0x1741, + 0x133c: 0x1749, 0x133d: 0x1749, 0x133e: 0x1749, 0x133f: 0x1749, // Block 0x4d, offset 0x1340 - 0x1340: 0x7891, 0x1341: 0x7891, 0x1342: 0x78a9, 0x1343: 0x78a9, 0x1344: 0x78c1, 0x1345: 0x78c1, - 0x1346: 0x78d9, 0x1347: 0x78d9, 0x1348: 0x78f1, 0x1349: 0x78f1, 0x134a: 0x7909, 0x134b: 0x7909, - 0x134c: 0x7921, 0x134d: 0x7921, 0x134e: 0x7939, 0x134f: 0x7939, 0x1350: 0x7939, 0x1351: 0x7939, - 0x1352: 0x7951, 0x1353: 0x7951, 0x1354: 0x7951, 0x1355: 0x7951, 0x1356: 0x7969, 0x1357: 0x7969, - 0x1358: 0x7969, 0x1359: 0x7969, 0x135a: 0x7981, 0x135b: 0x7981, 0x135c: 0x7981, 0x135d: 0x7981, - 0x135e: 0x7999, 0x135f: 0x7999, 0x1360: 0x79b1, 0x1361: 0x79b1, 0x1362: 0x79b1, 0x1363: 0x79b1, - 0x1364: 0x79c9, 0x1365: 0x79c9, 0x1366: 0x79e1, 0x1367: 0x79e1, 0x1368: 0x79e1, 0x1369: 0x79e1, - 0x136a: 0x79f9, 0x136b: 0x79f9, 0x136c: 0x79f9, 0x136d: 0x79f9, 0x136e: 0x7a11, 0x136f: 0x7a11, - 0x1370: 0x7a29, 0x1371: 0x7a29, 0x1372: 0x0818, 0x1373: 0x0818, 0x1374: 0x0818, 0x1375: 0x0818, - 0x1376: 0x0818, 0x1377: 0x0818, 0x1378: 0x0818, 0x1379: 0x0818, 0x137a: 0x0818, 0x137b: 0x0818, - 0x137c: 0x0818, 0x137d: 0x0818, 0x137e: 0x0818, 0x137f: 0x0818, + 0x1340: 0x1949, 0x1341: 0x1951, 0x1342: 0x1959, 0x1343: 0x1961, 0x1344: 0x1969, 0x1345: 0x1971, + 0x1346: 0x1979, 0x1347: 0x1981, 0x1348: 0x1989, 0x1349: 0x1991, 0x134a: 0x1999, 0x134b: 0x19a1, + 0x134c: 0x19a9, 0x134d: 0x19b1, 0x134e: 0x19b9, 0x134f: 0x19c1, 0x1350: 0x19c9, 0x1351: 0x19d1, + 0x1352: 0x19d9, 0x1353: 0x19e1, 0x1354: 0x19e9, 0x1355: 0x19f1, 0x1356: 0x19f9, 0x1357: 0x1a01, + 0x1358: 0x1a09, 0x1359: 0x1a11, 0x135a: 0x1a19, 0x135b: 0x1a21, 0x135c: 0x1a29, 0x135d: 0x1a31, + 0x135e: 0x1a3a, 0x135f: 0x1a42, 0x1360: 0x1a4a, 0x1361: 0x1a52, 0x1362: 0x1a5a, 0x1363: 0x1a62, + 0x1364: 0x1a69, 0x1365: 0x1a71, 0x1366: 0x1761, 0x1367: 0x1a79, 0x1368: 0x1741, 0x1369: 0x1769, + 0x136a: 0x1a81, 0x136b: 0x1a89, 0x136c: 0x1789, 0x136d: 0x1a91, 0x136e: 0x1791, 0x136f: 0x1799, + 0x1370: 0x1a99, 0x1371: 0x1aa1, 0x1372: 0x17b9, 0x1373: 0x1aa9, 0x1374: 0x17c1, 0x1375: 0x17c9, + 0x1376: 0x1ab1, 0x1377: 0x1ab9, 0x1378: 0x17d9, 0x1379: 0x1ac1, 0x137a: 0x17e1, 0x137b: 0x17e9, + 0x137c: 0x18d1, 0x137d: 0x18d9, 0x137e: 0x18f1, 0x137f: 0x18f9, // Block 0x4e, offset 0x1380 - 0x1380: 0x0818, 0x1381: 0x0818, 0x1382: 0x0040, 0x1383: 0x0040, 0x1384: 0x0040, 0x1385: 0x0040, - 0x1386: 0x0040, 0x1387: 0x0040, 0x1388: 0x0040, 0x1389: 0x0040, 0x138a: 0x0040, 0x138b: 0x0040, - 0x138c: 0x0040, 0x138d: 0x0040, 0x138e: 0x0040, 0x138f: 0x0040, 0x1390: 0x0040, 0x1391: 0x0040, - 0x1392: 0x0040, 0x1393: 0x7a41, 0x1394: 0x7a41, 0x1395: 0x7a41, 0x1396: 0x7a41, 0x1397: 0x7a59, - 0x1398: 0x7a59, 0x1399: 0x7a71, 0x139a: 0x7a71, 0x139b: 0x7a89, 0x139c: 0x7a89, 0x139d: 0x0479, - 0x139e: 0x7aa1, 0x139f: 0x7aa1, 0x13a0: 0x7ab9, 0x13a1: 0x7ab9, 0x13a2: 0x7ad1, 0x13a3: 0x7ad1, - 0x13a4: 0x7ae9, 0x13a5: 0x7ae9, 0x13a6: 0x7ae9, 0x13a7: 0x7ae9, 0x13a8: 0x7b01, 0x13a9: 0x7b01, - 0x13aa: 0x7b19, 0x13ab: 0x7b19, 0x13ac: 0x7b41, 0x13ad: 0x7b41, 0x13ae: 0x7b69, 0x13af: 0x7b69, - 0x13b0: 0x7b91, 0x13b1: 0x7b91, 0x13b2: 0x7bb9, 0x13b3: 0x7bb9, 0x13b4: 0x7be1, 0x13b5: 0x7be1, - 0x13b6: 0x7c09, 0x13b7: 0x7c09, 0x13b8: 0x7c09, 0x13b9: 0x7c31, 0x13ba: 0x7c31, 0x13bb: 0x7c31, - 0x13bc: 0x7c59, 0x13bd: 0x7c59, 0x13be: 0x7c59, 0x13bf: 0x7c59, + 0x1380: 0x1901, 0x1381: 0x1921, 0x1382: 0x1929, 0x1383: 0x1931, 0x1384: 0x1939, 0x1385: 0x1959, + 0x1386: 0x1961, 0x1387: 0x1969, 0x1388: 0x1ac9, 0x1389: 0x1989, 0x138a: 0x1ad1, 0x138b: 0x1ad9, + 0x138c: 0x19b9, 0x138d: 0x1ae1, 0x138e: 0x19c1, 0x138f: 0x19c9, 0x1390: 0x1a31, 0x1391: 0x1ae9, + 0x1392: 0x1af1, 0x1393: 0x1a09, 0x1394: 0x1af9, 0x1395: 0x1a11, 0x1396: 0x1a19, 0x1397: 0x1751, + 0x1398: 0x1759, 0x1399: 0x1b01, 0x139a: 0x1761, 0x139b: 0x1b09, 0x139c: 0x1771, 0x139d: 0x1779, + 0x139e: 0x1781, 0x139f: 0x1789, 0x13a0: 0x1b11, 0x13a1: 0x17a1, 0x13a2: 0x17a9, 0x13a3: 0x17b1, + 0x13a4: 0x17b9, 0x13a5: 0x1b19, 0x13a6: 0x17d9, 0x13a7: 0x17f1, 0x13a8: 0x17f9, 0x13a9: 0x1801, + 0x13aa: 0x1809, 0x13ab: 0x1811, 0x13ac: 0x1821, 0x13ad: 0x1829, 0x13ae: 0x1831, 0x13af: 0x1839, + 0x13b0: 0x1841, 0x13b1: 0x1849, 0x13b2: 0x1b21, 0x13b3: 0x1851, 0x13b4: 0x1859, 0x13b5: 0x1861, + 0x13b6: 0x1869, 0x13b7: 0x1871, 0x13b8: 0x1879, 0x13b9: 0x1889, 0x13ba: 0x1891, 0x13bb: 0x1899, + 0x13bc: 0x18a1, 0x13bd: 0x18a9, 0x13be: 0x18b1, 0x13bf: 0x18b9, // Block 0x4f, offset 0x13c0 - 0x13c0: 0x8649, 0x13c1: 0x8671, 0x13c2: 0x8699, 0x13c3: 0x86c1, 0x13c4: 0x86e9, 0x13c5: 0x8711, - 0x13c6: 0x8739, 0x13c7: 0x8761, 0x13c8: 0x8789, 0x13c9: 0x87b1, 0x13ca: 0x87d9, 0x13cb: 0x8801, - 0x13cc: 0x8829, 0x13cd: 0x8851, 0x13ce: 0x8879, 0x13cf: 0x88a1, 0x13d0: 0x88c9, 0x13d1: 0x88f1, - 0x13d2: 0x8919, 0x13d3: 0x8941, 0x13d4: 0x8969, 0x13d5: 0x8991, 0x13d6: 0x89b9, 0x13d7: 0x89e1, - 0x13d8: 0x8a09, 0x13d9: 0x8a31, 0x13da: 0x8a59, 0x13db: 0x8a81, 0x13dc: 0x8aa9, 0x13dd: 0x8ad1, - 0x13de: 0x8afa, 0x13df: 0x8b2a, 0x13e0: 0x8b5a, 0x13e1: 0x8b8a, 0x13e2: 0x8bba, 0x13e3: 0x8bea, - 0x13e4: 0x8c19, 0x13e5: 0x8c41, 0x13e6: 0x7cc1, 0x13e7: 0x8c69, 0x13e8: 0x7c31, 0x13e9: 0x7ce9, - 0x13ea: 0x8c91, 0x13eb: 0x8cb9, 0x13ec: 0x7d89, 0x13ed: 0x8ce1, 0x13ee: 0x7db1, 0x13ef: 0x7dd9, - 0x13f0: 0x8d09, 0x13f1: 0x8d31, 0x13f2: 0x7e79, 0x13f3: 0x8d59, 0x13f4: 0x7ea1, 0x13f5: 0x7ec9, - 0x13f6: 0x8d81, 0x13f7: 0x8da9, 0x13f8: 0x7f19, 0x13f9: 0x8dd1, 0x13fa: 0x7f41, 0x13fb: 0x7f69, - 0x13fc: 0x83f1, 0x13fd: 0x8419, 0x13fe: 0x8491, 0x13ff: 0x84b9, + 0x13c0: 0x18c1, 0x13c1: 0x18c9, 0x13c2: 0x18e1, 0x13c3: 0x18e9, 0x13c4: 0x1909, 0x13c5: 0x1911, + 0x13c6: 0x1919, 0x13c7: 0x1921, 0x13c8: 0x1929, 0x13c9: 0x1941, 0x13ca: 0x1949, 0x13cb: 0x1951, + 0x13cc: 0x1959, 0x13cd: 0x1b29, 0x13ce: 0x1971, 0x13cf: 0x1979, 0x13d0: 0x1981, 0x13d1: 0x1989, + 0x13d2: 0x19a1, 0x13d3: 0x19a9, 0x13d4: 0x19b1, 0x13d5: 0x19b9, 0x13d6: 0x1b31, 0x13d7: 0x19d1, + 0x13d8: 0x19d9, 0x13d9: 0x1b39, 0x13da: 0x19f1, 0x13db: 0x19f9, 0x13dc: 0x1a01, 0x13dd: 0x1a09, + 0x13de: 0x1b41, 0x13df: 0x1761, 0x13e0: 0x1b09, 0x13e1: 0x1789, 0x13e2: 0x1b11, 0x13e3: 0x17b9, + 0x13e4: 0x1b19, 0x13e5: 0x17d9, 0x13e6: 0x1b49, 0x13e7: 0x1841, 0x13e8: 0x1b51, 0x13e9: 0x1b59, + 0x13ea: 0x1b61, 0x13eb: 0x1921, 0x13ec: 0x1929, 0x13ed: 0x1959, 0x13ee: 0x19b9, 0x13ef: 0x1b31, + 0x13f0: 0x1a09, 0x13f1: 0x1b41, 0x13f2: 0x1b69, 0x13f3: 0x1b71, 0x13f4: 0x1b79, 0x13f5: 0x1b81, + 0x13f6: 0x1b89, 0x13f7: 0x1b91, 0x13f8: 0x1b99, 0x13f9: 0x1ba1, 0x13fa: 0x1ba9, 0x13fb: 0x1bb1, + 0x13fc: 0x1bb9, 0x13fd: 0x1bc1, 0x13fe: 0x1bc9, 0x13ff: 0x1bd1, // Block 0x50, offset 0x1400 - 0x1400: 0x84e1, 0x1401: 0x8581, 0x1402: 0x85a9, 0x1403: 0x85d1, 0x1404: 0x85f9, 0x1405: 0x8699, - 0x1406: 0x86c1, 0x1407: 0x86e9, 0x1408: 0x8df9, 0x1409: 0x8789, 0x140a: 0x8e21, 0x140b: 0x8e49, - 0x140c: 0x8879, 0x140d: 0x8e71, 0x140e: 0x88a1, 0x140f: 0x88c9, 0x1410: 0x8ad1, 0x1411: 0x8e99, - 0x1412: 0x8ec1, 0x1413: 0x8a09, 0x1414: 0x8ee9, 0x1415: 0x8a31, 0x1416: 0x8a59, 0x1417: 0x7c71, - 0x1418: 0x7c99, 0x1419: 0x8f11, 0x141a: 0x7cc1, 0x141b: 0x8f39, 0x141c: 0x7d11, 0x141d: 0x7d39, - 0x141e: 0x7d61, 0x141f: 0x7d89, 0x1420: 0x8f61, 0x1421: 0x7e01, 0x1422: 0x7e29, 0x1423: 0x7e51, - 0x1424: 0x7e79, 0x1425: 0x8f89, 0x1426: 0x7f19, 0x1427: 0x7f91, 0x1428: 0x7fb9, 0x1429: 0x7fe1, - 0x142a: 0x8009, 0x142b: 0x8031, 0x142c: 0x8081, 0x142d: 0x80a9, 0x142e: 0x80d1, 0x142f: 0x80f9, - 0x1430: 0x8121, 0x1431: 0x8149, 0x1432: 0x8fb1, 0x1433: 0x8171, 0x1434: 0x8199, 0x1435: 0x81c1, - 0x1436: 0x81e9, 0x1437: 0x8211, 0x1438: 0x8239, 0x1439: 0x8289, 0x143a: 0x82b1, 0x143b: 0x82d9, - 0x143c: 0x8301, 0x143d: 0x8329, 0x143e: 0x8351, 0x143f: 0x8379, + 0x1400: 0x1bd9, 0x1401: 0x1be1, 0x1402: 0x1be9, 0x1403: 0x1bf1, 0x1404: 0x1bf9, 0x1405: 0x1c01, + 0x1406: 0x1c09, 0x1407: 0x1c11, 0x1408: 0x1c19, 0x1409: 0x1c21, 0x140a: 0x1c29, 0x140b: 0x1c31, + 0x140c: 0x1b59, 0x140d: 0x1c39, 0x140e: 0x1c41, 0x140f: 0x1c49, 0x1410: 0x1c51, 0x1411: 0x1b81, + 0x1412: 0x1b89, 0x1413: 0x1b91, 0x1414: 0x1b99, 0x1415: 0x1ba1, 0x1416: 0x1ba9, 0x1417: 0x1bb1, + 0x1418: 0x1bb9, 0x1419: 0x1bc1, 0x141a: 0x1bc9, 0x141b: 0x1bd1, 0x141c: 0x1bd9, 0x141d: 0x1be1, + 0x141e: 0x1be9, 0x141f: 0x1bf1, 0x1420: 0x1bf9, 0x1421: 0x1c01, 0x1422: 0x1c09, 0x1423: 0x1c11, + 0x1424: 0x1c19, 0x1425: 0x1c21, 0x1426: 0x1c29, 0x1427: 0x1c31, 0x1428: 0x1b59, 0x1429: 0x1c39, + 0x142a: 0x1c41, 0x142b: 0x1c49, 0x142c: 0x1c51, 0x142d: 0x1c21, 0x142e: 0x1c29, 0x142f: 0x1c31, + 0x1430: 0x1b59, 0x1431: 0x1b51, 0x1432: 0x1b61, 0x1433: 0x1881, 0x1434: 0x1829, 0x1435: 0x1831, + 0x1436: 0x1839, 0x1437: 0x1c21, 0x1438: 0x1c29, 0x1439: 0x1c31, 0x143a: 0x1881, 0x143b: 0x1889, + 0x143c: 0x1c59, 0x143d: 0x1c59, 0x143e: 0x0018, 0x143f: 0x0018, // Block 0x51, offset 0x1440 - 0x1440: 0x83a1, 0x1441: 0x83c9, 0x1442: 0x8441, 0x1443: 0x8469, 0x1444: 0x8509, 0x1445: 0x8531, - 0x1446: 0x8559, 0x1447: 0x8581, 0x1448: 0x85a9, 0x1449: 0x8621, 0x144a: 0x8649, 0x144b: 0x8671, - 0x144c: 0x8699, 0x144d: 0x8fd9, 0x144e: 0x8711, 0x144f: 0x8739, 0x1450: 0x8761, 0x1451: 0x8789, - 0x1452: 0x8801, 0x1453: 0x8829, 0x1454: 0x8851, 0x1455: 0x8879, 0x1456: 0x9001, 0x1457: 0x88f1, - 0x1458: 0x8919, 0x1459: 0x9029, 0x145a: 0x8991, 0x145b: 0x89b9, 0x145c: 0x89e1, 0x145d: 0x8a09, - 0x145e: 0x9051, 0x145f: 0x7cc1, 0x1460: 0x8f39, 0x1461: 0x7d89, 0x1462: 0x8f61, 0x1463: 0x7e79, - 0x1464: 0x8f89, 0x1465: 0x7f19, 0x1466: 0x9079, 0x1467: 0x8121, 0x1468: 0x90a1, 0x1469: 0x90c9, - 0x146a: 0x90f1, 0x146b: 0x8581, 0x146c: 0x85a9, 0x146d: 0x8699, 0x146e: 0x8879, 0x146f: 0x9001, - 0x1470: 0x8a09, 0x1471: 0x9051, 0x1472: 0x9119, 0x1473: 0x9151, 0x1474: 0x9189, 0x1475: 0x91c1, - 0x1476: 0x91e9, 0x1477: 0x9211, 0x1478: 0x9239, 0x1479: 0x9261, 0x147a: 0x9289, 0x147b: 0x92b1, - 0x147c: 0x92d9, 0x147d: 0x9301, 0x147e: 0x9329, 0x147f: 0x9351, + 0x1440: 0x0040, 0x1441: 0x0040, 0x1442: 0x0040, 0x1443: 0x0040, 0x1444: 0x0040, 0x1445: 0x0040, + 0x1446: 0x0040, 0x1447: 0x0040, 0x1448: 0x0040, 0x1449: 0x0040, 0x144a: 0x0040, 0x144b: 0x0040, + 0x144c: 0x0040, 0x144d: 0x0040, 0x144e: 0x0040, 0x144f: 0x0040, 0x1450: 0x1c61, 0x1451: 0x1c69, + 0x1452: 0x1c69, 0x1453: 0x1c71, 0x1454: 0x1c79, 0x1455: 0x1c81, 0x1456: 0x1c89, 0x1457: 0x1c91, + 0x1458: 0x1c99, 0x1459: 0x1c99, 0x145a: 0x1ca1, 0x145b: 0x1ca9, 0x145c: 0x1cb1, 0x145d: 0x1cb9, + 0x145e: 0x1cc1, 0x145f: 0x1cc9, 0x1460: 0x1cc9, 0x1461: 0x1cd1, 0x1462: 0x1cd9, 0x1463: 0x1cd9, + 0x1464: 0x1ce1, 0x1465: 0x1ce1, 0x1466: 0x1ce9, 0x1467: 0x1cf1, 0x1468: 0x1cf1, 0x1469: 0x1cf9, + 0x146a: 0x1d01, 0x146b: 0x1d01, 0x146c: 0x1d09, 0x146d: 0x1d09, 0x146e: 0x1d11, 0x146f: 0x1d19, + 0x1470: 0x1d19, 0x1471: 0x1d21, 0x1472: 0x1d21, 0x1473: 0x1d29, 0x1474: 0x1d31, 0x1475: 0x1d39, + 0x1476: 0x1d41, 0x1477: 0x1d41, 0x1478: 0x1d49, 0x1479: 0x1d51, 0x147a: 0x1d59, 0x147b: 0x1d61, + 0x147c: 0x1d69, 0x147d: 0x1d69, 0x147e: 0x1d71, 0x147f: 0x1d79, // Block 0x52, offset 0x1480 - 0x1480: 0x9379, 0x1481: 0x93a1, 0x1482: 0x93c9, 0x1483: 0x93f1, 0x1484: 0x9419, 0x1485: 0x9441, - 0x1486: 0x9469, 0x1487: 0x9491, 0x1488: 0x94b9, 0x1489: 0x94e1, 0x148a: 0x9509, 0x148b: 0x9531, - 0x148c: 0x90c9, 0x148d: 0x9559, 0x148e: 0x9581, 0x148f: 0x95a9, 0x1490: 0x95d1, 0x1491: 0x91c1, - 0x1492: 0x91e9, 0x1493: 0x9211, 0x1494: 0x9239, 0x1495: 0x9261, 0x1496: 0x9289, 0x1497: 0x92b1, - 0x1498: 0x92d9, 0x1499: 0x9301, 0x149a: 0x9329, 0x149b: 0x9351, 0x149c: 0x9379, 0x149d: 0x93a1, - 0x149e: 0x93c9, 0x149f: 0x93f1, 0x14a0: 0x9419, 0x14a1: 0x9441, 0x14a2: 0x9469, 0x14a3: 0x9491, - 0x14a4: 0x94b9, 0x14a5: 0x94e1, 0x14a6: 0x9509, 0x14a7: 0x9531, 0x14a8: 0x90c9, 0x14a9: 0x9559, - 0x14aa: 0x9581, 0x14ab: 0x95a9, 0x14ac: 0x95d1, 0x14ad: 0x94e1, 0x14ae: 0x9509, 0x14af: 0x9531, - 0x14b0: 0x90c9, 0x14b1: 0x90a1, 0x14b2: 0x90f1, 0x14b3: 0x8261, 0x14b4: 0x80a9, 0x14b5: 0x80d1, - 0x14b6: 0x80f9, 0x14b7: 0x94e1, 0x14b8: 0x9509, 0x14b9: 0x9531, 0x14ba: 0x8261, 0x14bb: 0x8289, - 0x14bc: 0x95f9, 0x14bd: 0x95f9, 0x14be: 0x0018, 0x14bf: 0x0018, + 0x1480: 0x1f29, 0x1481: 0x1f31, 0x1482: 0x1f39, 0x1483: 0x1f11, 0x1484: 0x1d39, 0x1485: 0x1ce9, + 0x1486: 0x1f41, 0x1487: 0x1f49, 0x1488: 0x0040, 0x1489: 0x0040, 0x148a: 0x0040, 0x148b: 0x0040, + 0x148c: 0x0040, 0x148d: 0x0040, 0x148e: 0x0040, 0x148f: 0x0040, 0x1490: 0x0040, 0x1491: 0x0040, + 0x1492: 0x0040, 0x1493: 0x0040, 0x1494: 0x0040, 0x1495: 0x0040, 0x1496: 0x0040, 0x1497: 0x0040, + 0x1498: 0x0040, 0x1499: 0x0040, 0x149a: 0x0040, 0x149b: 0x0040, 0x149c: 0x0040, 0x149d: 0x0040, + 0x149e: 0x0040, 0x149f: 0x0040, 0x14a0: 0x0040, 0x14a1: 0x0040, 0x14a2: 0x0040, 0x14a3: 0x0040, + 0x14a4: 0x0040, 0x14a5: 0x0040, 0x14a6: 0x0040, 0x14a7: 0x0040, 0x14a8: 0x0040, 0x14a9: 0x0040, + 0x14aa: 0x0040, 0x14ab: 0x0040, 0x14ac: 0x0040, 0x14ad: 0x0040, 0x14ae: 0x0040, 0x14af: 0x0040, + 0x14b0: 0x1f51, 0x14b1: 0x1f59, 0x14b2: 0x1f61, 0x14b3: 0x1f69, 0x14b4: 0x1f71, 0x14b5: 0x1f79, + 0x14b6: 0x1f81, 0x14b7: 0x1f89, 0x14b8: 0x1f91, 0x14b9: 0x1f99, 0x14ba: 0x1fa2, 0x14bb: 0x1faa, + 0x14bc: 0x1fb1, 0x14bd: 0x0018, 0x14be: 0x0040, 0x14bf: 0x0040, // Block 0x53, offset 0x14c0 - 0x14c0: 0x0040, 0x14c1: 0x0040, 0x14c2: 0x0040, 0x14c3: 0x0040, 0x14c4: 0x0040, 0x14c5: 0x0040, - 0x14c6: 0x0040, 0x14c7: 0x0040, 0x14c8: 0x0040, 0x14c9: 0x0040, 0x14ca: 0x0040, 0x14cb: 0x0040, - 0x14cc: 0x0040, 0x14cd: 0x0040, 0x14ce: 0x0040, 0x14cf: 0x0040, 0x14d0: 0x9621, 0x14d1: 0x9659, - 0x14d2: 0x9659, 0x14d3: 0x9691, 0x14d4: 0x96c9, 0x14d5: 0x9701, 0x14d6: 0x9739, 0x14d7: 0x9771, - 0x14d8: 0x97a9, 0x14d9: 0x97a9, 0x14da: 0x97e1, 0x14db: 0x9819, 0x14dc: 0x9851, 0x14dd: 0x9889, - 0x14de: 0x98c1, 0x14df: 0x98f9, 0x14e0: 0x98f9, 0x14e1: 0x9931, 0x14e2: 0x9969, 0x14e3: 0x9969, - 0x14e4: 0x99a1, 0x14e5: 0x99a1, 0x14e6: 0x99d9, 0x14e7: 0x9a11, 0x14e8: 0x9a11, 0x14e9: 0x9a49, - 0x14ea: 0x9a81, 0x14eb: 0x9a81, 0x14ec: 0x9ab9, 0x14ed: 0x9ab9, 0x14ee: 0x9af1, 0x14ef: 0x9b29, - 0x14f0: 0x9b29, 0x14f1: 0x9b61, 0x14f2: 0x9b61, 0x14f3: 0x9b99, 0x14f4: 0x9bd1, 0x14f5: 0x9c09, - 0x14f6: 0x9c41, 0x14f7: 0x9c41, 0x14f8: 0x9c79, 0x14f9: 0x9cb1, 0x14fa: 0x9ce9, 0x14fb: 0x9d21, - 0x14fc: 0x9d59, 0x14fd: 0x9d59, 0x14fe: 0x9d91, 0x14ff: 0x9dc9, + 0x14c0: 0x33c0, 0x14c1: 0x33c0, 0x14c2: 0x33c0, 0x14c3: 0x33c0, 0x14c4: 0x33c0, 0x14c5: 0x33c0, + 0x14c6: 0x33c0, 0x14c7: 0x33c0, 0x14c8: 0x33c0, 0x14c9: 0x33c0, 0x14ca: 0x33c0, 0x14cb: 0x33c0, + 0x14cc: 0x33c0, 0x14cd: 0x33c0, 0x14ce: 0x33c0, 0x14cf: 0x33c0, 0x14d0: 0x1fba, 0x14d1: 0x7d8d, + 0x14d2: 0x0040, 0x14d3: 0x1fc2, 0x14d4: 0x0122, 0x14d5: 0x1fca, 0x14d6: 0x1fd2, 0x14d7: 0x7dad, + 0x14d8: 0x7dcd, 0x14d9: 0x0040, 0x14da: 0x0040, 0x14db: 0x0040, 0x14dc: 0x0040, 0x14dd: 0x0040, + 0x14de: 0x0040, 0x14df: 0x0040, 0x14e0: 0x3308, 0x14e1: 0x3308, 0x14e2: 0x3308, 0x14e3: 0x3308, + 0x14e4: 0x3308, 0x14e5: 0x3308, 0x14e6: 0x3308, 0x14e7: 0x3308, 0x14e8: 0x3308, 0x14e9: 0x3308, + 0x14ea: 0x3308, 0x14eb: 0x3308, 0x14ec: 0x3308, 0x14ed: 0x3308, 0x14ee: 0x3308, 0x14ef: 0x3308, + 0x14f0: 0x0040, 0x14f1: 0x7ded, 0x14f2: 0x7e0d, 0x14f3: 0x1fda, 0x14f4: 0x1fda, 0x14f5: 0x072a, + 0x14f6: 0x0732, 0x14f7: 0x1fe2, 0x14f8: 0x1fea, 0x14f9: 0x7e2d, 0x14fa: 0x7e4d, 0x14fb: 0x7e6d, + 0x14fc: 0x7e2d, 0x14fd: 0x7e8d, 0x14fe: 0x7ead, 0x14ff: 0x7e8d, // Block 0x54, offset 0x1500 - 0x1500: 0xa999, 0x1501: 0xa9d1, 0x1502: 0xaa09, 0x1503: 0xa8f1, 0x1504: 0x9c09, 0x1505: 0x99d9, - 0x1506: 0xaa41, 0x1507: 0xaa79, 0x1508: 0x0040, 0x1509: 0x0040, 0x150a: 0x0040, 0x150b: 0x0040, - 0x150c: 0x0040, 0x150d: 0x0040, 0x150e: 0x0040, 0x150f: 0x0040, 0x1510: 0x0040, 0x1511: 0x0040, - 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0040, 0x1515: 0x0040, 0x1516: 0x0040, 0x1517: 0x0040, - 0x1518: 0x0040, 0x1519: 0x0040, 0x151a: 0x0040, 0x151b: 0x0040, 0x151c: 0x0040, 0x151d: 0x0040, - 0x151e: 0x0040, 0x151f: 0x0040, 0x1520: 0x0040, 0x1521: 0x0040, 0x1522: 0x0040, 0x1523: 0x0040, - 0x1524: 0x0040, 0x1525: 0x0040, 0x1526: 0x0040, 0x1527: 0x0040, 0x1528: 0x0040, 0x1529: 0x0040, - 0x152a: 0x0040, 0x152b: 0x0040, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, - 0x1530: 0xaab1, 0x1531: 0xaae9, 0x1532: 0xab21, 0x1533: 0xab69, 0x1534: 0xabb1, 0x1535: 0xabf9, - 0x1536: 0xac41, 0x1537: 0xac89, 0x1538: 0xacd1, 0x1539: 0xad19, 0x153a: 0xad52, 0x153b: 0xae62, - 0x153c: 0xaee1, 0x153d: 0x0018, 0x153e: 0x0040, 0x153f: 0x0040, + 0x1500: 0x7ecd, 0x1501: 0x7eed, 0x1502: 0x7f0d, 0x1503: 0x7eed, 0x1504: 0x7f2d, 0x1505: 0x0018, + 0x1506: 0x0018, 0x1507: 0x1ff2, 0x1508: 0x1ffa, 0x1509: 0x7f4e, 0x150a: 0x7f6e, 0x150b: 0x7f8e, + 0x150c: 0x7fae, 0x150d: 0x1fda, 0x150e: 0x1fda, 0x150f: 0x1fda, 0x1510: 0x1fba, 0x1511: 0x7fcd, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0122, 0x1515: 0x1fc2, 0x1516: 0x1fd2, 0x1517: 0x1fca, + 0x1518: 0x7fed, 0x1519: 0x072a, 0x151a: 0x0732, 0x151b: 0x1fe2, 0x151c: 0x1fea, 0x151d: 0x7ecd, + 0x151e: 0x7f2d, 0x151f: 0x2002, 0x1520: 0x200a, 0x1521: 0x2012, 0x1522: 0x071a, 0x1523: 0x2019, + 0x1524: 0x2022, 0x1525: 0x202a, 0x1526: 0x0722, 0x1527: 0x0040, 0x1528: 0x2032, 0x1529: 0x203a, + 0x152a: 0x2042, 0x152b: 0x204a, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x800e, 0x1531: 0x2051, 0x1532: 0x802e, 0x1533: 0x0808, 0x1534: 0x804e, 0x1535: 0x0040, + 0x1536: 0x806e, 0x1537: 0x2059, 0x1538: 0x808e, 0x1539: 0x2061, 0x153a: 0x80ae, 0x153b: 0x2069, + 0x153c: 0x80ce, 0x153d: 0x2071, 0x153e: 0x80ee, 0x153f: 0x2079, // Block 0x55, offset 0x1540 - 0x1540: 0x33c0, 0x1541: 0x33c0, 0x1542: 0x33c0, 0x1543: 0x33c0, 0x1544: 0x33c0, 0x1545: 0x33c0, - 0x1546: 0x33c0, 0x1547: 0x33c0, 0x1548: 0x33c0, 0x1549: 0x33c0, 0x154a: 0x33c0, 0x154b: 0x33c0, - 0x154c: 0x33c0, 0x154d: 0x33c0, 0x154e: 0x33c0, 0x154f: 0x33c0, 0x1550: 0xaf2a, 0x1551: 0x7d8d, - 0x1552: 0x0040, 0x1553: 0xaf3a, 0x1554: 0x03c2, 0x1555: 0xaf4a, 0x1556: 0xaf5a, 0x1557: 0x7dad, - 0x1558: 0x7dcd, 0x1559: 0x0040, 0x155a: 0x0040, 0x155b: 0x0040, 0x155c: 0x0040, 0x155d: 0x0040, - 0x155e: 0x0040, 0x155f: 0x0040, 0x1560: 0x3308, 0x1561: 0x3308, 0x1562: 0x3308, 0x1563: 0x3308, - 0x1564: 0x3308, 0x1565: 0x3308, 0x1566: 0x3308, 0x1567: 0x3308, 0x1568: 0x3308, 0x1569: 0x3308, - 0x156a: 0x3308, 0x156b: 0x3308, 0x156c: 0x3308, 0x156d: 0x3308, 0x156e: 0x3308, 0x156f: 0x3308, - 0x1570: 0x0040, 0x1571: 0x7ded, 0x1572: 0x7e0d, 0x1573: 0xaf6a, 0x1574: 0xaf6a, 0x1575: 0x1fd2, - 0x1576: 0x1fe2, 0x1577: 0xaf7a, 0x1578: 0xaf8a, 0x1579: 0x7e2d, 0x157a: 0x7e4d, 0x157b: 0x7e6d, - 0x157c: 0x7e2d, 0x157d: 0x7e8d, 0x157e: 0x7ead, 0x157f: 0x7e8d, + 0x1540: 0x2081, 0x1541: 0x2089, 0x1542: 0x2089, 0x1543: 0x2091, 0x1544: 0x2091, 0x1545: 0x2099, + 0x1546: 0x2099, 0x1547: 0x20a1, 0x1548: 0x20a1, 0x1549: 0x20a9, 0x154a: 0x20a9, 0x154b: 0x20a9, + 0x154c: 0x20a9, 0x154d: 0x20b1, 0x154e: 0x20b1, 0x154f: 0x20b9, 0x1550: 0x20b9, 0x1551: 0x20b9, + 0x1552: 0x20b9, 0x1553: 0x20c1, 0x1554: 0x20c1, 0x1555: 0x20c9, 0x1556: 0x20c9, 0x1557: 0x20c9, + 0x1558: 0x20c9, 0x1559: 0x20d1, 0x155a: 0x20d1, 0x155b: 0x20d1, 0x155c: 0x20d1, 0x155d: 0x20d9, + 0x155e: 0x20d9, 0x155f: 0x20d9, 0x1560: 0x20d9, 0x1561: 0x20e1, 0x1562: 0x20e1, 0x1563: 0x20e1, + 0x1564: 0x20e1, 0x1565: 0x20e9, 0x1566: 0x20e9, 0x1567: 0x20e9, 0x1568: 0x20e9, 0x1569: 0x20f1, + 0x156a: 0x20f1, 0x156b: 0x20f9, 0x156c: 0x20f9, 0x156d: 0x2101, 0x156e: 0x2101, 0x156f: 0x2109, + 0x1570: 0x2109, 0x1571: 0x2111, 0x1572: 0x2111, 0x1573: 0x2111, 0x1574: 0x2111, 0x1575: 0x2119, + 0x1576: 0x2119, 0x1577: 0x2119, 0x1578: 0x2119, 0x1579: 0x2121, 0x157a: 0x2121, 0x157b: 0x2121, + 0x157c: 0x2121, 0x157d: 0x2129, 0x157e: 0x2129, 0x157f: 0x2129, // Block 0x56, offset 0x1580 - 0x1580: 0x7ecd, 0x1581: 0x7eed, 0x1582: 0x7f0d, 0x1583: 0x7eed, 0x1584: 0x7f2d, 0x1585: 0x0018, - 0x1586: 0x0018, 0x1587: 0xaf9a, 0x1588: 0xafaa, 0x1589: 0x7f4e, 0x158a: 0x7f6e, 0x158b: 0x7f8e, - 0x158c: 0x7fae, 0x158d: 0xaf6a, 0x158e: 0xaf6a, 0x158f: 0xaf6a, 0x1590: 0xaf2a, 0x1591: 0x7fcd, - 0x1592: 0x0040, 0x1593: 0x0040, 0x1594: 0x03c2, 0x1595: 0xaf3a, 0x1596: 0xaf5a, 0x1597: 0xaf4a, - 0x1598: 0x7fed, 0x1599: 0x1fd2, 0x159a: 0x1fe2, 0x159b: 0xaf7a, 0x159c: 0xaf8a, 0x159d: 0x7ecd, - 0x159e: 0x7f2d, 0x159f: 0xafba, 0x15a0: 0xafca, 0x15a1: 0xafda, 0x15a2: 0x1fb2, 0x15a3: 0xafe9, - 0x15a4: 0xaffa, 0x15a5: 0xb00a, 0x15a6: 0x1fc2, 0x15a7: 0x0040, 0x15a8: 0xb01a, 0x15a9: 0xb02a, - 0x15aa: 0xb03a, 0x15ab: 0xb04a, 0x15ac: 0x0040, 0x15ad: 0x0040, 0x15ae: 0x0040, 0x15af: 0x0040, - 0x15b0: 0x800e, 0x15b1: 0xb059, 0x15b2: 0x802e, 0x15b3: 0x0808, 0x15b4: 0x804e, 0x15b5: 0x0040, - 0x15b6: 0x806e, 0x15b7: 0xb081, 0x15b8: 0x808e, 0x15b9: 0xb0a9, 0x15ba: 0x80ae, 0x15bb: 0xb0d1, - 0x15bc: 0x80ce, 0x15bd: 0xb0f9, 0x15be: 0x80ee, 0x15bf: 0xb121, + 0x1580: 0x2129, 0x1581: 0x2131, 0x1582: 0x2131, 0x1583: 0x2131, 0x1584: 0x2131, 0x1585: 0x2139, + 0x1586: 0x2139, 0x1587: 0x2139, 0x1588: 0x2139, 0x1589: 0x2141, 0x158a: 0x2141, 0x158b: 0x2141, + 0x158c: 0x2141, 0x158d: 0x2149, 0x158e: 0x2149, 0x158f: 0x2149, 0x1590: 0x2149, 0x1591: 0x2151, + 0x1592: 0x2151, 0x1593: 0x2151, 0x1594: 0x2151, 0x1595: 0x2159, 0x1596: 0x2159, 0x1597: 0x2159, + 0x1598: 0x2159, 0x1599: 0x2161, 0x159a: 0x2161, 0x159b: 0x2161, 0x159c: 0x2161, 0x159d: 0x2169, + 0x159e: 0x2169, 0x159f: 0x2169, 0x15a0: 0x2169, 0x15a1: 0x2171, 0x15a2: 0x2171, 0x15a3: 0x2171, + 0x15a4: 0x2171, 0x15a5: 0x2179, 0x15a6: 0x2179, 0x15a7: 0x2179, 0x15a8: 0x2179, 0x15a9: 0x2181, + 0x15aa: 0x2181, 0x15ab: 0x2181, 0x15ac: 0x2181, 0x15ad: 0x2189, 0x15ae: 0x2189, 0x15af: 0x1701, + 0x15b0: 0x1701, 0x15b1: 0x2191, 0x15b2: 0x2191, 0x15b3: 0x2191, 0x15b4: 0x2191, 0x15b5: 0x2199, + 0x15b6: 0x2199, 0x15b7: 0x21a1, 0x15b8: 0x21a1, 0x15b9: 0x21a9, 0x15ba: 0x21a9, 0x15bb: 0x21b1, + 0x15bc: 0x21b1, 0x15bd: 0x0040, 0x15be: 0x0040, 0x15bf: 0x03c0, // Block 0x57, offset 0x15c0 - 0x15c0: 0xb149, 0x15c1: 0xb161, 0x15c2: 0xb161, 0x15c3: 0xb179, 0x15c4: 0xb179, 0x15c5: 0xb191, - 0x15c6: 0xb191, 0x15c7: 0xb1a9, 0x15c8: 0xb1a9, 0x15c9: 0xb1c1, 0x15ca: 0xb1c1, 0x15cb: 0xb1c1, - 0x15cc: 0xb1c1, 0x15cd: 0xb1d9, 0x15ce: 0xb1d9, 0x15cf: 0xb1f1, 0x15d0: 0xb1f1, 0x15d1: 0xb1f1, - 0x15d2: 0xb1f1, 0x15d3: 0xb209, 0x15d4: 0xb209, 0x15d5: 0xb221, 0x15d6: 0xb221, 0x15d7: 0xb221, - 0x15d8: 0xb221, 0x15d9: 0xb239, 0x15da: 0xb239, 0x15db: 0xb239, 0x15dc: 0xb239, 0x15dd: 0xb251, - 0x15de: 0xb251, 0x15df: 0xb251, 0x15e0: 0xb251, 0x15e1: 0xb269, 0x15e2: 0xb269, 0x15e3: 0xb269, - 0x15e4: 0xb269, 0x15e5: 0xb281, 0x15e6: 0xb281, 0x15e7: 0xb281, 0x15e8: 0xb281, 0x15e9: 0xb299, - 0x15ea: 0xb299, 0x15eb: 0xb2b1, 0x15ec: 0xb2b1, 0x15ed: 0xb2c9, 0x15ee: 0xb2c9, 0x15ef: 0xb2e1, - 0x15f0: 0xb2e1, 0x15f1: 0xb2f9, 0x15f2: 0xb2f9, 0x15f3: 0xb2f9, 0x15f4: 0xb2f9, 0x15f5: 0xb311, - 0x15f6: 0xb311, 0x15f7: 0xb311, 0x15f8: 0xb311, 0x15f9: 0xb329, 0x15fa: 0xb329, 0x15fb: 0xb329, - 0x15fc: 0xb329, 0x15fd: 0xb341, 0x15fe: 0xb341, 0x15ff: 0xb341, + 0x15c0: 0x0040, 0x15c1: 0x1fca, 0x15c2: 0x21ba, 0x15c3: 0x2002, 0x15c4: 0x203a, 0x15c5: 0x2042, + 0x15c6: 0x200a, 0x15c7: 0x21c2, 0x15c8: 0x072a, 0x15c9: 0x0732, 0x15ca: 0x2012, 0x15cb: 0x071a, + 0x15cc: 0x1fba, 0x15cd: 0x2019, 0x15ce: 0x0961, 0x15cf: 0x21ca, 0x15d0: 0x06e1, 0x15d1: 0x0049, + 0x15d2: 0x0029, 0x15d3: 0x0031, 0x15d4: 0x06e9, 0x15d5: 0x06f1, 0x15d6: 0x06f9, 0x15d7: 0x0701, + 0x15d8: 0x0709, 0x15d9: 0x0711, 0x15da: 0x1fc2, 0x15db: 0x0122, 0x15dc: 0x2022, 0x15dd: 0x0722, + 0x15de: 0x202a, 0x15df: 0x1fd2, 0x15e0: 0x204a, 0x15e1: 0x0019, 0x15e2: 0x02e9, 0x15e3: 0x03d9, + 0x15e4: 0x02f1, 0x15e5: 0x02f9, 0x15e6: 0x03f1, 0x15e7: 0x0309, 0x15e8: 0x00a9, 0x15e9: 0x0311, + 0x15ea: 0x00b1, 0x15eb: 0x0319, 0x15ec: 0x0101, 0x15ed: 0x0321, 0x15ee: 0x0329, 0x15ef: 0x0051, + 0x15f0: 0x0339, 0x15f1: 0x0751, 0x15f2: 0x00b9, 0x15f3: 0x0089, 0x15f4: 0x0341, 0x15f5: 0x0349, + 0x15f6: 0x0391, 0x15f7: 0x00c1, 0x15f8: 0x0109, 0x15f9: 0x00c9, 0x15fa: 0x04b1, 0x15fb: 0x1ff2, + 0x15fc: 0x2032, 0x15fd: 0x1ffa, 0x15fe: 0x21d2, 0x15ff: 0x1fda, // Block 0x58, offset 0x1600 - 0x1600: 0xb341, 0x1601: 0xb359, 0x1602: 0xb359, 0x1603: 0xb359, 0x1604: 0xb359, 0x1605: 0xb371, - 0x1606: 0xb371, 0x1607: 0xb371, 0x1608: 0xb371, 0x1609: 0xb389, 0x160a: 0xb389, 0x160b: 0xb389, - 0x160c: 0xb389, 0x160d: 0xb3a1, 0x160e: 0xb3a1, 0x160f: 0xb3a1, 0x1610: 0xb3a1, 0x1611: 0xb3b9, - 0x1612: 0xb3b9, 0x1613: 0xb3b9, 0x1614: 0xb3b9, 0x1615: 0xb3d1, 0x1616: 0xb3d1, 0x1617: 0xb3d1, - 0x1618: 0xb3d1, 0x1619: 0xb3e9, 0x161a: 0xb3e9, 0x161b: 0xb3e9, 0x161c: 0xb3e9, 0x161d: 0xb401, - 0x161e: 0xb401, 0x161f: 0xb401, 0x1620: 0xb401, 0x1621: 0xb419, 0x1622: 0xb419, 0x1623: 0xb419, - 0x1624: 0xb419, 0x1625: 0xb431, 0x1626: 0xb431, 0x1627: 0xb431, 0x1628: 0xb431, 0x1629: 0xb449, - 0x162a: 0xb449, 0x162b: 0xb449, 0x162c: 0xb449, 0x162d: 0xb461, 0x162e: 0xb461, 0x162f: 0x7b01, - 0x1630: 0x7b01, 0x1631: 0xb479, 0x1632: 0xb479, 0x1633: 0xb479, 0x1634: 0xb479, 0x1635: 0xb491, - 0x1636: 0xb491, 0x1637: 0xb4b9, 0x1638: 0xb4b9, 0x1639: 0xb4e1, 0x163a: 0xb4e1, 0x163b: 0xb509, - 0x163c: 0xb509, 0x163d: 0x0040, 0x163e: 0x0040, 0x163f: 0x03c0, + 0x1600: 0x0672, 0x1601: 0x0019, 0x1602: 0x02e9, 0x1603: 0x03d9, 0x1604: 0x02f1, 0x1605: 0x02f9, + 0x1606: 0x03f1, 0x1607: 0x0309, 0x1608: 0x00a9, 0x1609: 0x0311, 0x160a: 0x00b1, 0x160b: 0x0319, + 0x160c: 0x0101, 0x160d: 0x0321, 0x160e: 0x0329, 0x160f: 0x0051, 0x1610: 0x0339, 0x1611: 0x0751, + 0x1612: 0x00b9, 0x1613: 0x0089, 0x1614: 0x0341, 0x1615: 0x0349, 0x1616: 0x0391, 0x1617: 0x00c1, + 0x1618: 0x0109, 0x1619: 0x00c9, 0x161a: 0x04b1, 0x161b: 0x1fe2, 0x161c: 0x21da, 0x161d: 0x1fea, + 0x161e: 0x21e2, 0x161f: 0x810d, 0x1620: 0x812d, 0x1621: 0x0961, 0x1622: 0x814d, 0x1623: 0x814d, + 0x1624: 0x816d, 0x1625: 0x818d, 0x1626: 0x81ad, 0x1627: 0x81cd, 0x1628: 0x81ed, 0x1629: 0x820d, + 0x162a: 0x822d, 0x162b: 0x824d, 0x162c: 0x826d, 0x162d: 0x828d, 0x162e: 0x82ad, 0x162f: 0x82cd, + 0x1630: 0x82ed, 0x1631: 0x830d, 0x1632: 0x832d, 0x1633: 0x834d, 0x1634: 0x836d, 0x1635: 0x838d, + 0x1636: 0x83ad, 0x1637: 0x83cd, 0x1638: 0x83ed, 0x1639: 0x840d, 0x163a: 0x842d, 0x163b: 0x844d, + 0x163c: 0x81ed, 0x163d: 0x846d, 0x163e: 0x848d, 0x163f: 0x824d, // Block 0x59, offset 0x1640 - 0x1640: 0x0040, 0x1641: 0xaf4a, 0x1642: 0xb532, 0x1643: 0xafba, 0x1644: 0xb02a, 0x1645: 0xb03a, - 0x1646: 0xafca, 0x1647: 0xb542, 0x1648: 0x1fd2, 0x1649: 0x1fe2, 0x164a: 0xafda, 0x164b: 0x1fb2, - 0x164c: 0xaf2a, 0x164d: 0xafe9, 0x164e: 0x29d1, 0x164f: 0xb552, 0x1650: 0x1f41, 0x1651: 0x00c9, - 0x1652: 0x0069, 0x1653: 0x0079, 0x1654: 0x1f51, 0x1655: 0x1f61, 0x1656: 0x1f71, 0x1657: 0x1f81, - 0x1658: 0x1f91, 0x1659: 0x1fa1, 0x165a: 0xaf3a, 0x165b: 0x03c2, 0x165c: 0xaffa, 0x165d: 0x1fc2, - 0x165e: 0xb00a, 0x165f: 0xaf5a, 0x1660: 0xb04a, 0x1661: 0x0039, 0x1662: 0x0ee9, 0x1663: 0x1159, - 0x1664: 0x0ef9, 0x1665: 0x0f09, 0x1666: 0x1199, 0x1667: 0x0f31, 0x1668: 0x0249, 0x1669: 0x0f41, - 0x166a: 0x0259, 0x166b: 0x0f51, 0x166c: 0x0359, 0x166d: 0x0f61, 0x166e: 0x0f71, 0x166f: 0x00d9, - 0x1670: 0x0f99, 0x1671: 0x2039, 0x1672: 0x0269, 0x1673: 0x01d9, 0x1674: 0x0fa9, 0x1675: 0x0fb9, - 0x1676: 0x1089, 0x1677: 0x0279, 0x1678: 0x0369, 0x1679: 0x0289, 0x167a: 0x13d1, 0x167b: 0xaf9a, - 0x167c: 0xb01a, 0x167d: 0xafaa, 0x167e: 0xb562, 0x167f: 0xaf6a, + 0x1640: 0x84ad, 0x1641: 0x84cd, 0x1642: 0x84ed, 0x1643: 0x850d, 0x1644: 0x852d, 0x1645: 0x854d, + 0x1646: 0x856d, 0x1647: 0x858d, 0x1648: 0x850d, 0x1649: 0x85ad, 0x164a: 0x850d, 0x164b: 0x85cd, + 0x164c: 0x85cd, 0x164d: 0x85ed, 0x164e: 0x85ed, 0x164f: 0x860d, 0x1650: 0x854d, 0x1651: 0x862d, + 0x1652: 0x864d, 0x1653: 0x862d, 0x1654: 0x866d, 0x1655: 0x864d, 0x1656: 0x868d, 0x1657: 0x868d, + 0x1658: 0x86ad, 0x1659: 0x86ad, 0x165a: 0x86cd, 0x165b: 0x86cd, 0x165c: 0x864d, 0x165d: 0x814d, + 0x165e: 0x86ed, 0x165f: 0x870d, 0x1660: 0x0040, 0x1661: 0x872d, 0x1662: 0x874d, 0x1663: 0x876d, + 0x1664: 0x878d, 0x1665: 0x876d, 0x1666: 0x87ad, 0x1667: 0x87cd, 0x1668: 0x87ed, 0x1669: 0x87ed, + 0x166a: 0x880d, 0x166b: 0x880d, 0x166c: 0x882d, 0x166d: 0x882d, 0x166e: 0x880d, 0x166f: 0x880d, + 0x1670: 0x884d, 0x1671: 0x886d, 0x1672: 0x888d, 0x1673: 0x88ad, 0x1674: 0x88cd, 0x1675: 0x88ed, + 0x1676: 0x88ed, 0x1677: 0x88ed, 0x1678: 0x890d, 0x1679: 0x890d, 0x167a: 0x890d, 0x167b: 0x890d, + 0x167c: 0x87ed, 0x167d: 0x87ed, 0x167e: 0x87ed, 0x167f: 0x0040, // Block 0x5a, offset 0x1680 - 0x1680: 0x1caa, 0x1681: 0x0039, 0x1682: 0x0ee9, 0x1683: 0x1159, 0x1684: 0x0ef9, 0x1685: 0x0f09, - 0x1686: 0x1199, 0x1687: 0x0f31, 0x1688: 0x0249, 0x1689: 0x0f41, 0x168a: 0x0259, 0x168b: 0x0f51, - 0x168c: 0x0359, 0x168d: 0x0f61, 0x168e: 0x0f71, 0x168f: 0x00d9, 0x1690: 0x0f99, 0x1691: 0x2039, - 0x1692: 0x0269, 0x1693: 0x01d9, 0x1694: 0x0fa9, 0x1695: 0x0fb9, 0x1696: 0x1089, 0x1697: 0x0279, - 0x1698: 0x0369, 0x1699: 0x0289, 0x169a: 0x13d1, 0x169b: 0xaf7a, 0x169c: 0xb572, 0x169d: 0xaf8a, - 0x169e: 0xb582, 0x169f: 0x810d, 0x16a0: 0x812d, 0x16a1: 0x29d1, 0x16a2: 0x814d, 0x16a3: 0x814d, - 0x16a4: 0x816d, 0x16a5: 0x818d, 0x16a6: 0x81ad, 0x16a7: 0x81cd, 0x16a8: 0x81ed, 0x16a9: 0x820d, - 0x16aa: 0x822d, 0x16ab: 0x824d, 0x16ac: 0x826d, 0x16ad: 0x828d, 0x16ae: 0x82ad, 0x16af: 0x82cd, - 0x16b0: 0x82ed, 0x16b1: 0x830d, 0x16b2: 0x832d, 0x16b3: 0x834d, 0x16b4: 0x836d, 0x16b5: 0x838d, - 0x16b6: 0x83ad, 0x16b7: 0x83cd, 0x16b8: 0x83ed, 0x16b9: 0x840d, 0x16ba: 0x842d, 0x16bb: 0x844d, - 0x16bc: 0x81ed, 0x16bd: 0x846d, 0x16be: 0x848d, 0x16bf: 0x824d, + 0x1680: 0x0040, 0x1681: 0x0040, 0x1682: 0x874d, 0x1683: 0x872d, 0x1684: 0x892d, 0x1685: 0x872d, + 0x1686: 0x874d, 0x1687: 0x872d, 0x1688: 0x0040, 0x1689: 0x0040, 0x168a: 0x894d, 0x168b: 0x874d, + 0x168c: 0x896d, 0x168d: 0x892d, 0x168e: 0x896d, 0x168f: 0x874d, 0x1690: 0x0040, 0x1691: 0x0040, + 0x1692: 0x898d, 0x1693: 0x89ad, 0x1694: 0x88ad, 0x1695: 0x896d, 0x1696: 0x892d, 0x1697: 0x896d, + 0x1698: 0x0040, 0x1699: 0x0040, 0x169a: 0x89cd, 0x169b: 0x89ed, 0x169c: 0x89cd, 0x169d: 0x0040, + 0x169e: 0x0040, 0x169f: 0x0040, 0x16a0: 0x21e9, 0x16a1: 0x21f1, 0x16a2: 0x21f9, 0x16a3: 0x8a0e, + 0x16a4: 0x2201, 0x16a5: 0x2209, 0x16a6: 0x8a2d, 0x16a7: 0x0040, 0x16a8: 0x8a4d, 0x16a9: 0x8a6d, + 0x16aa: 0x8a8d, 0x16ab: 0x8a6d, 0x16ac: 0x8aad, 0x16ad: 0x8acd, 0x16ae: 0x8aed, 0x16af: 0x0040, + 0x16b0: 0x0040, 0x16b1: 0x0040, 0x16b2: 0x0040, 0x16b3: 0x0040, 0x16b4: 0x0040, 0x16b5: 0x0040, + 0x16b6: 0x0040, 0x16b7: 0x0040, 0x16b8: 0x0040, 0x16b9: 0x0340, 0x16ba: 0x0340, 0x16bb: 0x0340, + 0x16bc: 0x0040, 0x16bd: 0x0040, 0x16be: 0x0040, 0x16bf: 0x0040, // Block 0x5b, offset 0x16c0 - 0x16c0: 0x84ad, 0x16c1: 0x84cd, 0x16c2: 0x84ed, 0x16c3: 0x850d, 0x16c4: 0x852d, 0x16c5: 0x854d, - 0x16c6: 0x856d, 0x16c7: 0x858d, 0x16c8: 0x850d, 0x16c9: 0x85ad, 0x16ca: 0x850d, 0x16cb: 0x85cd, - 0x16cc: 0x85cd, 0x16cd: 0x85ed, 0x16ce: 0x85ed, 0x16cf: 0x860d, 0x16d0: 0x854d, 0x16d1: 0x862d, - 0x16d2: 0x864d, 0x16d3: 0x862d, 0x16d4: 0x866d, 0x16d5: 0x864d, 0x16d6: 0x868d, 0x16d7: 0x868d, - 0x16d8: 0x86ad, 0x16d9: 0x86ad, 0x16da: 0x86cd, 0x16db: 0x86cd, 0x16dc: 0x864d, 0x16dd: 0x814d, - 0x16de: 0x86ed, 0x16df: 0x870d, 0x16e0: 0x0040, 0x16e1: 0x872d, 0x16e2: 0x874d, 0x16e3: 0x876d, - 0x16e4: 0x878d, 0x16e5: 0x876d, 0x16e6: 0x87ad, 0x16e7: 0x87cd, 0x16e8: 0x87ed, 0x16e9: 0x87ed, - 0x16ea: 0x880d, 0x16eb: 0x880d, 0x16ec: 0x882d, 0x16ed: 0x882d, 0x16ee: 0x880d, 0x16ef: 0x880d, - 0x16f0: 0x884d, 0x16f1: 0x886d, 0x16f2: 0x888d, 0x16f3: 0x88ad, 0x16f4: 0x88cd, 0x16f5: 0x88ed, - 0x16f6: 0x88ed, 0x16f7: 0x88ed, 0x16f8: 0x890d, 0x16f9: 0x890d, 0x16fa: 0x890d, 0x16fb: 0x890d, - 0x16fc: 0x87ed, 0x16fd: 0x87ed, 0x16fe: 0x87ed, 0x16ff: 0x0040, + 0x16c0: 0x0a08, 0x16c1: 0x0a08, 0x16c2: 0x0a08, 0x16c3: 0x0a08, 0x16c4: 0x0a08, 0x16c5: 0x0c08, + 0x16c6: 0x0808, 0x16c7: 0x0c08, 0x16c8: 0x0818, 0x16c9: 0x0c08, 0x16ca: 0x0c08, 0x16cb: 0x0808, + 0x16cc: 0x0808, 0x16cd: 0x0908, 0x16ce: 0x0c08, 0x16cf: 0x0c08, 0x16d0: 0x0c08, 0x16d1: 0x0c08, + 0x16d2: 0x0c08, 0x16d3: 0x0a08, 0x16d4: 0x0a08, 0x16d5: 0x0a08, 0x16d6: 0x0a08, 0x16d7: 0x0908, + 0x16d8: 0x0a08, 0x16d9: 0x0a08, 0x16da: 0x0a08, 0x16db: 0x0a08, 0x16dc: 0x0a08, 0x16dd: 0x0c08, + 0x16de: 0x0a08, 0x16df: 0x0a08, 0x16e0: 0x0a08, 0x16e1: 0x0c08, 0x16e2: 0x0808, 0x16e3: 0x0808, + 0x16e4: 0x0c08, 0x16e5: 0x3308, 0x16e6: 0x3308, 0x16e7: 0x0040, 0x16e8: 0x0040, 0x16e9: 0x0040, + 0x16ea: 0x0040, 0x16eb: 0x0a18, 0x16ec: 0x0a18, 0x16ed: 0x0a18, 0x16ee: 0x0a18, 0x16ef: 0x0c18, + 0x16f0: 0x0818, 0x16f1: 0x0818, 0x16f2: 0x0818, 0x16f3: 0x0818, 0x16f4: 0x0818, 0x16f5: 0x0818, + 0x16f6: 0x0818, 0x16f7: 0x0040, 0x16f8: 0x0040, 0x16f9: 0x0040, 0x16fa: 0x0040, 0x16fb: 0x0040, + 0x16fc: 0x0040, 0x16fd: 0x0040, 0x16fe: 0x0040, 0x16ff: 0x0040, // Block 0x5c, offset 0x1700 - 0x1700: 0x0040, 0x1701: 0x0040, 0x1702: 0x874d, 0x1703: 0x872d, 0x1704: 0x892d, 0x1705: 0x872d, - 0x1706: 0x874d, 0x1707: 0x872d, 0x1708: 0x0040, 0x1709: 0x0040, 0x170a: 0x894d, 0x170b: 0x874d, - 0x170c: 0x896d, 0x170d: 0x892d, 0x170e: 0x896d, 0x170f: 0x874d, 0x1710: 0x0040, 0x1711: 0x0040, - 0x1712: 0x898d, 0x1713: 0x89ad, 0x1714: 0x88ad, 0x1715: 0x896d, 0x1716: 0x892d, 0x1717: 0x896d, - 0x1718: 0x0040, 0x1719: 0x0040, 0x171a: 0x89cd, 0x171b: 0x89ed, 0x171c: 0x89cd, 0x171d: 0x0040, - 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0xb591, 0x1721: 0xb5a9, 0x1722: 0xb5c1, 0x1723: 0x8a0e, - 0x1724: 0xb5d9, 0x1725: 0xb5f1, 0x1726: 0x8a2d, 0x1727: 0x0040, 0x1728: 0x8a4d, 0x1729: 0x8a6d, - 0x172a: 0x8a8d, 0x172b: 0x8a6d, 0x172c: 0x8aad, 0x172d: 0x8acd, 0x172e: 0x8aed, 0x172f: 0x0040, + 0x1700: 0x0a08, 0x1701: 0x0c08, 0x1702: 0x0a08, 0x1703: 0x0c08, 0x1704: 0x0c08, 0x1705: 0x0c08, + 0x1706: 0x0a08, 0x1707: 0x0a08, 0x1708: 0x0a08, 0x1709: 0x0c08, 0x170a: 0x0a08, 0x170b: 0x0a08, + 0x170c: 0x0c08, 0x170d: 0x0a08, 0x170e: 0x0c08, 0x170f: 0x0c08, 0x1710: 0x0a08, 0x1711: 0x0c08, + 0x1712: 0x0040, 0x1713: 0x0040, 0x1714: 0x0040, 0x1715: 0x0040, 0x1716: 0x0040, 0x1717: 0x0040, + 0x1718: 0x0040, 0x1719: 0x0818, 0x171a: 0x0818, 0x171b: 0x0818, 0x171c: 0x0818, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x0040, 0x1721: 0x0040, 0x1722: 0x0040, 0x1723: 0x0040, + 0x1724: 0x0040, 0x1725: 0x0040, 0x1726: 0x0040, 0x1727: 0x0040, 0x1728: 0x0040, 0x1729: 0x0c18, + 0x172a: 0x0c18, 0x172b: 0x0c18, 0x172c: 0x0c18, 0x172d: 0x0a18, 0x172e: 0x0a18, 0x172f: 0x0818, 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, - 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0340, 0x173a: 0x0340, 0x173b: 0x0340, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0040, 0x173a: 0x0040, 0x173b: 0x0040, 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, // Block 0x5d, offset 0x1740 - 0x1740: 0x0a08, 0x1741: 0x0a08, 0x1742: 0x0a08, 0x1743: 0x0a08, 0x1744: 0x0a08, 0x1745: 0x0c08, - 0x1746: 0x0808, 0x1747: 0x0c08, 0x1748: 0x0818, 0x1749: 0x0c08, 0x174a: 0x0c08, 0x174b: 0x0808, - 0x174c: 0x0808, 0x174d: 0x0908, 0x174e: 0x0c08, 0x174f: 0x0c08, 0x1750: 0x0c08, 0x1751: 0x0c08, - 0x1752: 0x0c08, 0x1753: 0x0a08, 0x1754: 0x0a08, 0x1755: 0x0a08, 0x1756: 0x0a08, 0x1757: 0x0908, - 0x1758: 0x0a08, 0x1759: 0x0a08, 0x175a: 0x0a08, 0x175b: 0x0a08, 0x175c: 0x0a08, 0x175d: 0x0c08, - 0x175e: 0x0a08, 0x175f: 0x0a08, 0x1760: 0x0a08, 0x1761: 0x0c08, 0x1762: 0x0808, 0x1763: 0x0808, - 0x1764: 0x0c08, 0x1765: 0x3308, 0x1766: 0x3308, 0x1767: 0x0040, 0x1768: 0x0040, 0x1769: 0x0040, - 0x176a: 0x0040, 0x176b: 0x0a18, 0x176c: 0x0a18, 0x176d: 0x0a18, 0x176e: 0x0a18, 0x176f: 0x0c18, - 0x1770: 0x0818, 0x1771: 0x0818, 0x1772: 0x0818, 0x1773: 0x0818, 0x1774: 0x0818, 0x1775: 0x0818, - 0x1776: 0x0818, 0x1777: 0x0040, 0x1778: 0x0040, 0x1779: 0x0040, 0x177a: 0x0040, 0x177b: 0x0040, - 0x177c: 0x0040, 0x177d: 0x0040, 0x177e: 0x0040, 0x177f: 0x0040, + 0x1740: 0x3308, 0x1741: 0x3308, 0x1742: 0x3008, 0x1743: 0x3008, 0x1744: 0x0040, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0040, 0x174e: 0x0040, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0040, + 0x1752: 0x0040, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0008, 0x1765: 0x0008, 0x1766: 0x0008, 0x1767: 0x0008, 0x1768: 0x0008, 0x1769: 0x0040, + 0x176a: 0x0008, 0x176b: 0x0008, 0x176c: 0x0008, 0x176d: 0x0008, 0x176e: 0x0008, 0x176f: 0x0008, + 0x1770: 0x0008, 0x1771: 0x0040, 0x1772: 0x0008, 0x1773: 0x0008, 0x1774: 0x0040, 0x1775: 0x0008, + 0x1776: 0x0008, 0x1777: 0x0008, 0x1778: 0x0008, 0x1779: 0x0008, 0x177a: 0x0040, 0x177b: 0x3308, + 0x177c: 0x3308, 0x177d: 0x0008, 0x177e: 0x3008, 0x177f: 0x3008, // Block 0x5e, offset 0x1780 - 0x1780: 0x0a08, 0x1781: 0x0c08, 0x1782: 0x0a08, 0x1783: 0x0c08, 0x1784: 0x0c08, 0x1785: 0x0c08, - 0x1786: 0x0a08, 0x1787: 0x0a08, 0x1788: 0x0a08, 0x1789: 0x0c08, 0x178a: 0x0a08, 0x178b: 0x0a08, - 0x178c: 0x0c08, 0x178d: 0x0a08, 0x178e: 0x0c08, 0x178f: 0x0c08, 0x1790: 0x0a08, 0x1791: 0x0c08, - 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x0040, - 0x1798: 0x0040, 0x1799: 0x0818, 0x179a: 0x0818, 0x179b: 0x0818, 0x179c: 0x0818, 0x179d: 0x0040, - 0x179e: 0x0040, 0x179f: 0x0040, 0x17a0: 0x0040, 0x17a1: 0x0040, 0x17a2: 0x0040, 0x17a3: 0x0040, - 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x0040, 0x17a7: 0x0040, 0x17a8: 0x0040, 0x17a9: 0x0c18, - 0x17aa: 0x0c18, 0x17ab: 0x0c18, 0x17ac: 0x0c18, 0x17ad: 0x0a18, 0x17ae: 0x0a18, 0x17af: 0x0818, - 0x17b0: 0x0040, 0x17b1: 0x0040, 0x17b2: 0x0040, 0x17b3: 0x0040, 0x17b4: 0x0040, 0x17b5: 0x0040, + 0x1780: 0x3308, 0x1781: 0x3008, 0x1782: 0x3008, 0x1783: 0x3008, 0x1784: 0x3008, 0x1785: 0x0040, + 0x1786: 0x0040, 0x1787: 0x3008, 0x1788: 0x3008, 0x1789: 0x0040, 0x178a: 0x0040, 0x178b: 0x3008, + 0x178c: 0x3008, 0x178d: 0x3808, 0x178e: 0x0040, 0x178f: 0x0040, 0x1790: 0x0008, 0x1791: 0x0040, + 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x3008, + 0x1798: 0x0040, 0x1799: 0x0040, 0x179a: 0x0040, 0x179b: 0x0040, 0x179c: 0x0040, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x3008, 0x17a3: 0x3008, + 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x3308, 0x17a7: 0x3308, 0x17a8: 0x3308, 0x17a9: 0x3308, + 0x17aa: 0x3308, 0x17ab: 0x3308, 0x17ac: 0x3308, 0x17ad: 0x0040, 0x17ae: 0x0040, 0x17af: 0x0040, + 0x17b0: 0x3308, 0x17b1: 0x3308, 0x17b2: 0x3308, 0x17b3: 0x3308, 0x17b4: 0x3308, 0x17b5: 0x0040, 0x17b6: 0x0040, 0x17b7: 0x0040, 0x17b8: 0x0040, 0x17b9: 0x0040, 0x17ba: 0x0040, 0x17bb: 0x0040, 0x17bc: 0x0040, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, // Block 0x5f, offset 0x17c0 - 0x17c0: 0x3308, 0x17c1: 0x3308, 0x17c2: 0x3008, 0x17c3: 0x3008, 0x17c4: 0x0040, 0x17c5: 0x0008, - 0x17c6: 0x0008, 0x17c7: 0x0008, 0x17c8: 0x0008, 0x17c9: 0x0008, 0x17ca: 0x0008, 0x17cb: 0x0008, - 0x17cc: 0x0008, 0x17cd: 0x0040, 0x17ce: 0x0040, 0x17cf: 0x0008, 0x17d0: 0x0008, 0x17d1: 0x0040, - 0x17d2: 0x0040, 0x17d3: 0x0008, 0x17d4: 0x0008, 0x17d5: 0x0008, 0x17d6: 0x0008, 0x17d7: 0x0008, + 0x17c0: 0x0008, 0x17c1: 0x0008, 0x17c2: 0x0008, 0x17c3: 0x0008, 0x17c4: 0x0008, 0x17c5: 0x0008, + 0x17c6: 0x0008, 0x17c7: 0x0040, 0x17c8: 0x0040, 0x17c9: 0x0008, 0x17ca: 0x0040, 0x17cb: 0x0040, + 0x17cc: 0x0008, 0x17cd: 0x0008, 0x17ce: 0x0008, 0x17cf: 0x0008, 0x17d0: 0x0008, 0x17d1: 0x0008, + 0x17d2: 0x0008, 0x17d3: 0x0008, 0x17d4: 0x0040, 0x17d5: 0x0008, 0x17d6: 0x0008, 0x17d7: 0x0040, 0x17d8: 0x0008, 0x17d9: 0x0008, 0x17da: 0x0008, 0x17db: 0x0008, 0x17dc: 0x0008, 0x17dd: 0x0008, 0x17de: 0x0008, 0x17df: 0x0008, 0x17e0: 0x0008, 0x17e1: 0x0008, 0x17e2: 0x0008, 0x17e3: 0x0008, - 0x17e4: 0x0008, 0x17e5: 0x0008, 0x17e6: 0x0008, 0x17e7: 0x0008, 0x17e8: 0x0008, 0x17e9: 0x0040, + 0x17e4: 0x0008, 0x17e5: 0x0008, 0x17e6: 0x0008, 0x17e7: 0x0008, 0x17e8: 0x0008, 0x17e9: 0x0008, 0x17ea: 0x0008, 0x17eb: 0x0008, 0x17ec: 0x0008, 0x17ed: 0x0008, 0x17ee: 0x0008, 0x17ef: 0x0008, - 0x17f0: 0x0008, 0x17f1: 0x0040, 0x17f2: 0x0008, 0x17f3: 0x0008, 0x17f4: 0x0040, 0x17f5: 0x0008, - 0x17f6: 0x0008, 0x17f7: 0x0008, 0x17f8: 0x0008, 0x17f9: 0x0008, 0x17fa: 0x0040, 0x17fb: 0x3308, - 0x17fc: 0x3308, 0x17fd: 0x0008, 0x17fe: 0x3008, 0x17ff: 0x3008, + 0x17f0: 0x3008, 0x17f1: 0x3008, 0x17f2: 0x3008, 0x17f3: 0x3008, 0x17f4: 0x3008, 0x17f5: 0x3008, + 0x17f6: 0x0040, 0x17f7: 0x3008, 0x17f8: 0x3008, 0x17f9: 0x0040, 0x17fa: 0x0040, 0x17fb: 0x3308, + 0x17fc: 0x3308, 0x17fd: 0x3808, 0x17fe: 0x3b08, 0x17ff: 0x0008, // Block 0x60, offset 0x1800 - 0x1800: 0x3308, 0x1801: 0x3008, 0x1802: 0x3008, 0x1803: 0x3008, 0x1804: 0x3008, 0x1805: 0x0040, - 0x1806: 0x0040, 0x1807: 0x3008, 0x1808: 0x3008, 0x1809: 0x0040, 0x180a: 0x0040, 0x180b: 0x3008, - 0x180c: 0x3008, 0x180d: 0x3808, 0x180e: 0x0040, 0x180f: 0x0040, 0x1810: 0x0008, 0x1811: 0x0040, - 0x1812: 0x0040, 0x1813: 0x0040, 0x1814: 0x0040, 0x1815: 0x0040, 0x1816: 0x0040, 0x1817: 0x3008, - 0x1818: 0x0040, 0x1819: 0x0040, 0x181a: 0x0040, 0x181b: 0x0040, 0x181c: 0x0040, 0x181d: 0x0008, - 0x181e: 0x0008, 0x181f: 0x0008, 0x1820: 0x0008, 0x1821: 0x0008, 0x1822: 0x3008, 0x1823: 0x3008, - 0x1824: 0x0040, 0x1825: 0x0040, 0x1826: 0x3308, 0x1827: 0x3308, 0x1828: 0x3308, 0x1829: 0x3308, - 0x182a: 0x3308, 0x182b: 0x3308, 0x182c: 0x3308, 0x182d: 0x0040, 0x182e: 0x0040, 0x182f: 0x0040, - 0x1830: 0x3308, 0x1831: 0x3308, 0x1832: 0x3308, 0x1833: 0x3308, 0x1834: 0x3308, 0x1835: 0x0040, - 0x1836: 0x0040, 0x1837: 0x0040, 0x1838: 0x0040, 0x1839: 0x0040, 0x183a: 0x0040, 0x183b: 0x0040, - 0x183c: 0x0040, 0x183d: 0x0040, 0x183e: 0x0040, 0x183f: 0x0040, + 0x1800: 0x0019, 0x1801: 0x02e9, 0x1802: 0x03d9, 0x1803: 0x02f1, 0x1804: 0x02f9, 0x1805: 0x03f1, + 0x1806: 0x0309, 0x1807: 0x00a9, 0x1808: 0x0311, 0x1809: 0x00b1, 0x180a: 0x0319, 0x180b: 0x0101, + 0x180c: 0x0321, 0x180d: 0x0329, 0x180e: 0x0051, 0x180f: 0x0339, 0x1810: 0x0751, 0x1811: 0x00b9, + 0x1812: 0x0089, 0x1813: 0x0341, 0x1814: 0x0349, 0x1815: 0x0391, 0x1816: 0x00c1, 0x1817: 0x0109, + 0x1818: 0x00c9, 0x1819: 0x04b1, 0x181a: 0x0019, 0x181b: 0x02e9, 0x181c: 0x03d9, 0x181d: 0x02f1, + 0x181e: 0x02f9, 0x181f: 0x03f1, 0x1820: 0x0309, 0x1821: 0x00a9, 0x1822: 0x0311, 0x1823: 0x00b1, + 0x1824: 0x0319, 0x1825: 0x0101, 0x1826: 0x0321, 0x1827: 0x0329, 0x1828: 0x0051, 0x1829: 0x0339, + 0x182a: 0x0751, 0x182b: 0x00b9, 0x182c: 0x0089, 0x182d: 0x0341, 0x182e: 0x0349, 0x182f: 0x0391, + 0x1830: 0x00c1, 0x1831: 0x0109, 0x1832: 0x00c9, 0x1833: 0x04b1, 0x1834: 0x0019, 0x1835: 0x02e9, + 0x1836: 0x03d9, 0x1837: 0x02f1, 0x1838: 0x02f9, 0x1839: 0x03f1, 0x183a: 0x0309, 0x183b: 0x00a9, + 0x183c: 0x0311, 0x183d: 0x00b1, 0x183e: 0x0319, 0x183f: 0x0101, // Block 0x61, offset 0x1840 - 0x1840: 0x0008, 0x1841: 0x0008, 0x1842: 0x0008, 0x1843: 0x0008, 0x1844: 0x0008, 0x1845: 0x0008, - 0x1846: 0x0008, 0x1847: 0x0040, 0x1848: 0x0040, 0x1849: 0x0008, 0x184a: 0x0040, 0x184b: 0x0040, - 0x184c: 0x0008, 0x184d: 0x0008, 0x184e: 0x0008, 0x184f: 0x0008, 0x1850: 0x0008, 0x1851: 0x0008, - 0x1852: 0x0008, 0x1853: 0x0008, 0x1854: 0x0040, 0x1855: 0x0008, 0x1856: 0x0008, 0x1857: 0x0040, - 0x1858: 0x0008, 0x1859: 0x0008, 0x185a: 0x0008, 0x185b: 0x0008, 0x185c: 0x0008, 0x185d: 0x0008, - 0x185e: 0x0008, 0x185f: 0x0008, 0x1860: 0x0008, 0x1861: 0x0008, 0x1862: 0x0008, 0x1863: 0x0008, - 0x1864: 0x0008, 0x1865: 0x0008, 0x1866: 0x0008, 0x1867: 0x0008, 0x1868: 0x0008, 0x1869: 0x0008, - 0x186a: 0x0008, 0x186b: 0x0008, 0x186c: 0x0008, 0x186d: 0x0008, 0x186e: 0x0008, 0x186f: 0x0008, - 0x1870: 0x3008, 0x1871: 0x3008, 0x1872: 0x3008, 0x1873: 0x3008, 0x1874: 0x3008, 0x1875: 0x3008, - 0x1876: 0x0040, 0x1877: 0x3008, 0x1878: 0x3008, 0x1879: 0x0040, 0x187a: 0x0040, 0x187b: 0x3308, - 0x187c: 0x3308, 0x187d: 0x3808, 0x187e: 0x3b08, 0x187f: 0x0008, + 0x1840: 0x0321, 0x1841: 0x0329, 0x1842: 0x0051, 0x1843: 0x0339, 0x1844: 0x0751, 0x1845: 0x00b9, + 0x1846: 0x0089, 0x1847: 0x0341, 0x1848: 0x0349, 0x1849: 0x0391, 0x184a: 0x00c1, 0x184b: 0x0109, + 0x184c: 0x00c9, 0x184d: 0x04b1, 0x184e: 0x0019, 0x184f: 0x02e9, 0x1850: 0x03d9, 0x1851: 0x02f1, + 0x1852: 0x02f9, 0x1853: 0x03f1, 0x1854: 0x0309, 0x1855: 0x0040, 0x1856: 0x0311, 0x1857: 0x00b1, + 0x1858: 0x0319, 0x1859: 0x0101, 0x185a: 0x0321, 0x185b: 0x0329, 0x185c: 0x0051, 0x185d: 0x0339, + 0x185e: 0x0751, 0x185f: 0x00b9, 0x1860: 0x0089, 0x1861: 0x0341, 0x1862: 0x0349, 0x1863: 0x0391, + 0x1864: 0x00c1, 0x1865: 0x0109, 0x1866: 0x00c9, 0x1867: 0x04b1, 0x1868: 0x0019, 0x1869: 0x02e9, + 0x186a: 0x03d9, 0x186b: 0x02f1, 0x186c: 0x02f9, 0x186d: 0x03f1, 0x186e: 0x0309, 0x186f: 0x00a9, + 0x1870: 0x0311, 0x1871: 0x00b1, 0x1872: 0x0319, 0x1873: 0x0101, 0x1874: 0x0321, 0x1875: 0x0329, + 0x1876: 0x0051, 0x1877: 0x0339, 0x1878: 0x0751, 0x1879: 0x00b9, 0x187a: 0x0089, 0x187b: 0x0341, + 0x187c: 0x0349, 0x187d: 0x0391, 0x187e: 0x00c1, 0x187f: 0x0109, // Block 0x62, offset 0x1880 - 0x1880: 0x0039, 0x1881: 0x0ee9, 0x1882: 0x1159, 0x1883: 0x0ef9, 0x1884: 0x0f09, 0x1885: 0x1199, - 0x1886: 0x0f31, 0x1887: 0x0249, 0x1888: 0x0f41, 0x1889: 0x0259, 0x188a: 0x0f51, 0x188b: 0x0359, - 0x188c: 0x0f61, 0x188d: 0x0f71, 0x188e: 0x00d9, 0x188f: 0x0f99, 0x1890: 0x2039, 0x1891: 0x0269, - 0x1892: 0x01d9, 0x1893: 0x0fa9, 0x1894: 0x0fb9, 0x1895: 0x1089, 0x1896: 0x0279, 0x1897: 0x0369, - 0x1898: 0x0289, 0x1899: 0x13d1, 0x189a: 0x0039, 0x189b: 0x0ee9, 0x189c: 0x1159, 0x189d: 0x0ef9, - 0x189e: 0x0f09, 0x189f: 0x1199, 0x18a0: 0x0f31, 0x18a1: 0x0249, 0x18a2: 0x0f41, 0x18a3: 0x0259, - 0x18a4: 0x0f51, 0x18a5: 0x0359, 0x18a6: 0x0f61, 0x18a7: 0x0f71, 0x18a8: 0x00d9, 0x18a9: 0x0f99, - 0x18aa: 0x2039, 0x18ab: 0x0269, 0x18ac: 0x01d9, 0x18ad: 0x0fa9, 0x18ae: 0x0fb9, 0x18af: 0x1089, - 0x18b0: 0x0279, 0x18b1: 0x0369, 0x18b2: 0x0289, 0x18b3: 0x13d1, 0x18b4: 0x0039, 0x18b5: 0x0ee9, - 0x18b6: 0x1159, 0x18b7: 0x0ef9, 0x18b8: 0x0f09, 0x18b9: 0x1199, 0x18ba: 0x0f31, 0x18bb: 0x0249, - 0x18bc: 0x0f41, 0x18bd: 0x0259, 0x18be: 0x0f51, 0x18bf: 0x0359, + 0x1880: 0x00c9, 0x1881: 0x04b1, 0x1882: 0x0019, 0x1883: 0x02e9, 0x1884: 0x03d9, 0x1885: 0x02f1, + 0x1886: 0x02f9, 0x1887: 0x03f1, 0x1888: 0x0309, 0x1889: 0x00a9, 0x188a: 0x0311, 0x188b: 0x00b1, + 0x188c: 0x0319, 0x188d: 0x0101, 0x188e: 0x0321, 0x188f: 0x0329, 0x1890: 0x0051, 0x1891: 0x0339, + 0x1892: 0x0751, 0x1893: 0x00b9, 0x1894: 0x0089, 0x1895: 0x0341, 0x1896: 0x0349, 0x1897: 0x0391, + 0x1898: 0x00c1, 0x1899: 0x0109, 0x189a: 0x00c9, 0x189b: 0x04b1, 0x189c: 0x0019, 0x189d: 0x0040, + 0x189e: 0x03d9, 0x189f: 0x02f1, 0x18a0: 0x0040, 0x18a1: 0x0040, 0x18a2: 0x0309, 0x18a3: 0x0040, + 0x18a4: 0x0040, 0x18a5: 0x00b1, 0x18a6: 0x0319, 0x18a7: 0x0040, 0x18a8: 0x0040, 0x18a9: 0x0329, + 0x18aa: 0x0051, 0x18ab: 0x0339, 0x18ac: 0x0751, 0x18ad: 0x0040, 0x18ae: 0x0089, 0x18af: 0x0341, + 0x18b0: 0x0349, 0x18b1: 0x0391, 0x18b2: 0x00c1, 0x18b3: 0x0109, 0x18b4: 0x00c9, 0x18b5: 0x04b1, + 0x18b6: 0x0019, 0x18b7: 0x02e9, 0x18b8: 0x03d9, 0x18b9: 0x02f1, 0x18ba: 0x0040, 0x18bb: 0x03f1, + 0x18bc: 0x0040, 0x18bd: 0x00a9, 0x18be: 0x0311, 0x18bf: 0x00b1, // Block 0x63, offset 0x18c0 - 0x18c0: 0x0f61, 0x18c1: 0x0f71, 0x18c2: 0x00d9, 0x18c3: 0x0f99, 0x18c4: 0x2039, 0x18c5: 0x0269, - 0x18c6: 0x01d9, 0x18c7: 0x0fa9, 0x18c8: 0x0fb9, 0x18c9: 0x1089, 0x18ca: 0x0279, 0x18cb: 0x0369, - 0x18cc: 0x0289, 0x18cd: 0x13d1, 0x18ce: 0x0039, 0x18cf: 0x0ee9, 0x18d0: 0x1159, 0x18d1: 0x0ef9, - 0x18d2: 0x0f09, 0x18d3: 0x1199, 0x18d4: 0x0f31, 0x18d5: 0x0040, 0x18d6: 0x0f41, 0x18d7: 0x0259, - 0x18d8: 0x0f51, 0x18d9: 0x0359, 0x18da: 0x0f61, 0x18db: 0x0f71, 0x18dc: 0x00d9, 0x18dd: 0x0f99, - 0x18de: 0x2039, 0x18df: 0x0269, 0x18e0: 0x01d9, 0x18e1: 0x0fa9, 0x18e2: 0x0fb9, 0x18e3: 0x1089, - 0x18e4: 0x0279, 0x18e5: 0x0369, 0x18e6: 0x0289, 0x18e7: 0x13d1, 0x18e8: 0x0039, 0x18e9: 0x0ee9, - 0x18ea: 0x1159, 0x18eb: 0x0ef9, 0x18ec: 0x0f09, 0x18ed: 0x1199, 0x18ee: 0x0f31, 0x18ef: 0x0249, - 0x18f0: 0x0f41, 0x18f1: 0x0259, 0x18f2: 0x0f51, 0x18f3: 0x0359, 0x18f4: 0x0f61, 0x18f5: 0x0f71, - 0x18f6: 0x00d9, 0x18f7: 0x0f99, 0x18f8: 0x2039, 0x18f9: 0x0269, 0x18fa: 0x01d9, 0x18fb: 0x0fa9, - 0x18fc: 0x0fb9, 0x18fd: 0x1089, 0x18fe: 0x0279, 0x18ff: 0x0369, + 0x18c0: 0x0319, 0x18c1: 0x0101, 0x18c2: 0x0321, 0x18c3: 0x0329, 0x18c4: 0x0040, 0x18c5: 0x0339, + 0x18c6: 0x0751, 0x18c7: 0x00b9, 0x18c8: 0x0089, 0x18c9: 0x0341, 0x18ca: 0x0349, 0x18cb: 0x0391, + 0x18cc: 0x00c1, 0x18cd: 0x0109, 0x18ce: 0x00c9, 0x18cf: 0x04b1, 0x18d0: 0x0019, 0x18d1: 0x02e9, + 0x18d2: 0x03d9, 0x18d3: 0x02f1, 0x18d4: 0x02f9, 0x18d5: 0x03f1, 0x18d6: 0x0309, 0x18d7: 0x00a9, + 0x18d8: 0x0311, 0x18d9: 0x00b1, 0x18da: 0x0319, 0x18db: 0x0101, 0x18dc: 0x0321, 0x18dd: 0x0329, + 0x18de: 0x0051, 0x18df: 0x0339, 0x18e0: 0x0751, 0x18e1: 0x00b9, 0x18e2: 0x0089, 0x18e3: 0x0341, + 0x18e4: 0x0349, 0x18e5: 0x0391, 0x18e6: 0x00c1, 0x18e7: 0x0109, 0x18e8: 0x00c9, 0x18e9: 0x04b1, + 0x18ea: 0x0019, 0x18eb: 0x02e9, 0x18ec: 0x03d9, 0x18ed: 0x02f1, 0x18ee: 0x02f9, 0x18ef: 0x03f1, + 0x18f0: 0x0309, 0x18f1: 0x00a9, 0x18f2: 0x0311, 0x18f3: 0x00b1, 0x18f4: 0x0319, 0x18f5: 0x0101, + 0x18f6: 0x0321, 0x18f7: 0x0329, 0x18f8: 0x0051, 0x18f9: 0x0339, 0x18fa: 0x0751, 0x18fb: 0x00b9, + 0x18fc: 0x0089, 0x18fd: 0x0341, 0x18fe: 0x0349, 0x18ff: 0x0391, // Block 0x64, offset 0x1900 - 0x1900: 0x0289, 0x1901: 0x13d1, 0x1902: 0x0039, 0x1903: 0x0ee9, 0x1904: 0x1159, 0x1905: 0x0ef9, - 0x1906: 0x0f09, 0x1907: 0x1199, 0x1908: 0x0f31, 0x1909: 0x0249, 0x190a: 0x0f41, 0x190b: 0x0259, - 0x190c: 0x0f51, 0x190d: 0x0359, 0x190e: 0x0f61, 0x190f: 0x0f71, 0x1910: 0x00d9, 0x1911: 0x0f99, - 0x1912: 0x2039, 0x1913: 0x0269, 0x1914: 0x01d9, 0x1915: 0x0fa9, 0x1916: 0x0fb9, 0x1917: 0x1089, - 0x1918: 0x0279, 0x1919: 0x0369, 0x191a: 0x0289, 0x191b: 0x13d1, 0x191c: 0x0039, 0x191d: 0x0040, - 0x191e: 0x1159, 0x191f: 0x0ef9, 0x1920: 0x0040, 0x1921: 0x0040, 0x1922: 0x0f31, 0x1923: 0x0040, - 0x1924: 0x0040, 0x1925: 0x0259, 0x1926: 0x0f51, 0x1927: 0x0040, 0x1928: 0x0040, 0x1929: 0x0f71, - 0x192a: 0x00d9, 0x192b: 0x0f99, 0x192c: 0x2039, 0x192d: 0x0040, 0x192e: 0x01d9, 0x192f: 0x0fa9, - 0x1930: 0x0fb9, 0x1931: 0x1089, 0x1932: 0x0279, 0x1933: 0x0369, 0x1934: 0x0289, 0x1935: 0x13d1, - 0x1936: 0x0039, 0x1937: 0x0ee9, 0x1938: 0x1159, 0x1939: 0x0ef9, 0x193a: 0x0040, 0x193b: 0x1199, - 0x193c: 0x0040, 0x193d: 0x0249, 0x193e: 0x0f41, 0x193f: 0x0259, + 0x1900: 0x00c1, 0x1901: 0x0109, 0x1902: 0x00c9, 0x1903: 0x04b1, 0x1904: 0x0019, 0x1905: 0x02e9, + 0x1906: 0x0040, 0x1907: 0x02f1, 0x1908: 0x02f9, 0x1909: 0x03f1, 0x190a: 0x0309, 0x190b: 0x0040, + 0x190c: 0x0040, 0x190d: 0x00b1, 0x190e: 0x0319, 0x190f: 0x0101, 0x1910: 0x0321, 0x1911: 0x0329, + 0x1912: 0x0051, 0x1913: 0x0339, 0x1914: 0x0751, 0x1915: 0x0040, 0x1916: 0x0089, 0x1917: 0x0341, + 0x1918: 0x0349, 0x1919: 0x0391, 0x191a: 0x00c1, 0x191b: 0x0109, 0x191c: 0x00c9, 0x191d: 0x0040, + 0x191e: 0x0019, 0x191f: 0x02e9, 0x1920: 0x03d9, 0x1921: 0x02f1, 0x1922: 0x02f9, 0x1923: 0x03f1, + 0x1924: 0x0309, 0x1925: 0x00a9, 0x1926: 0x0311, 0x1927: 0x00b1, 0x1928: 0x0319, 0x1929: 0x0101, + 0x192a: 0x0321, 0x192b: 0x0329, 0x192c: 0x0051, 0x192d: 0x0339, 0x192e: 0x0751, 0x192f: 0x00b9, + 0x1930: 0x0089, 0x1931: 0x0341, 0x1932: 0x0349, 0x1933: 0x0391, 0x1934: 0x00c1, 0x1935: 0x0109, + 0x1936: 0x00c9, 0x1937: 0x04b1, 0x1938: 0x0019, 0x1939: 0x02e9, 0x193a: 0x0040, 0x193b: 0x02f1, + 0x193c: 0x02f9, 0x193d: 0x03f1, 0x193e: 0x0309, 0x193f: 0x0040, // Block 0x65, offset 0x1940 - 0x1940: 0x0f51, 0x1941: 0x0359, 0x1942: 0x0f61, 0x1943: 0x0f71, 0x1944: 0x0040, 0x1945: 0x0f99, - 0x1946: 0x2039, 0x1947: 0x0269, 0x1948: 0x01d9, 0x1949: 0x0fa9, 0x194a: 0x0fb9, 0x194b: 0x1089, - 0x194c: 0x0279, 0x194d: 0x0369, 0x194e: 0x0289, 0x194f: 0x13d1, 0x1950: 0x0039, 0x1951: 0x0ee9, - 0x1952: 0x1159, 0x1953: 0x0ef9, 0x1954: 0x0f09, 0x1955: 0x1199, 0x1956: 0x0f31, 0x1957: 0x0249, - 0x1958: 0x0f41, 0x1959: 0x0259, 0x195a: 0x0f51, 0x195b: 0x0359, 0x195c: 0x0f61, 0x195d: 0x0f71, - 0x195e: 0x00d9, 0x195f: 0x0f99, 0x1960: 0x2039, 0x1961: 0x0269, 0x1962: 0x01d9, 0x1963: 0x0fa9, - 0x1964: 0x0fb9, 0x1965: 0x1089, 0x1966: 0x0279, 0x1967: 0x0369, 0x1968: 0x0289, 0x1969: 0x13d1, - 0x196a: 0x0039, 0x196b: 0x0ee9, 0x196c: 0x1159, 0x196d: 0x0ef9, 0x196e: 0x0f09, 0x196f: 0x1199, - 0x1970: 0x0f31, 0x1971: 0x0249, 0x1972: 0x0f41, 0x1973: 0x0259, 0x1974: 0x0f51, 0x1975: 0x0359, - 0x1976: 0x0f61, 0x1977: 0x0f71, 0x1978: 0x00d9, 0x1979: 0x0f99, 0x197a: 0x2039, 0x197b: 0x0269, - 0x197c: 0x01d9, 0x197d: 0x0fa9, 0x197e: 0x0fb9, 0x197f: 0x1089, + 0x1940: 0x0311, 0x1941: 0x00b1, 0x1942: 0x0319, 0x1943: 0x0101, 0x1944: 0x0321, 0x1945: 0x0040, + 0x1946: 0x0051, 0x1947: 0x0040, 0x1948: 0x0040, 0x1949: 0x0040, 0x194a: 0x0089, 0x194b: 0x0341, + 0x194c: 0x0349, 0x194d: 0x0391, 0x194e: 0x00c1, 0x194f: 0x0109, 0x1950: 0x00c9, 0x1951: 0x0040, + 0x1952: 0x0019, 0x1953: 0x02e9, 0x1954: 0x03d9, 0x1955: 0x02f1, 0x1956: 0x02f9, 0x1957: 0x03f1, + 0x1958: 0x0309, 0x1959: 0x00a9, 0x195a: 0x0311, 0x195b: 0x00b1, 0x195c: 0x0319, 0x195d: 0x0101, + 0x195e: 0x0321, 0x195f: 0x0329, 0x1960: 0x0051, 0x1961: 0x0339, 0x1962: 0x0751, 0x1963: 0x00b9, + 0x1964: 0x0089, 0x1965: 0x0341, 0x1966: 0x0349, 0x1967: 0x0391, 0x1968: 0x00c1, 0x1969: 0x0109, + 0x196a: 0x00c9, 0x196b: 0x04b1, 0x196c: 0x0019, 0x196d: 0x02e9, 0x196e: 0x03d9, 0x196f: 0x02f1, + 0x1970: 0x02f9, 0x1971: 0x03f1, 0x1972: 0x0309, 0x1973: 0x00a9, 0x1974: 0x0311, 0x1975: 0x00b1, + 0x1976: 0x0319, 0x1977: 0x0101, 0x1978: 0x0321, 0x1979: 0x0329, 0x197a: 0x0051, 0x197b: 0x0339, + 0x197c: 0x0751, 0x197d: 0x00b9, 0x197e: 0x0089, 0x197f: 0x0341, // Block 0x66, offset 0x1980 - 0x1980: 0x0279, 0x1981: 0x0369, 0x1982: 0x0289, 0x1983: 0x13d1, 0x1984: 0x0039, 0x1985: 0x0ee9, - 0x1986: 0x0040, 0x1987: 0x0ef9, 0x1988: 0x0f09, 0x1989: 0x1199, 0x198a: 0x0f31, 0x198b: 0x0040, - 0x198c: 0x0040, 0x198d: 0x0259, 0x198e: 0x0f51, 0x198f: 0x0359, 0x1990: 0x0f61, 0x1991: 0x0f71, - 0x1992: 0x00d9, 0x1993: 0x0f99, 0x1994: 0x2039, 0x1995: 0x0040, 0x1996: 0x01d9, 0x1997: 0x0fa9, - 0x1998: 0x0fb9, 0x1999: 0x1089, 0x199a: 0x0279, 0x199b: 0x0369, 0x199c: 0x0289, 0x199d: 0x0040, - 0x199e: 0x0039, 0x199f: 0x0ee9, 0x19a0: 0x1159, 0x19a1: 0x0ef9, 0x19a2: 0x0f09, 0x19a3: 0x1199, - 0x19a4: 0x0f31, 0x19a5: 0x0249, 0x19a6: 0x0f41, 0x19a7: 0x0259, 0x19a8: 0x0f51, 0x19a9: 0x0359, - 0x19aa: 0x0f61, 0x19ab: 0x0f71, 0x19ac: 0x00d9, 0x19ad: 0x0f99, 0x19ae: 0x2039, 0x19af: 0x0269, - 0x19b0: 0x01d9, 0x19b1: 0x0fa9, 0x19b2: 0x0fb9, 0x19b3: 0x1089, 0x19b4: 0x0279, 0x19b5: 0x0369, - 0x19b6: 0x0289, 0x19b7: 0x13d1, 0x19b8: 0x0039, 0x19b9: 0x0ee9, 0x19ba: 0x0040, 0x19bb: 0x0ef9, - 0x19bc: 0x0f09, 0x19bd: 0x1199, 0x19be: 0x0f31, 0x19bf: 0x0040, + 0x1980: 0x0349, 0x1981: 0x0391, 0x1982: 0x00c1, 0x1983: 0x0109, 0x1984: 0x00c9, 0x1985: 0x04b1, + 0x1986: 0x0019, 0x1987: 0x02e9, 0x1988: 0x03d9, 0x1989: 0x02f1, 0x198a: 0x02f9, 0x198b: 0x03f1, + 0x198c: 0x0309, 0x198d: 0x00a9, 0x198e: 0x0311, 0x198f: 0x00b1, 0x1990: 0x0319, 0x1991: 0x0101, + 0x1992: 0x0321, 0x1993: 0x0329, 0x1994: 0x0051, 0x1995: 0x0339, 0x1996: 0x0751, 0x1997: 0x00b9, + 0x1998: 0x0089, 0x1999: 0x0341, 0x199a: 0x0349, 0x199b: 0x0391, 0x199c: 0x00c1, 0x199d: 0x0109, + 0x199e: 0x00c9, 0x199f: 0x04b1, 0x19a0: 0x0019, 0x19a1: 0x02e9, 0x19a2: 0x03d9, 0x19a3: 0x02f1, + 0x19a4: 0x02f9, 0x19a5: 0x03f1, 0x19a6: 0x0309, 0x19a7: 0x00a9, 0x19a8: 0x0311, 0x19a9: 0x00b1, + 0x19aa: 0x0319, 0x19ab: 0x0101, 0x19ac: 0x0321, 0x19ad: 0x0329, 0x19ae: 0x0051, 0x19af: 0x0339, + 0x19b0: 0x0751, 0x19b1: 0x00b9, 0x19b2: 0x0089, 0x19b3: 0x0341, 0x19b4: 0x0349, 0x19b5: 0x0391, + 0x19b6: 0x00c1, 0x19b7: 0x0109, 0x19b8: 0x00c9, 0x19b9: 0x04b1, 0x19ba: 0x0019, 0x19bb: 0x02e9, + 0x19bc: 0x03d9, 0x19bd: 0x02f1, 0x19be: 0x02f9, 0x19bf: 0x03f1, // Block 0x67, offset 0x19c0 - 0x19c0: 0x0f41, 0x19c1: 0x0259, 0x19c2: 0x0f51, 0x19c3: 0x0359, 0x19c4: 0x0f61, 0x19c5: 0x0040, - 0x19c6: 0x00d9, 0x19c7: 0x0040, 0x19c8: 0x0040, 0x19c9: 0x0040, 0x19ca: 0x01d9, 0x19cb: 0x0fa9, - 0x19cc: 0x0fb9, 0x19cd: 0x1089, 0x19ce: 0x0279, 0x19cf: 0x0369, 0x19d0: 0x0289, 0x19d1: 0x0040, - 0x19d2: 0x0039, 0x19d3: 0x0ee9, 0x19d4: 0x1159, 0x19d5: 0x0ef9, 0x19d6: 0x0f09, 0x19d7: 0x1199, - 0x19d8: 0x0f31, 0x19d9: 0x0249, 0x19da: 0x0f41, 0x19db: 0x0259, 0x19dc: 0x0f51, 0x19dd: 0x0359, - 0x19de: 0x0f61, 0x19df: 0x0f71, 0x19e0: 0x00d9, 0x19e1: 0x0f99, 0x19e2: 0x2039, 0x19e3: 0x0269, - 0x19e4: 0x01d9, 0x19e5: 0x0fa9, 0x19e6: 0x0fb9, 0x19e7: 0x1089, 0x19e8: 0x0279, 0x19e9: 0x0369, - 0x19ea: 0x0289, 0x19eb: 0x13d1, 0x19ec: 0x0039, 0x19ed: 0x0ee9, 0x19ee: 0x1159, 0x19ef: 0x0ef9, - 0x19f0: 0x0f09, 0x19f1: 0x1199, 0x19f2: 0x0f31, 0x19f3: 0x0249, 0x19f4: 0x0f41, 0x19f5: 0x0259, - 0x19f6: 0x0f51, 0x19f7: 0x0359, 0x19f8: 0x0f61, 0x19f9: 0x0f71, 0x19fa: 0x00d9, 0x19fb: 0x0f99, - 0x19fc: 0x2039, 0x19fd: 0x0269, 0x19fe: 0x01d9, 0x19ff: 0x0fa9, + 0x19c0: 0x0309, 0x19c1: 0x00a9, 0x19c2: 0x0311, 0x19c3: 0x00b1, 0x19c4: 0x0319, 0x19c5: 0x0101, + 0x19c6: 0x0321, 0x19c7: 0x0329, 0x19c8: 0x0051, 0x19c9: 0x0339, 0x19ca: 0x0751, 0x19cb: 0x00b9, + 0x19cc: 0x0089, 0x19cd: 0x0341, 0x19ce: 0x0349, 0x19cf: 0x0391, 0x19d0: 0x00c1, 0x19d1: 0x0109, + 0x19d2: 0x00c9, 0x19d3: 0x04b1, 0x19d4: 0x0019, 0x19d5: 0x02e9, 0x19d6: 0x03d9, 0x19d7: 0x02f1, + 0x19d8: 0x02f9, 0x19d9: 0x03f1, 0x19da: 0x0309, 0x19db: 0x00a9, 0x19dc: 0x0311, 0x19dd: 0x00b1, + 0x19de: 0x0319, 0x19df: 0x0101, 0x19e0: 0x0321, 0x19e1: 0x0329, 0x19e2: 0x0051, 0x19e3: 0x0339, + 0x19e4: 0x0751, 0x19e5: 0x00b9, 0x19e6: 0x0089, 0x19e7: 0x0341, 0x19e8: 0x0349, 0x19e9: 0x0391, + 0x19ea: 0x00c1, 0x19eb: 0x0109, 0x19ec: 0x00c9, 0x19ed: 0x04b1, 0x19ee: 0x0019, 0x19ef: 0x02e9, + 0x19f0: 0x03d9, 0x19f1: 0x02f1, 0x19f2: 0x02f9, 0x19f3: 0x03f1, 0x19f4: 0x0309, 0x19f5: 0x00a9, + 0x19f6: 0x0311, 0x19f7: 0x00b1, 0x19f8: 0x0319, 0x19f9: 0x0101, 0x19fa: 0x0321, 0x19fb: 0x0329, + 0x19fc: 0x0051, 0x19fd: 0x0339, 0x19fe: 0x0751, 0x19ff: 0x00b9, // Block 0x68, offset 0x1a00 - 0x1a00: 0x0fb9, 0x1a01: 0x1089, 0x1a02: 0x0279, 0x1a03: 0x0369, 0x1a04: 0x0289, 0x1a05: 0x13d1, - 0x1a06: 0x0039, 0x1a07: 0x0ee9, 0x1a08: 0x1159, 0x1a09: 0x0ef9, 0x1a0a: 0x0f09, 0x1a0b: 0x1199, - 0x1a0c: 0x0f31, 0x1a0d: 0x0249, 0x1a0e: 0x0f41, 0x1a0f: 0x0259, 0x1a10: 0x0f51, 0x1a11: 0x0359, - 0x1a12: 0x0f61, 0x1a13: 0x0f71, 0x1a14: 0x00d9, 0x1a15: 0x0f99, 0x1a16: 0x2039, 0x1a17: 0x0269, - 0x1a18: 0x01d9, 0x1a19: 0x0fa9, 0x1a1a: 0x0fb9, 0x1a1b: 0x1089, 0x1a1c: 0x0279, 0x1a1d: 0x0369, - 0x1a1e: 0x0289, 0x1a1f: 0x13d1, 0x1a20: 0x0039, 0x1a21: 0x0ee9, 0x1a22: 0x1159, 0x1a23: 0x0ef9, - 0x1a24: 0x0f09, 0x1a25: 0x1199, 0x1a26: 0x0f31, 0x1a27: 0x0249, 0x1a28: 0x0f41, 0x1a29: 0x0259, - 0x1a2a: 0x0f51, 0x1a2b: 0x0359, 0x1a2c: 0x0f61, 0x1a2d: 0x0f71, 0x1a2e: 0x00d9, 0x1a2f: 0x0f99, - 0x1a30: 0x2039, 0x1a31: 0x0269, 0x1a32: 0x01d9, 0x1a33: 0x0fa9, 0x1a34: 0x0fb9, 0x1a35: 0x1089, - 0x1a36: 0x0279, 0x1a37: 0x0369, 0x1a38: 0x0289, 0x1a39: 0x13d1, 0x1a3a: 0x0039, 0x1a3b: 0x0ee9, - 0x1a3c: 0x1159, 0x1a3d: 0x0ef9, 0x1a3e: 0x0f09, 0x1a3f: 0x1199, + 0x1a00: 0x0089, 0x1a01: 0x0341, 0x1a02: 0x0349, 0x1a03: 0x0391, 0x1a04: 0x00c1, 0x1a05: 0x0109, + 0x1a06: 0x00c9, 0x1a07: 0x04b1, 0x1a08: 0x0019, 0x1a09: 0x02e9, 0x1a0a: 0x03d9, 0x1a0b: 0x02f1, + 0x1a0c: 0x02f9, 0x1a0d: 0x03f1, 0x1a0e: 0x0309, 0x1a0f: 0x00a9, 0x1a10: 0x0311, 0x1a11: 0x00b1, + 0x1a12: 0x0319, 0x1a13: 0x0101, 0x1a14: 0x0321, 0x1a15: 0x0329, 0x1a16: 0x0051, 0x1a17: 0x0339, + 0x1a18: 0x0751, 0x1a19: 0x00b9, 0x1a1a: 0x0089, 0x1a1b: 0x0341, 0x1a1c: 0x0349, 0x1a1d: 0x0391, + 0x1a1e: 0x00c1, 0x1a1f: 0x0109, 0x1a20: 0x00c9, 0x1a21: 0x04b1, 0x1a22: 0x0019, 0x1a23: 0x02e9, + 0x1a24: 0x03d9, 0x1a25: 0x02f1, 0x1a26: 0x02f9, 0x1a27: 0x03f1, 0x1a28: 0x0309, 0x1a29: 0x00a9, + 0x1a2a: 0x0311, 0x1a2b: 0x00b1, 0x1a2c: 0x0319, 0x1a2d: 0x0101, 0x1a2e: 0x0321, 0x1a2f: 0x0329, + 0x1a30: 0x0051, 0x1a31: 0x0339, 0x1a32: 0x0751, 0x1a33: 0x00b9, 0x1a34: 0x0089, 0x1a35: 0x0341, + 0x1a36: 0x0349, 0x1a37: 0x0391, 0x1a38: 0x00c1, 0x1a39: 0x0109, 0x1a3a: 0x00c9, 0x1a3b: 0x04b1, + 0x1a3c: 0x0019, 0x1a3d: 0x02e9, 0x1a3e: 0x03d9, 0x1a3f: 0x02f1, // Block 0x69, offset 0x1a40 - 0x1a40: 0x0f31, 0x1a41: 0x0249, 0x1a42: 0x0f41, 0x1a43: 0x0259, 0x1a44: 0x0f51, 0x1a45: 0x0359, - 0x1a46: 0x0f61, 0x1a47: 0x0f71, 0x1a48: 0x00d9, 0x1a49: 0x0f99, 0x1a4a: 0x2039, 0x1a4b: 0x0269, - 0x1a4c: 0x01d9, 0x1a4d: 0x0fa9, 0x1a4e: 0x0fb9, 0x1a4f: 0x1089, 0x1a50: 0x0279, 0x1a51: 0x0369, - 0x1a52: 0x0289, 0x1a53: 0x13d1, 0x1a54: 0x0039, 0x1a55: 0x0ee9, 0x1a56: 0x1159, 0x1a57: 0x0ef9, - 0x1a58: 0x0f09, 0x1a59: 0x1199, 0x1a5a: 0x0f31, 0x1a5b: 0x0249, 0x1a5c: 0x0f41, 0x1a5d: 0x0259, - 0x1a5e: 0x0f51, 0x1a5f: 0x0359, 0x1a60: 0x0f61, 0x1a61: 0x0f71, 0x1a62: 0x00d9, 0x1a63: 0x0f99, - 0x1a64: 0x2039, 0x1a65: 0x0269, 0x1a66: 0x01d9, 0x1a67: 0x0fa9, 0x1a68: 0x0fb9, 0x1a69: 0x1089, - 0x1a6a: 0x0279, 0x1a6b: 0x0369, 0x1a6c: 0x0289, 0x1a6d: 0x13d1, 0x1a6e: 0x0039, 0x1a6f: 0x0ee9, - 0x1a70: 0x1159, 0x1a71: 0x0ef9, 0x1a72: 0x0f09, 0x1a73: 0x1199, 0x1a74: 0x0f31, 0x1a75: 0x0249, - 0x1a76: 0x0f41, 0x1a77: 0x0259, 0x1a78: 0x0f51, 0x1a79: 0x0359, 0x1a7a: 0x0f61, 0x1a7b: 0x0f71, - 0x1a7c: 0x00d9, 0x1a7d: 0x0f99, 0x1a7e: 0x2039, 0x1a7f: 0x0269, + 0x1a40: 0x02f9, 0x1a41: 0x03f1, 0x1a42: 0x0309, 0x1a43: 0x00a9, 0x1a44: 0x0311, 0x1a45: 0x00b1, + 0x1a46: 0x0319, 0x1a47: 0x0101, 0x1a48: 0x0321, 0x1a49: 0x0329, 0x1a4a: 0x0051, 0x1a4b: 0x0339, + 0x1a4c: 0x0751, 0x1a4d: 0x00b9, 0x1a4e: 0x0089, 0x1a4f: 0x0341, 0x1a50: 0x0349, 0x1a51: 0x0391, + 0x1a52: 0x00c1, 0x1a53: 0x0109, 0x1a54: 0x00c9, 0x1a55: 0x04b1, 0x1a56: 0x0019, 0x1a57: 0x02e9, + 0x1a58: 0x03d9, 0x1a59: 0x02f1, 0x1a5a: 0x02f9, 0x1a5b: 0x03f1, 0x1a5c: 0x0309, 0x1a5d: 0x00a9, + 0x1a5e: 0x0311, 0x1a5f: 0x00b1, 0x1a60: 0x0319, 0x1a61: 0x0101, 0x1a62: 0x0321, 0x1a63: 0x0329, + 0x1a64: 0x0051, 0x1a65: 0x0339, 0x1a66: 0x0751, 0x1a67: 0x00b9, 0x1a68: 0x0089, 0x1a69: 0x0341, + 0x1a6a: 0x0349, 0x1a6b: 0x0391, 0x1a6c: 0x00c1, 0x1a6d: 0x0109, 0x1a6e: 0x00c9, 0x1a6f: 0x04b1, + 0x1a70: 0x0019, 0x1a71: 0x02e9, 0x1a72: 0x03d9, 0x1a73: 0x02f1, 0x1a74: 0x02f9, 0x1a75: 0x03f1, + 0x1a76: 0x0309, 0x1a77: 0x00a9, 0x1a78: 0x0311, 0x1a79: 0x00b1, 0x1a7a: 0x0319, 0x1a7b: 0x0101, + 0x1a7c: 0x0321, 0x1a7d: 0x0329, 0x1a7e: 0x0051, 0x1a7f: 0x0339, // Block 0x6a, offset 0x1a80 - 0x1a80: 0x01d9, 0x1a81: 0x0fa9, 0x1a82: 0x0fb9, 0x1a83: 0x1089, 0x1a84: 0x0279, 0x1a85: 0x0369, - 0x1a86: 0x0289, 0x1a87: 0x13d1, 0x1a88: 0x0039, 0x1a89: 0x0ee9, 0x1a8a: 0x1159, 0x1a8b: 0x0ef9, - 0x1a8c: 0x0f09, 0x1a8d: 0x1199, 0x1a8e: 0x0f31, 0x1a8f: 0x0249, 0x1a90: 0x0f41, 0x1a91: 0x0259, - 0x1a92: 0x0f51, 0x1a93: 0x0359, 0x1a94: 0x0f61, 0x1a95: 0x0f71, 0x1a96: 0x00d9, 0x1a97: 0x0f99, - 0x1a98: 0x2039, 0x1a99: 0x0269, 0x1a9a: 0x01d9, 0x1a9b: 0x0fa9, 0x1a9c: 0x0fb9, 0x1a9d: 0x1089, - 0x1a9e: 0x0279, 0x1a9f: 0x0369, 0x1aa0: 0x0289, 0x1aa1: 0x13d1, 0x1aa2: 0x0039, 0x1aa3: 0x0ee9, - 0x1aa4: 0x1159, 0x1aa5: 0x0ef9, 0x1aa6: 0x0f09, 0x1aa7: 0x1199, 0x1aa8: 0x0f31, 0x1aa9: 0x0249, - 0x1aaa: 0x0f41, 0x1aab: 0x0259, 0x1aac: 0x0f51, 0x1aad: 0x0359, 0x1aae: 0x0f61, 0x1aaf: 0x0f71, - 0x1ab0: 0x00d9, 0x1ab1: 0x0f99, 0x1ab2: 0x2039, 0x1ab3: 0x0269, 0x1ab4: 0x01d9, 0x1ab5: 0x0fa9, - 0x1ab6: 0x0fb9, 0x1ab7: 0x1089, 0x1ab8: 0x0279, 0x1ab9: 0x0369, 0x1aba: 0x0289, 0x1abb: 0x13d1, - 0x1abc: 0x0039, 0x1abd: 0x0ee9, 0x1abe: 0x1159, 0x1abf: 0x0ef9, + 0x1a80: 0x0751, 0x1a81: 0x00b9, 0x1a82: 0x0089, 0x1a83: 0x0341, 0x1a84: 0x0349, 0x1a85: 0x0391, + 0x1a86: 0x00c1, 0x1a87: 0x0109, 0x1a88: 0x00c9, 0x1a89: 0x04b1, 0x1a8a: 0x0019, 0x1a8b: 0x02e9, + 0x1a8c: 0x03d9, 0x1a8d: 0x02f1, 0x1a8e: 0x02f9, 0x1a8f: 0x03f1, 0x1a90: 0x0309, 0x1a91: 0x00a9, + 0x1a92: 0x0311, 0x1a93: 0x00b1, 0x1a94: 0x0319, 0x1a95: 0x0101, 0x1a96: 0x0321, 0x1a97: 0x0329, + 0x1a98: 0x0051, 0x1a99: 0x0339, 0x1a9a: 0x0751, 0x1a9b: 0x00b9, 0x1a9c: 0x0089, 0x1a9d: 0x0341, + 0x1a9e: 0x0349, 0x1a9f: 0x0391, 0x1aa0: 0x00c1, 0x1aa1: 0x0109, 0x1aa2: 0x00c9, 0x1aa3: 0x04b1, + 0x1aa4: 0x2279, 0x1aa5: 0x2281, 0x1aa6: 0x0040, 0x1aa7: 0x0040, 0x1aa8: 0x2289, 0x1aa9: 0x0399, + 0x1aaa: 0x03a1, 0x1aab: 0x03a9, 0x1aac: 0x2291, 0x1aad: 0x2299, 0x1aae: 0x22a1, 0x1aaf: 0x04d1, + 0x1ab0: 0x05f9, 0x1ab1: 0x22a9, 0x1ab2: 0x22b1, 0x1ab3: 0x22b9, 0x1ab4: 0x22c1, 0x1ab5: 0x22c9, + 0x1ab6: 0x22d1, 0x1ab7: 0x0799, 0x1ab8: 0x03c1, 0x1ab9: 0x04d1, 0x1aba: 0x22d9, 0x1abb: 0x22e1, + 0x1abc: 0x22e9, 0x1abd: 0x03b1, 0x1abe: 0x03b9, 0x1abf: 0x22f1, // Block 0x6b, offset 0x1ac0 - 0x1ac0: 0x0f09, 0x1ac1: 0x1199, 0x1ac2: 0x0f31, 0x1ac3: 0x0249, 0x1ac4: 0x0f41, 0x1ac5: 0x0259, - 0x1ac6: 0x0f51, 0x1ac7: 0x0359, 0x1ac8: 0x0f61, 0x1ac9: 0x0f71, 0x1aca: 0x00d9, 0x1acb: 0x0f99, - 0x1acc: 0x2039, 0x1acd: 0x0269, 0x1ace: 0x01d9, 0x1acf: 0x0fa9, 0x1ad0: 0x0fb9, 0x1ad1: 0x1089, - 0x1ad2: 0x0279, 0x1ad3: 0x0369, 0x1ad4: 0x0289, 0x1ad5: 0x13d1, 0x1ad6: 0x0039, 0x1ad7: 0x0ee9, - 0x1ad8: 0x1159, 0x1ad9: 0x0ef9, 0x1ada: 0x0f09, 0x1adb: 0x1199, 0x1adc: 0x0f31, 0x1add: 0x0249, - 0x1ade: 0x0f41, 0x1adf: 0x0259, 0x1ae0: 0x0f51, 0x1ae1: 0x0359, 0x1ae2: 0x0f61, 0x1ae3: 0x0f71, - 0x1ae4: 0x00d9, 0x1ae5: 0x0f99, 0x1ae6: 0x2039, 0x1ae7: 0x0269, 0x1ae8: 0x01d9, 0x1ae9: 0x0fa9, - 0x1aea: 0x0fb9, 0x1aeb: 0x1089, 0x1aec: 0x0279, 0x1aed: 0x0369, 0x1aee: 0x0289, 0x1aef: 0x13d1, - 0x1af0: 0x0039, 0x1af1: 0x0ee9, 0x1af2: 0x1159, 0x1af3: 0x0ef9, 0x1af4: 0x0f09, 0x1af5: 0x1199, - 0x1af6: 0x0f31, 0x1af7: 0x0249, 0x1af8: 0x0f41, 0x1af9: 0x0259, 0x1afa: 0x0f51, 0x1afb: 0x0359, - 0x1afc: 0x0f61, 0x1afd: 0x0f71, 0x1afe: 0x00d9, 0x1aff: 0x0f99, + 0x1ac0: 0x0769, 0x1ac1: 0x22f9, 0x1ac2: 0x2289, 0x1ac3: 0x0399, 0x1ac4: 0x03a1, 0x1ac5: 0x03a9, + 0x1ac6: 0x2291, 0x1ac7: 0x2299, 0x1ac8: 0x22a1, 0x1ac9: 0x04d1, 0x1aca: 0x05f9, 0x1acb: 0x22a9, + 0x1acc: 0x22b1, 0x1acd: 0x22b9, 0x1ace: 0x22c1, 0x1acf: 0x22c9, 0x1ad0: 0x22d1, 0x1ad1: 0x0799, + 0x1ad2: 0x03c1, 0x1ad3: 0x22d9, 0x1ad4: 0x22d9, 0x1ad5: 0x22e1, 0x1ad6: 0x22e9, 0x1ad7: 0x03b1, + 0x1ad8: 0x03b9, 0x1ad9: 0x22f1, 0x1ada: 0x0769, 0x1adb: 0x2301, 0x1adc: 0x2291, 0x1add: 0x04d1, + 0x1ade: 0x22a9, 0x1adf: 0x03b1, 0x1ae0: 0x03c1, 0x1ae1: 0x0799, 0x1ae2: 0x2289, 0x1ae3: 0x0399, + 0x1ae4: 0x03a1, 0x1ae5: 0x03a9, 0x1ae6: 0x2291, 0x1ae7: 0x2299, 0x1ae8: 0x22a1, 0x1ae9: 0x04d1, + 0x1aea: 0x05f9, 0x1aeb: 0x22a9, 0x1aec: 0x22b1, 0x1aed: 0x22b9, 0x1aee: 0x22c1, 0x1aef: 0x22c9, + 0x1af0: 0x22d1, 0x1af1: 0x0799, 0x1af2: 0x03c1, 0x1af3: 0x04d1, 0x1af4: 0x22d9, 0x1af5: 0x22e1, + 0x1af6: 0x22e9, 0x1af7: 0x03b1, 0x1af8: 0x03b9, 0x1af9: 0x22f1, 0x1afa: 0x0769, 0x1afb: 0x22f9, + 0x1afc: 0x2289, 0x1afd: 0x0399, 0x1afe: 0x03a1, 0x1aff: 0x03a9, // Block 0x6c, offset 0x1b00 - 0x1b00: 0x2039, 0x1b01: 0x0269, 0x1b02: 0x01d9, 0x1b03: 0x0fa9, 0x1b04: 0x0fb9, 0x1b05: 0x1089, - 0x1b06: 0x0279, 0x1b07: 0x0369, 0x1b08: 0x0289, 0x1b09: 0x13d1, 0x1b0a: 0x0039, 0x1b0b: 0x0ee9, - 0x1b0c: 0x1159, 0x1b0d: 0x0ef9, 0x1b0e: 0x0f09, 0x1b0f: 0x1199, 0x1b10: 0x0f31, 0x1b11: 0x0249, - 0x1b12: 0x0f41, 0x1b13: 0x0259, 0x1b14: 0x0f51, 0x1b15: 0x0359, 0x1b16: 0x0f61, 0x1b17: 0x0f71, - 0x1b18: 0x00d9, 0x1b19: 0x0f99, 0x1b1a: 0x2039, 0x1b1b: 0x0269, 0x1b1c: 0x01d9, 0x1b1d: 0x0fa9, - 0x1b1e: 0x0fb9, 0x1b1f: 0x1089, 0x1b20: 0x0279, 0x1b21: 0x0369, 0x1b22: 0x0289, 0x1b23: 0x13d1, - 0x1b24: 0xbad1, 0x1b25: 0xbae9, 0x1b26: 0x0040, 0x1b27: 0x0040, 0x1b28: 0xbb01, 0x1b29: 0x1099, - 0x1b2a: 0x10b1, 0x1b2b: 0x10c9, 0x1b2c: 0xbb19, 0x1b2d: 0xbb31, 0x1b2e: 0xbb49, 0x1b2f: 0x1429, - 0x1b30: 0x1a31, 0x1b31: 0xbb61, 0x1b32: 0xbb79, 0x1b33: 0xbb91, 0x1b34: 0xbba9, 0x1b35: 0xbbc1, - 0x1b36: 0xbbd9, 0x1b37: 0x2109, 0x1b38: 0x1111, 0x1b39: 0x1429, 0x1b3a: 0xbbf1, 0x1b3b: 0xbc09, - 0x1b3c: 0xbc21, 0x1b3d: 0x10e1, 0x1b3e: 0x10f9, 0x1b3f: 0xbc39, + 0x1b00: 0x2291, 0x1b01: 0x2299, 0x1b02: 0x22a1, 0x1b03: 0x04d1, 0x1b04: 0x05f9, 0x1b05: 0x22a9, + 0x1b06: 0x22b1, 0x1b07: 0x22b9, 0x1b08: 0x22c1, 0x1b09: 0x22c9, 0x1b0a: 0x22d1, 0x1b0b: 0x0799, + 0x1b0c: 0x03c1, 0x1b0d: 0x22d9, 0x1b0e: 0x22d9, 0x1b0f: 0x22e1, 0x1b10: 0x22e9, 0x1b11: 0x03b1, + 0x1b12: 0x03b9, 0x1b13: 0x22f1, 0x1b14: 0x0769, 0x1b15: 0x2301, 0x1b16: 0x2291, 0x1b17: 0x04d1, + 0x1b18: 0x22a9, 0x1b19: 0x03b1, 0x1b1a: 0x03c1, 0x1b1b: 0x0799, 0x1b1c: 0x2289, 0x1b1d: 0x0399, + 0x1b1e: 0x03a1, 0x1b1f: 0x03a9, 0x1b20: 0x2291, 0x1b21: 0x2299, 0x1b22: 0x22a1, 0x1b23: 0x04d1, + 0x1b24: 0x05f9, 0x1b25: 0x22a9, 0x1b26: 0x22b1, 0x1b27: 0x22b9, 0x1b28: 0x22c1, 0x1b29: 0x22c9, + 0x1b2a: 0x22d1, 0x1b2b: 0x0799, 0x1b2c: 0x03c1, 0x1b2d: 0x04d1, 0x1b2e: 0x22d9, 0x1b2f: 0x22e1, + 0x1b30: 0x22e9, 0x1b31: 0x03b1, 0x1b32: 0x03b9, 0x1b33: 0x22f1, 0x1b34: 0x0769, 0x1b35: 0x22f9, + 0x1b36: 0x2289, 0x1b37: 0x0399, 0x1b38: 0x03a1, 0x1b39: 0x03a9, 0x1b3a: 0x2291, 0x1b3b: 0x2299, + 0x1b3c: 0x22a1, 0x1b3d: 0x04d1, 0x1b3e: 0x05f9, 0x1b3f: 0x22a9, // Block 0x6d, offset 0x1b40 - 0x1b40: 0x2079, 0x1b41: 0xbc51, 0x1b42: 0xbb01, 0x1b43: 0x1099, 0x1b44: 0x10b1, 0x1b45: 0x10c9, - 0x1b46: 0xbb19, 0x1b47: 0xbb31, 0x1b48: 0xbb49, 0x1b49: 0x1429, 0x1b4a: 0x1a31, 0x1b4b: 0xbb61, - 0x1b4c: 0xbb79, 0x1b4d: 0xbb91, 0x1b4e: 0xbba9, 0x1b4f: 0xbbc1, 0x1b50: 0xbbd9, 0x1b51: 0x2109, - 0x1b52: 0x1111, 0x1b53: 0xbbf1, 0x1b54: 0xbbf1, 0x1b55: 0xbc09, 0x1b56: 0xbc21, 0x1b57: 0x10e1, - 0x1b58: 0x10f9, 0x1b59: 0xbc39, 0x1b5a: 0x2079, 0x1b5b: 0xbc71, 0x1b5c: 0xbb19, 0x1b5d: 0x1429, - 0x1b5e: 0xbb61, 0x1b5f: 0x10e1, 0x1b60: 0x1111, 0x1b61: 0x2109, 0x1b62: 0xbb01, 0x1b63: 0x1099, - 0x1b64: 0x10b1, 0x1b65: 0x10c9, 0x1b66: 0xbb19, 0x1b67: 0xbb31, 0x1b68: 0xbb49, 0x1b69: 0x1429, - 0x1b6a: 0x1a31, 0x1b6b: 0xbb61, 0x1b6c: 0xbb79, 0x1b6d: 0xbb91, 0x1b6e: 0xbba9, 0x1b6f: 0xbbc1, - 0x1b70: 0xbbd9, 0x1b71: 0x2109, 0x1b72: 0x1111, 0x1b73: 0x1429, 0x1b74: 0xbbf1, 0x1b75: 0xbc09, - 0x1b76: 0xbc21, 0x1b77: 0x10e1, 0x1b78: 0x10f9, 0x1b79: 0xbc39, 0x1b7a: 0x2079, 0x1b7b: 0xbc51, - 0x1b7c: 0xbb01, 0x1b7d: 0x1099, 0x1b7e: 0x10b1, 0x1b7f: 0x10c9, + 0x1b40: 0x22b1, 0x1b41: 0x22b9, 0x1b42: 0x22c1, 0x1b43: 0x22c9, 0x1b44: 0x22d1, 0x1b45: 0x0799, + 0x1b46: 0x03c1, 0x1b47: 0x22d9, 0x1b48: 0x22d9, 0x1b49: 0x22e1, 0x1b4a: 0x22e9, 0x1b4b: 0x03b1, + 0x1b4c: 0x03b9, 0x1b4d: 0x22f1, 0x1b4e: 0x0769, 0x1b4f: 0x2301, 0x1b50: 0x2291, 0x1b51: 0x04d1, + 0x1b52: 0x22a9, 0x1b53: 0x03b1, 0x1b54: 0x03c1, 0x1b55: 0x0799, 0x1b56: 0x2289, 0x1b57: 0x0399, + 0x1b58: 0x03a1, 0x1b59: 0x03a9, 0x1b5a: 0x2291, 0x1b5b: 0x2299, 0x1b5c: 0x22a1, 0x1b5d: 0x04d1, + 0x1b5e: 0x05f9, 0x1b5f: 0x22a9, 0x1b60: 0x22b1, 0x1b61: 0x22b9, 0x1b62: 0x22c1, 0x1b63: 0x22c9, + 0x1b64: 0x22d1, 0x1b65: 0x0799, 0x1b66: 0x03c1, 0x1b67: 0x04d1, 0x1b68: 0x22d9, 0x1b69: 0x22e1, + 0x1b6a: 0x22e9, 0x1b6b: 0x03b1, 0x1b6c: 0x03b9, 0x1b6d: 0x22f1, 0x1b6e: 0x0769, 0x1b6f: 0x22f9, + 0x1b70: 0x2289, 0x1b71: 0x0399, 0x1b72: 0x03a1, 0x1b73: 0x03a9, 0x1b74: 0x2291, 0x1b75: 0x2299, + 0x1b76: 0x22a1, 0x1b77: 0x04d1, 0x1b78: 0x05f9, 0x1b79: 0x22a9, 0x1b7a: 0x22b1, 0x1b7b: 0x22b9, + 0x1b7c: 0x22c1, 0x1b7d: 0x22c9, 0x1b7e: 0x22d1, 0x1b7f: 0x0799, // Block 0x6e, offset 0x1b80 - 0x1b80: 0xbb19, 0x1b81: 0xbb31, 0x1b82: 0xbb49, 0x1b83: 0x1429, 0x1b84: 0x1a31, 0x1b85: 0xbb61, - 0x1b86: 0xbb79, 0x1b87: 0xbb91, 0x1b88: 0xbba9, 0x1b89: 0xbbc1, 0x1b8a: 0xbbd9, 0x1b8b: 0x2109, - 0x1b8c: 0x1111, 0x1b8d: 0xbbf1, 0x1b8e: 0xbbf1, 0x1b8f: 0xbc09, 0x1b90: 0xbc21, 0x1b91: 0x10e1, - 0x1b92: 0x10f9, 0x1b93: 0xbc39, 0x1b94: 0x2079, 0x1b95: 0xbc71, 0x1b96: 0xbb19, 0x1b97: 0x1429, - 0x1b98: 0xbb61, 0x1b99: 0x10e1, 0x1b9a: 0x1111, 0x1b9b: 0x2109, 0x1b9c: 0xbb01, 0x1b9d: 0x1099, - 0x1b9e: 0x10b1, 0x1b9f: 0x10c9, 0x1ba0: 0xbb19, 0x1ba1: 0xbb31, 0x1ba2: 0xbb49, 0x1ba3: 0x1429, - 0x1ba4: 0x1a31, 0x1ba5: 0xbb61, 0x1ba6: 0xbb79, 0x1ba7: 0xbb91, 0x1ba8: 0xbba9, 0x1ba9: 0xbbc1, - 0x1baa: 0xbbd9, 0x1bab: 0x2109, 0x1bac: 0x1111, 0x1bad: 0x1429, 0x1bae: 0xbbf1, 0x1baf: 0xbc09, - 0x1bb0: 0xbc21, 0x1bb1: 0x10e1, 0x1bb2: 0x10f9, 0x1bb3: 0xbc39, 0x1bb4: 0x2079, 0x1bb5: 0xbc51, - 0x1bb6: 0xbb01, 0x1bb7: 0x1099, 0x1bb8: 0x10b1, 0x1bb9: 0x10c9, 0x1bba: 0xbb19, 0x1bbb: 0xbb31, - 0x1bbc: 0xbb49, 0x1bbd: 0x1429, 0x1bbe: 0x1a31, 0x1bbf: 0xbb61, + 0x1b80: 0x03c1, 0x1b81: 0x22d9, 0x1b82: 0x22d9, 0x1b83: 0x22e1, 0x1b84: 0x22e9, 0x1b85: 0x03b1, + 0x1b86: 0x03b9, 0x1b87: 0x22f1, 0x1b88: 0x0769, 0x1b89: 0x2301, 0x1b8a: 0x2291, 0x1b8b: 0x04d1, + 0x1b8c: 0x22a9, 0x1b8d: 0x03b1, 0x1b8e: 0x03c1, 0x1b8f: 0x0799, 0x1b90: 0x2289, 0x1b91: 0x0399, + 0x1b92: 0x03a1, 0x1b93: 0x03a9, 0x1b94: 0x2291, 0x1b95: 0x2299, 0x1b96: 0x22a1, 0x1b97: 0x04d1, + 0x1b98: 0x05f9, 0x1b99: 0x22a9, 0x1b9a: 0x22b1, 0x1b9b: 0x22b9, 0x1b9c: 0x22c1, 0x1b9d: 0x22c9, + 0x1b9e: 0x22d1, 0x1b9f: 0x0799, 0x1ba0: 0x03c1, 0x1ba1: 0x04d1, 0x1ba2: 0x22d9, 0x1ba3: 0x22e1, + 0x1ba4: 0x22e9, 0x1ba5: 0x03b1, 0x1ba6: 0x03b9, 0x1ba7: 0x22f1, 0x1ba8: 0x0769, 0x1ba9: 0x22f9, + 0x1baa: 0x2289, 0x1bab: 0x0399, 0x1bac: 0x03a1, 0x1bad: 0x03a9, 0x1bae: 0x2291, 0x1baf: 0x2299, + 0x1bb0: 0x22a1, 0x1bb1: 0x04d1, 0x1bb2: 0x05f9, 0x1bb3: 0x22a9, 0x1bb4: 0x22b1, 0x1bb5: 0x22b9, + 0x1bb6: 0x22c1, 0x1bb7: 0x22c9, 0x1bb8: 0x22d1, 0x1bb9: 0x0799, 0x1bba: 0x03c1, 0x1bbb: 0x22d9, + 0x1bbc: 0x22d9, 0x1bbd: 0x22e1, 0x1bbe: 0x22e9, 0x1bbf: 0x03b1, // Block 0x6f, offset 0x1bc0 - 0x1bc0: 0xbb79, 0x1bc1: 0xbb91, 0x1bc2: 0xbba9, 0x1bc3: 0xbbc1, 0x1bc4: 0xbbd9, 0x1bc5: 0x2109, - 0x1bc6: 0x1111, 0x1bc7: 0xbbf1, 0x1bc8: 0xbbf1, 0x1bc9: 0xbc09, 0x1bca: 0xbc21, 0x1bcb: 0x10e1, - 0x1bcc: 0x10f9, 0x1bcd: 0xbc39, 0x1bce: 0x2079, 0x1bcf: 0xbc71, 0x1bd0: 0xbb19, 0x1bd1: 0x1429, - 0x1bd2: 0xbb61, 0x1bd3: 0x10e1, 0x1bd4: 0x1111, 0x1bd5: 0x2109, 0x1bd6: 0xbb01, 0x1bd7: 0x1099, - 0x1bd8: 0x10b1, 0x1bd9: 0x10c9, 0x1bda: 0xbb19, 0x1bdb: 0xbb31, 0x1bdc: 0xbb49, 0x1bdd: 0x1429, - 0x1bde: 0x1a31, 0x1bdf: 0xbb61, 0x1be0: 0xbb79, 0x1be1: 0xbb91, 0x1be2: 0xbba9, 0x1be3: 0xbbc1, - 0x1be4: 0xbbd9, 0x1be5: 0x2109, 0x1be6: 0x1111, 0x1be7: 0x1429, 0x1be8: 0xbbf1, 0x1be9: 0xbc09, - 0x1bea: 0xbc21, 0x1beb: 0x10e1, 0x1bec: 0x10f9, 0x1bed: 0xbc39, 0x1bee: 0x2079, 0x1bef: 0xbc51, - 0x1bf0: 0xbb01, 0x1bf1: 0x1099, 0x1bf2: 0x10b1, 0x1bf3: 0x10c9, 0x1bf4: 0xbb19, 0x1bf5: 0xbb31, - 0x1bf6: 0xbb49, 0x1bf7: 0x1429, 0x1bf8: 0x1a31, 0x1bf9: 0xbb61, 0x1bfa: 0xbb79, 0x1bfb: 0xbb91, - 0x1bfc: 0xbba9, 0x1bfd: 0xbbc1, 0x1bfe: 0xbbd9, 0x1bff: 0x2109, + 0x1bc0: 0x03b9, 0x1bc1: 0x22f1, 0x1bc2: 0x0769, 0x1bc3: 0x2301, 0x1bc4: 0x2291, 0x1bc5: 0x04d1, + 0x1bc6: 0x22a9, 0x1bc7: 0x03b1, 0x1bc8: 0x03c1, 0x1bc9: 0x0799, 0x1bca: 0x2309, 0x1bcb: 0x2309, + 0x1bcc: 0x0040, 0x1bcd: 0x0040, 0x1bce: 0x06e1, 0x1bcf: 0x0049, 0x1bd0: 0x0029, 0x1bd1: 0x0031, + 0x1bd2: 0x06e9, 0x1bd3: 0x06f1, 0x1bd4: 0x06f9, 0x1bd5: 0x0701, 0x1bd6: 0x0709, 0x1bd7: 0x0711, + 0x1bd8: 0x06e1, 0x1bd9: 0x0049, 0x1bda: 0x0029, 0x1bdb: 0x0031, 0x1bdc: 0x06e9, 0x1bdd: 0x06f1, + 0x1bde: 0x06f9, 0x1bdf: 0x0701, 0x1be0: 0x0709, 0x1be1: 0x0711, 0x1be2: 0x06e1, 0x1be3: 0x0049, + 0x1be4: 0x0029, 0x1be5: 0x0031, 0x1be6: 0x06e9, 0x1be7: 0x06f1, 0x1be8: 0x06f9, 0x1be9: 0x0701, + 0x1bea: 0x0709, 0x1beb: 0x0711, 0x1bec: 0x06e1, 0x1bed: 0x0049, 0x1bee: 0x0029, 0x1bef: 0x0031, + 0x1bf0: 0x06e9, 0x1bf1: 0x06f1, 0x1bf2: 0x06f9, 0x1bf3: 0x0701, 0x1bf4: 0x0709, 0x1bf5: 0x0711, + 0x1bf6: 0x06e1, 0x1bf7: 0x0049, 0x1bf8: 0x0029, 0x1bf9: 0x0031, 0x1bfa: 0x06e9, 0x1bfb: 0x06f1, + 0x1bfc: 0x06f9, 0x1bfd: 0x0701, 0x1bfe: 0x0709, 0x1bff: 0x0711, // Block 0x70, offset 0x1c00 - 0x1c00: 0x1111, 0x1c01: 0xbbf1, 0x1c02: 0xbbf1, 0x1c03: 0xbc09, 0x1c04: 0xbc21, 0x1c05: 0x10e1, - 0x1c06: 0x10f9, 0x1c07: 0xbc39, 0x1c08: 0x2079, 0x1c09: 0xbc71, 0x1c0a: 0xbb19, 0x1c0b: 0x1429, - 0x1c0c: 0xbb61, 0x1c0d: 0x10e1, 0x1c0e: 0x1111, 0x1c0f: 0x2109, 0x1c10: 0xbb01, 0x1c11: 0x1099, - 0x1c12: 0x10b1, 0x1c13: 0x10c9, 0x1c14: 0xbb19, 0x1c15: 0xbb31, 0x1c16: 0xbb49, 0x1c17: 0x1429, - 0x1c18: 0x1a31, 0x1c19: 0xbb61, 0x1c1a: 0xbb79, 0x1c1b: 0xbb91, 0x1c1c: 0xbba9, 0x1c1d: 0xbbc1, - 0x1c1e: 0xbbd9, 0x1c1f: 0x2109, 0x1c20: 0x1111, 0x1c21: 0x1429, 0x1c22: 0xbbf1, 0x1c23: 0xbc09, - 0x1c24: 0xbc21, 0x1c25: 0x10e1, 0x1c26: 0x10f9, 0x1c27: 0xbc39, 0x1c28: 0x2079, 0x1c29: 0xbc51, - 0x1c2a: 0xbb01, 0x1c2b: 0x1099, 0x1c2c: 0x10b1, 0x1c2d: 0x10c9, 0x1c2e: 0xbb19, 0x1c2f: 0xbb31, - 0x1c30: 0xbb49, 0x1c31: 0x1429, 0x1c32: 0x1a31, 0x1c33: 0xbb61, 0x1c34: 0xbb79, 0x1c35: 0xbb91, - 0x1c36: 0xbba9, 0x1c37: 0xbbc1, 0x1c38: 0xbbd9, 0x1c39: 0x2109, 0x1c3a: 0x1111, 0x1c3b: 0xbbf1, - 0x1c3c: 0xbbf1, 0x1c3d: 0xbc09, 0x1c3e: 0xbc21, 0x1c3f: 0x10e1, + 0x1c00: 0xe115, 0x1c01: 0xe115, 0x1c02: 0xe135, 0x1c03: 0xe135, 0x1c04: 0xe115, 0x1c05: 0xe115, + 0x1c06: 0xe175, 0x1c07: 0xe175, 0x1c08: 0xe115, 0x1c09: 0xe115, 0x1c0a: 0xe135, 0x1c0b: 0xe135, + 0x1c0c: 0xe115, 0x1c0d: 0xe115, 0x1c0e: 0xe1f5, 0x1c0f: 0xe1f5, 0x1c10: 0xe115, 0x1c11: 0xe115, + 0x1c12: 0xe135, 0x1c13: 0xe135, 0x1c14: 0xe115, 0x1c15: 0xe115, 0x1c16: 0xe175, 0x1c17: 0xe175, + 0x1c18: 0xe115, 0x1c19: 0xe115, 0x1c1a: 0xe135, 0x1c1b: 0xe135, 0x1c1c: 0xe115, 0x1c1d: 0xe115, + 0x1c1e: 0x8b3d, 0x1c1f: 0x8b3d, 0x1c20: 0x04b5, 0x1c21: 0x04b5, 0x1c22: 0x0a08, 0x1c23: 0x0a08, + 0x1c24: 0x0a08, 0x1c25: 0x0a08, 0x1c26: 0x0a08, 0x1c27: 0x0a08, 0x1c28: 0x0a08, 0x1c29: 0x0a08, + 0x1c2a: 0x0a08, 0x1c2b: 0x0a08, 0x1c2c: 0x0a08, 0x1c2d: 0x0a08, 0x1c2e: 0x0a08, 0x1c2f: 0x0a08, + 0x1c30: 0x0a08, 0x1c31: 0x0a08, 0x1c32: 0x0a08, 0x1c33: 0x0a08, 0x1c34: 0x0a08, 0x1c35: 0x0a08, + 0x1c36: 0x0a08, 0x1c37: 0x0a08, 0x1c38: 0x0a08, 0x1c39: 0x0a08, 0x1c3a: 0x0a08, 0x1c3b: 0x0a08, + 0x1c3c: 0x0a08, 0x1c3d: 0x0a08, 0x1c3e: 0x0a08, 0x1c3f: 0x0a08, // Block 0x71, offset 0x1c40 - 0x1c40: 0x10f9, 0x1c41: 0xbc39, 0x1c42: 0x2079, 0x1c43: 0xbc71, 0x1c44: 0xbb19, 0x1c45: 0x1429, - 0x1c46: 0xbb61, 0x1c47: 0x10e1, 0x1c48: 0x1111, 0x1c49: 0x2109, 0x1c4a: 0xbc91, 0x1c4b: 0xbc91, - 0x1c4c: 0x0040, 0x1c4d: 0x0040, 0x1c4e: 0x1f41, 0x1c4f: 0x00c9, 0x1c50: 0x0069, 0x1c51: 0x0079, - 0x1c52: 0x1f51, 0x1c53: 0x1f61, 0x1c54: 0x1f71, 0x1c55: 0x1f81, 0x1c56: 0x1f91, 0x1c57: 0x1fa1, - 0x1c58: 0x1f41, 0x1c59: 0x00c9, 0x1c5a: 0x0069, 0x1c5b: 0x0079, 0x1c5c: 0x1f51, 0x1c5d: 0x1f61, - 0x1c5e: 0x1f71, 0x1c5f: 0x1f81, 0x1c60: 0x1f91, 0x1c61: 0x1fa1, 0x1c62: 0x1f41, 0x1c63: 0x00c9, - 0x1c64: 0x0069, 0x1c65: 0x0079, 0x1c66: 0x1f51, 0x1c67: 0x1f61, 0x1c68: 0x1f71, 0x1c69: 0x1f81, - 0x1c6a: 0x1f91, 0x1c6b: 0x1fa1, 0x1c6c: 0x1f41, 0x1c6d: 0x00c9, 0x1c6e: 0x0069, 0x1c6f: 0x0079, - 0x1c70: 0x1f51, 0x1c71: 0x1f61, 0x1c72: 0x1f71, 0x1c73: 0x1f81, 0x1c74: 0x1f91, 0x1c75: 0x1fa1, - 0x1c76: 0x1f41, 0x1c77: 0x00c9, 0x1c78: 0x0069, 0x1c79: 0x0079, 0x1c7a: 0x1f51, 0x1c7b: 0x1f61, - 0x1c7c: 0x1f71, 0x1c7d: 0x1f81, 0x1c7e: 0x1f91, 0x1c7f: 0x1fa1, + 0x1c40: 0x20b1, 0x1c41: 0x20b9, 0x1c42: 0x20d9, 0x1c43: 0x20f1, 0x1c44: 0x0040, 0x1c45: 0x2189, + 0x1c46: 0x2109, 0x1c47: 0x20e1, 0x1c48: 0x2131, 0x1c49: 0x2191, 0x1c4a: 0x2161, 0x1c4b: 0x2169, + 0x1c4c: 0x2171, 0x1c4d: 0x2179, 0x1c4e: 0x2111, 0x1c4f: 0x2141, 0x1c50: 0x2151, 0x1c51: 0x2121, + 0x1c52: 0x2159, 0x1c53: 0x2101, 0x1c54: 0x2119, 0x1c55: 0x20c9, 0x1c56: 0x20d1, 0x1c57: 0x20e9, + 0x1c58: 0x20f9, 0x1c59: 0x2129, 0x1c5a: 0x2139, 0x1c5b: 0x2149, 0x1c5c: 0x2311, 0x1c5d: 0x1689, + 0x1c5e: 0x2319, 0x1c5f: 0x2321, 0x1c60: 0x0040, 0x1c61: 0x20b9, 0x1c62: 0x20d9, 0x1c63: 0x0040, + 0x1c64: 0x2181, 0x1c65: 0x0040, 0x1c66: 0x0040, 0x1c67: 0x20e1, 0x1c68: 0x0040, 0x1c69: 0x2191, + 0x1c6a: 0x2161, 0x1c6b: 0x2169, 0x1c6c: 0x2171, 0x1c6d: 0x2179, 0x1c6e: 0x2111, 0x1c6f: 0x2141, + 0x1c70: 0x2151, 0x1c71: 0x2121, 0x1c72: 0x2159, 0x1c73: 0x0040, 0x1c74: 0x2119, 0x1c75: 0x20c9, + 0x1c76: 0x20d1, 0x1c77: 0x20e9, 0x1c78: 0x0040, 0x1c79: 0x2129, 0x1c7a: 0x0040, 0x1c7b: 0x2149, + 0x1c7c: 0x0040, 0x1c7d: 0x0040, 0x1c7e: 0x0040, 0x1c7f: 0x0040, // Block 0x72, offset 0x1c80 - 0x1c80: 0xe115, 0x1c81: 0xe115, 0x1c82: 0xe135, 0x1c83: 0xe135, 0x1c84: 0xe115, 0x1c85: 0xe115, - 0x1c86: 0xe175, 0x1c87: 0xe175, 0x1c88: 0xe115, 0x1c89: 0xe115, 0x1c8a: 0xe135, 0x1c8b: 0xe135, - 0x1c8c: 0xe115, 0x1c8d: 0xe115, 0x1c8e: 0xe1f5, 0x1c8f: 0xe1f5, 0x1c90: 0xe115, 0x1c91: 0xe115, - 0x1c92: 0xe135, 0x1c93: 0xe135, 0x1c94: 0xe115, 0x1c95: 0xe115, 0x1c96: 0xe175, 0x1c97: 0xe175, - 0x1c98: 0xe115, 0x1c99: 0xe115, 0x1c9a: 0xe135, 0x1c9b: 0xe135, 0x1c9c: 0xe115, 0x1c9d: 0xe115, - 0x1c9e: 0x8b3d, 0x1c9f: 0x8b3d, 0x1ca0: 0x04b5, 0x1ca1: 0x04b5, 0x1ca2: 0x0a08, 0x1ca3: 0x0a08, - 0x1ca4: 0x0a08, 0x1ca5: 0x0a08, 0x1ca6: 0x0a08, 0x1ca7: 0x0a08, 0x1ca8: 0x0a08, 0x1ca9: 0x0a08, - 0x1caa: 0x0a08, 0x1cab: 0x0a08, 0x1cac: 0x0a08, 0x1cad: 0x0a08, 0x1cae: 0x0a08, 0x1caf: 0x0a08, - 0x1cb0: 0x0a08, 0x1cb1: 0x0a08, 0x1cb2: 0x0a08, 0x1cb3: 0x0a08, 0x1cb4: 0x0a08, 0x1cb5: 0x0a08, - 0x1cb6: 0x0a08, 0x1cb7: 0x0a08, 0x1cb8: 0x0a08, 0x1cb9: 0x0a08, 0x1cba: 0x0a08, 0x1cbb: 0x0a08, - 0x1cbc: 0x0a08, 0x1cbd: 0x0a08, 0x1cbe: 0x0a08, 0x1cbf: 0x0a08, + 0x1c80: 0x0040, 0x1c81: 0x0040, 0x1c82: 0x20d9, 0x1c83: 0x0040, 0x1c84: 0x0040, 0x1c85: 0x0040, + 0x1c86: 0x0040, 0x1c87: 0x20e1, 0x1c88: 0x0040, 0x1c89: 0x2191, 0x1c8a: 0x0040, 0x1c8b: 0x2169, + 0x1c8c: 0x0040, 0x1c8d: 0x2179, 0x1c8e: 0x2111, 0x1c8f: 0x2141, 0x1c90: 0x0040, 0x1c91: 0x2121, + 0x1c92: 0x2159, 0x1c93: 0x0040, 0x1c94: 0x2119, 0x1c95: 0x0040, 0x1c96: 0x0040, 0x1c97: 0x20e9, + 0x1c98: 0x0040, 0x1c99: 0x2129, 0x1c9a: 0x0040, 0x1c9b: 0x2149, 0x1c9c: 0x0040, 0x1c9d: 0x1689, + 0x1c9e: 0x0040, 0x1c9f: 0x2321, 0x1ca0: 0x0040, 0x1ca1: 0x20b9, 0x1ca2: 0x20d9, 0x1ca3: 0x0040, + 0x1ca4: 0x2181, 0x1ca5: 0x0040, 0x1ca6: 0x0040, 0x1ca7: 0x20e1, 0x1ca8: 0x2131, 0x1ca9: 0x2191, + 0x1caa: 0x2161, 0x1cab: 0x0040, 0x1cac: 0x2171, 0x1cad: 0x2179, 0x1cae: 0x2111, 0x1caf: 0x2141, + 0x1cb0: 0x2151, 0x1cb1: 0x2121, 0x1cb2: 0x2159, 0x1cb3: 0x0040, 0x1cb4: 0x2119, 0x1cb5: 0x20c9, + 0x1cb6: 0x20d1, 0x1cb7: 0x20e9, 0x1cb8: 0x0040, 0x1cb9: 0x2129, 0x1cba: 0x2139, 0x1cbb: 0x2149, + 0x1cbc: 0x2311, 0x1cbd: 0x0040, 0x1cbe: 0x2319, 0x1cbf: 0x0040, // Block 0x73, offset 0x1cc0 - 0x1cc0: 0xb1d9, 0x1cc1: 0xb1f1, 0x1cc2: 0xb251, 0x1cc3: 0xb299, 0x1cc4: 0x0040, 0x1cc5: 0xb461, - 0x1cc6: 0xb2e1, 0x1cc7: 0xb269, 0x1cc8: 0xb359, 0x1cc9: 0xb479, 0x1cca: 0xb3e9, 0x1ccb: 0xb401, - 0x1ccc: 0xb419, 0x1ccd: 0xb431, 0x1cce: 0xb2f9, 0x1ccf: 0xb389, 0x1cd0: 0xb3b9, 0x1cd1: 0xb329, - 0x1cd2: 0xb3d1, 0x1cd3: 0xb2c9, 0x1cd4: 0xb311, 0x1cd5: 0xb221, 0x1cd6: 0xb239, 0x1cd7: 0xb281, - 0x1cd8: 0xb2b1, 0x1cd9: 0xb341, 0x1cda: 0xb371, 0x1cdb: 0xb3a1, 0x1cdc: 0xbca9, 0x1cdd: 0x7999, - 0x1cde: 0xbcc1, 0x1cdf: 0xbcd9, 0x1ce0: 0x0040, 0x1ce1: 0xb1f1, 0x1ce2: 0xb251, 0x1ce3: 0x0040, - 0x1ce4: 0xb449, 0x1ce5: 0x0040, 0x1ce6: 0x0040, 0x1ce7: 0xb269, 0x1ce8: 0x0040, 0x1ce9: 0xb479, - 0x1cea: 0xb3e9, 0x1ceb: 0xb401, 0x1cec: 0xb419, 0x1ced: 0xb431, 0x1cee: 0xb2f9, 0x1cef: 0xb389, - 0x1cf0: 0xb3b9, 0x1cf1: 0xb329, 0x1cf2: 0xb3d1, 0x1cf3: 0x0040, 0x1cf4: 0xb311, 0x1cf5: 0xb221, - 0x1cf6: 0xb239, 0x1cf7: 0xb281, 0x1cf8: 0x0040, 0x1cf9: 0xb341, 0x1cfa: 0x0040, 0x1cfb: 0xb3a1, + 0x1cc0: 0x20b1, 0x1cc1: 0x20b9, 0x1cc2: 0x20d9, 0x1cc3: 0x20f1, 0x1cc4: 0x2181, 0x1cc5: 0x2189, + 0x1cc6: 0x2109, 0x1cc7: 0x20e1, 0x1cc8: 0x2131, 0x1cc9: 0x2191, 0x1cca: 0x0040, 0x1ccb: 0x2169, + 0x1ccc: 0x2171, 0x1ccd: 0x2179, 0x1cce: 0x2111, 0x1ccf: 0x2141, 0x1cd0: 0x2151, 0x1cd1: 0x2121, + 0x1cd2: 0x2159, 0x1cd3: 0x2101, 0x1cd4: 0x2119, 0x1cd5: 0x20c9, 0x1cd6: 0x20d1, 0x1cd7: 0x20e9, + 0x1cd8: 0x20f9, 0x1cd9: 0x2129, 0x1cda: 0x2139, 0x1cdb: 0x2149, 0x1cdc: 0x0040, 0x1cdd: 0x0040, + 0x1cde: 0x0040, 0x1cdf: 0x0040, 0x1ce0: 0x0040, 0x1ce1: 0x20b9, 0x1ce2: 0x20d9, 0x1ce3: 0x20f1, + 0x1ce4: 0x0040, 0x1ce5: 0x2189, 0x1ce6: 0x2109, 0x1ce7: 0x20e1, 0x1ce8: 0x2131, 0x1ce9: 0x2191, + 0x1cea: 0x0040, 0x1ceb: 0x2169, 0x1cec: 0x2171, 0x1ced: 0x2179, 0x1cee: 0x2111, 0x1cef: 0x2141, + 0x1cf0: 0x2151, 0x1cf1: 0x2121, 0x1cf2: 0x2159, 0x1cf3: 0x2101, 0x1cf4: 0x2119, 0x1cf5: 0x20c9, + 0x1cf6: 0x20d1, 0x1cf7: 0x20e9, 0x1cf8: 0x20f9, 0x1cf9: 0x2129, 0x1cfa: 0x2139, 0x1cfb: 0x2149, 0x1cfc: 0x0040, 0x1cfd: 0x0040, 0x1cfe: 0x0040, 0x1cff: 0x0040, // Block 0x74, offset 0x1d00 - 0x1d00: 0x0040, 0x1d01: 0x0040, 0x1d02: 0xb251, 0x1d03: 0x0040, 0x1d04: 0x0040, 0x1d05: 0x0040, - 0x1d06: 0x0040, 0x1d07: 0xb269, 0x1d08: 0x0040, 0x1d09: 0xb479, 0x1d0a: 0x0040, 0x1d0b: 0xb401, - 0x1d0c: 0x0040, 0x1d0d: 0xb431, 0x1d0e: 0xb2f9, 0x1d0f: 0xb389, 0x1d10: 0x0040, 0x1d11: 0xb329, - 0x1d12: 0xb3d1, 0x1d13: 0x0040, 0x1d14: 0xb311, 0x1d15: 0x0040, 0x1d16: 0x0040, 0x1d17: 0xb281, - 0x1d18: 0x0040, 0x1d19: 0xb341, 0x1d1a: 0x0040, 0x1d1b: 0xb3a1, 0x1d1c: 0x0040, 0x1d1d: 0x7999, - 0x1d1e: 0x0040, 0x1d1f: 0xbcd9, 0x1d20: 0x0040, 0x1d21: 0xb1f1, 0x1d22: 0xb251, 0x1d23: 0x0040, - 0x1d24: 0xb449, 0x1d25: 0x0040, 0x1d26: 0x0040, 0x1d27: 0xb269, 0x1d28: 0xb359, 0x1d29: 0xb479, - 0x1d2a: 0xb3e9, 0x1d2b: 0x0040, 0x1d2c: 0xb419, 0x1d2d: 0xb431, 0x1d2e: 0xb2f9, 0x1d2f: 0xb389, - 0x1d30: 0xb3b9, 0x1d31: 0xb329, 0x1d32: 0xb3d1, 0x1d33: 0x0040, 0x1d34: 0xb311, 0x1d35: 0xb221, - 0x1d36: 0xb239, 0x1d37: 0xb281, 0x1d38: 0x0040, 0x1d39: 0xb341, 0x1d3a: 0xb371, 0x1d3b: 0xb3a1, - 0x1d3c: 0xbca9, 0x1d3d: 0x0040, 0x1d3e: 0xbcc1, 0x1d3f: 0x0040, + 0x1d00: 0x0040, 0x1d01: 0x232a, 0x1d02: 0x2332, 0x1d03: 0x233a, 0x1d04: 0x2342, 0x1d05: 0x234a, + 0x1d06: 0x2352, 0x1d07: 0x235a, 0x1d08: 0x2362, 0x1d09: 0x236a, 0x1d0a: 0x2372, 0x1d0b: 0x0018, + 0x1d0c: 0x0018, 0x1d0d: 0x0018, 0x1d0e: 0x0018, 0x1d0f: 0x0018, 0x1d10: 0x237a, 0x1d11: 0x2382, + 0x1d12: 0x238a, 0x1d13: 0x2392, 0x1d14: 0x239a, 0x1d15: 0x23a2, 0x1d16: 0x23aa, 0x1d17: 0x23b2, + 0x1d18: 0x23ba, 0x1d19: 0x23c2, 0x1d1a: 0x23ca, 0x1d1b: 0x23d2, 0x1d1c: 0x23da, 0x1d1d: 0x23e2, + 0x1d1e: 0x23ea, 0x1d1f: 0x23f2, 0x1d20: 0x23fa, 0x1d21: 0x2402, 0x1d22: 0x240a, 0x1d23: 0x2412, + 0x1d24: 0x241a, 0x1d25: 0x2422, 0x1d26: 0x242a, 0x1d27: 0x2432, 0x1d28: 0x243a, 0x1d29: 0x2442, + 0x1d2a: 0x2449, 0x1d2b: 0x03d9, 0x1d2c: 0x00b9, 0x1d2d: 0x1239, 0x1d2e: 0x2451, 0x1d2f: 0x0018, + 0x1d30: 0x0019, 0x1d31: 0x02e9, 0x1d32: 0x03d9, 0x1d33: 0x02f1, 0x1d34: 0x02f9, 0x1d35: 0x03f1, + 0x1d36: 0x0309, 0x1d37: 0x00a9, 0x1d38: 0x0311, 0x1d39: 0x00b1, 0x1d3a: 0x0319, 0x1d3b: 0x0101, + 0x1d3c: 0x0321, 0x1d3d: 0x0329, 0x1d3e: 0x0051, 0x1d3f: 0x0339, // Block 0x75, offset 0x1d40 - 0x1d40: 0xb1d9, 0x1d41: 0xb1f1, 0x1d42: 0xb251, 0x1d43: 0xb299, 0x1d44: 0xb449, 0x1d45: 0xb461, - 0x1d46: 0xb2e1, 0x1d47: 0xb269, 0x1d48: 0xb359, 0x1d49: 0xb479, 0x1d4a: 0x0040, 0x1d4b: 0xb401, - 0x1d4c: 0xb419, 0x1d4d: 0xb431, 0x1d4e: 0xb2f9, 0x1d4f: 0xb389, 0x1d50: 0xb3b9, 0x1d51: 0xb329, - 0x1d52: 0xb3d1, 0x1d53: 0xb2c9, 0x1d54: 0xb311, 0x1d55: 0xb221, 0x1d56: 0xb239, 0x1d57: 0xb281, - 0x1d58: 0xb2b1, 0x1d59: 0xb341, 0x1d5a: 0xb371, 0x1d5b: 0xb3a1, 0x1d5c: 0x0040, 0x1d5d: 0x0040, - 0x1d5e: 0x0040, 0x1d5f: 0x0040, 0x1d60: 0x0040, 0x1d61: 0xb1f1, 0x1d62: 0xb251, 0x1d63: 0xb299, - 0x1d64: 0x0040, 0x1d65: 0xb461, 0x1d66: 0xb2e1, 0x1d67: 0xb269, 0x1d68: 0xb359, 0x1d69: 0xb479, - 0x1d6a: 0x0040, 0x1d6b: 0xb401, 0x1d6c: 0xb419, 0x1d6d: 0xb431, 0x1d6e: 0xb2f9, 0x1d6f: 0xb389, - 0x1d70: 0xb3b9, 0x1d71: 0xb329, 0x1d72: 0xb3d1, 0x1d73: 0xb2c9, 0x1d74: 0xb311, 0x1d75: 0xb221, - 0x1d76: 0xb239, 0x1d77: 0xb281, 0x1d78: 0xb2b1, 0x1d79: 0xb341, 0x1d7a: 0xb371, 0x1d7b: 0xb3a1, - 0x1d7c: 0x0040, 0x1d7d: 0x0040, 0x1d7e: 0x0040, 0x1d7f: 0x0040, + 0x1d40: 0x0751, 0x1d41: 0x00b9, 0x1d42: 0x0089, 0x1d43: 0x0341, 0x1d44: 0x0349, 0x1d45: 0x0391, + 0x1d46: 0x00c1, 0x1d47: 0x0109, 0x1d48: 0x00c9, 0x1d49: 0x04b1, 0x1d4a: 0x2459, 0x1d4b: 0x11f9, + 0x1d4c: 0x2461, 0x1d4d: 0x04d9, 0x1d4e: 0x2469, 0x1d4f: 0x2471, 0x1d50: 0x0018, 0x1d51: 0x0018, + 0x1d52: 0x0018, 0x1d53: 0x0018, 0x1d54: 0x0018, 0x1d55: 0x0018, 0x1d56: 0x0018, 0x1d57: 0x0018, + 0x1d58: 0x0018, 0x1d59: 0x0018, 0x1d5a: 0x0018, 0x1d5b: 0x0018, 0x1d5c: 0x0018, 0x1d5d: 0x0018, + 0x1d5e: 0x0018, 0x1d5f: 0x0018, 0x1d60: 0x0018, 0x1d61: 0x0018, 0x1d62: 0x0018, 0x1d63: 0x0018, + 0x1d64: 0x0018, 0x1d65: 0x0018, 0x1d66: 0x0018, 0x1d67: 0x0018, 0x1d68: 0x0018, 0x1d69: 0x0018, + 0x1d6a: 0x2479, 0x1d6b: 0x2481, 0x1d6c: 0x2489, 0x1d6d: 0x0018, 0x1d6e: 0x0018, 0x1d6f: 0x0018, + 0x1d70: 0x0018, 0x1d71: 0x0018, 0x1d72: 0x0018, 0x1d73: 0x0018, 0x1d74: 0x0018, 0x1d75: 0x0018, + 0x1d76: 0x0018, 0x1d77: 0x0018, 0x1d78: 0x0018, 0x1d79: 0x0018, 0x1d7a: 0x0018, 0x1d7b: 0x0018, + 0x1d7c: 0x0018, 0x1d7d: 0x0018, 0x1d7e: 0x0018, 0x1d7f: 0x0018, // Block 0x76, offset 0x1d80 - 0x1d80: 0x0040, 0x1d81: 0xbcf2, 0x1d82: 0xbd0a, 0x1d83: 0xbd22, 0x1d84: 0xbd3a, 0x1d85: 0xbd52, - 0x1d86: 0xbd6a, 0x1d87: 0xbd82, 0x1d88: 0xbd9a, 0x1d89: 0xbdb2, 0x1d8a: 0xbdca, 0x1d8b: 0x0018, - 0x1d8c: 0x0018, 0x1d8d: 0x0018, 0x1d8e: 0x0018, 0x1d8f: 0x0018, 0x1d90: 0xbde2, 0x1d91: 0xbe02, - 0x1d92: 0xbe22, 0x1d93: 0xbe42, 0x1d94: 0xbe62, 0x1d95: 0xbe82, 0x1d96: 0xbea2, 0x1d97: 0xbec2, - 0x1d98: 0xbee2, 0x1d99: 0xbf02, 0x1d9a: 0xbf22, 0x1d9b: 0xbf42, 0x1d9c: 0xbf62, 0x1d9d: 0xbf82, - 0x1d9e: 0xbfa2, 0x1d9f: 0xbfc2, 0x1da0: 0xbfe2, 0x1da1: 0xc002, 0x1da2: 0xc022, 0x1da3: 0xc042, - 0x1da4: 0xc062, 0x1da5: 0xc082, 0x1da6: 0xc0a2, 0x1da7: 0xc0c2, 0x1da8: 0xc0e2, 0x1da9: 0xc102, - 0x1daa: 0xc121, 0x1dab: 0x1159, 0x1dac: 0x0269, 0x1dad: 0x66a9, 0x1dae: 0xc161, 0x1daf: 0x0018, - 0x1db0: 0x0039, 0x1db1: 0x0ee9, 0x1db2: 0x1159, 0x1db3: 0x0ef9, 0x1db4: 0x0f09, 0x1db5: 0x1199, - 0x1db6: 0x0f31, 0x1db7: 0x0249, 0x1db8: 0x0f41, 0x1db9: 0x0259, 0x1dba: 0x0f51, 0x1dbb: 0x0359, - 0x1dbc: 0x0f61, 0x1dbd: 0x0f71, 0x1dbe: 0x00d9, 0x1dbf: 0x0f99, + 0x1d80: 0x2499, 0x1d81: 0x24a1, 0x1d82: 0x24a9, 0x1d83: 0x0040, 0x1d84: 0x0040, 0x1d85: 0x0040, + 0x1d86: 0x0040, 0x1d87: 0x0040, 0x1d88: 0x0040, 0x1d89: 0x0040, 0x1d8a: 0x0040, 0x1d8b: 0x0040, + 0x1d8c: 0x0040, 0x1d8d: 0x0040, 0x1d8e: 0x0040, 0x1d8f: 0x0040, 0x1d90: 0x24b1, 0x1d91: 0x24b9, + 0x1d92: 0x24c1, 0x1d93: 0x24c9, 0x1d94: 0x24d1, 0x1d95: 0x24d9, 0x1d96: 0x24e1, 0x1d97: 0x24e9, + 0x1d98: 0x24f1, 0x1d99: 0x24f9, 0x1d9a: 0x2501, 0x1d9b: 0x2509, 0x1d9c: 0x2511, 0x1d9d: 0x2519, + 0x1d9e: 0x2521, 0x1d9f: 0x2529, 0x1da0: 0x2531, 0x1da1: 0x2539, 0x1da2: 0x2541, 0x1da3: 0x2549, + 0x1da4: 0x2551, 0x1da5: 0x2559, 0x1da6: 0x2561, 0x1da7: 0x2569, 0x1da8: 0x2571, 0x1da9: 0x2579, + 0x1daa: 0x2581, 0x1dab: 0x2589, 0x1dac: 0x2591, 0x1dad: 0x2599, 0x1dae: 0x25a1, 0x1daf: 0x25a9, + 0x1db0: 0x25b1, 0x1db1: 0x25b9, 0x1db2: 0x25c1, 0x1db3: 0x25c9, 0x1db4: 0x25d1, 0x1db5: 0x25d9, + 0x1db6: 0x25e1, 0x1db7: 0x25e9, 0x1db8: 0x25f1, 0x1db9: 0x25f9, 0x1dba: 0x2601, 0x1dbb: 0x2609, + 0x1dbc: 0x0040, 0x1dbd: 0x0040, 0x1dbe: 0x0040, 0x1dbf: 0x0040, // Block 0x77, offset 0x1dc0 - 0x1dc0: 0x2039, 0x1dc1: 0x0269, 0x1dc2: 0x01d9, 0x1dc3: 0x0fa9, 0x1dc4: 0x0fb9, 0x1dc5: 0x1089, - 0x1dc6: 0x0279, 0x1dc7: 0x0369, 0x1dc8: 0x0289, 0x1dc9: 0x13d1, 0x1dca: 0xc179, 0x1dcb: 0x65e9, - 0x1dcc: 0xc191, 0x1dcd: 0x1441, 0x1dce: 0xc1a9, 0x1dcf: 0xc1c9, 0x1dd0: 0x0018, 0x1dd1: 0x0018, - 0x1dd2: 0x0018, 0x1dd3: 0x0018, 0x1dd4: 0x0018, 0x1dd5: 0x0018, 0x1dd6: 0x0018, 0x1dd7: 0x0018, - 0x1dd8: 0x0018, 0x1dd9: 0x0018, 0x1dda: 0x0018, 0x1ddb: 0x0018, 0x1ddc: 0x0018, 0x1ddd: 0x0018, - 0x1dde: 0x0018, 0x1ddf: 0x0018, 0x1de0: 0x0018, 0x1de1: 0x0018, 0x1de2: 0x0018, 0x1de3: 0x0018, - 0x1de4: 0x0018, 0x1de5: 0x0018, 0x1de6: 0x0018, 0x1de7: 0x0018, 0x1de8: 0x0018, 0x1de9: 0x0018, - 0x1dea: 0xc1e1, 0x1deb: 0xc1f9, 0x1dec: 0xc211, 0x1ded: 0x0018, 0x1dee: 0x0018, 0x1def: 0x0018, - 0x1df0: 0x0018, 0x1df1: 0x0018, 0x1df2: 0x0018, 0x1df3: 0x0018, 0x1df4: 0x0018, 0x1df5: 0x0018, - 0x1df6: 0x0018, 0x1df7: 0x0018, 0x1df8: 0x0018, 0x1df9: 0x0018, 0x1dfa: 0x0018, 0x1dfb: 0x0018, - 0x1dfc: 0x0018, 0x1dfd: 0x0018, 0x1dfe: 0x0018, 0x1dff: 0x0018, + 0x1dc0: 0x2669, 0x1dc1: 0x2671, 0x1dc2: 0x2679, 0x1dc3: 0x8b55, 0x1dc4: 0x2681, 0x1dc5: 0x2689, + 0x1dc6: 0x2691, 0x1dc7: 0x2699, 0x1dc8: 0x26a1, 0x1dc9: 0x26a9, 0x1dca: 0x26b1, 0x1dcb: 0x26b9, + 0x1dcc: 0x26c1, 0x1dcd: 0x8b75, 0x1dce: 0x26c9, 0x1dcf: 0x26d1, 0x1dd0: 0x26d9, 0x1dd1: 0x26e1, + 0x1dd2: 0x8b95, 0x1dd3: 0x26e9, 0x1dd4: 0x26f1, 0x1dd5: 0x2521, 0x1dd6: 0x8bb5, 0x1dd7: 0x26f9, + 0x1dd8: 0x2701, 0x1dd9: 0x2709, 0x1dda: 0x2711, 0x1ddb: 0x2719, 0x1ddc: 0x8bd5, 0x1ddd: 0x2721, + 0x1dde: 0x2729, 0x1ddf: 0x2731, 0x1de0: 0x2739, 0x1de1: 0x2741, 0x1de2: 0x25f9, 0x1de3: 0x2749, + 0x1de4: 0x2751, 0x1de5: 0x2759, 0x1de6: 0x2761, 0x1de7: 0x2769, 0x1de8: 0x2771, 0x1de9: 0x2779, + 0x1dea: 0x2781, 0x1deb: 0x2789, 0x1dec: 0x2791, 0x1ded: 0x2799, 0x1dee: 0x27a1, 0x1def: 0x27a9, + 0x1df0: 0x27b1, 0x1df1: 0x27b9, 0x1df2: 0x27b9, 0x1df3: 0x27b9, 0x1df4: 0x8bf5, 0x1df5: 0x27c1, + 0x1df6: 0x27c9, 0x1df7: 0x27d1, 0x1df8: 0x8c15, 0x1df9: 0x27d9, 0x1dfa: 0x27e1, 0x1dfb: 0x27e9, + 0x1dfc: 0x27f1, 0x1dfd: 0x27f9, 0x1dfe: 0x2801, 0x1dff: 0x2809, // Block 0x78, offset 0x1e00 - 0x1e00: 0xc241, 0x1e01: 0xc279, 0x1e02: 0xc2b1, 0x1e03: 0x0040, 0x1e04: 0x0040, 0x1e05: 0x0040, - 0x1e06: 0x0040, 0x1e07: 0x0040, 0x1e08: 0x0040, 0x1e09: 0x0040, 0x1e0a: 0x0040, 0x1e0b: 0x0040, - 0x1e0c: 0x0040, 0x1e0d: 0x0040, 0x1e0e: 0x0040, 0x1e0f: 0x0040, 0x1e10: 0xc2d1, 0x1e11: 0xc2f1, - 0x1e12: 0xc311, 0x1e13: 0xc331, 0x1e14: 0xc351, 0x1e15: 0xc371, 0x1e16: 0xc391, 0x1e17: 0xc3b1, - 0x1e18: 0xc3d1, 0x1e19: 0xc3f1, 0x1e1a: 0xc411, 0x1e1b: 0xc431, 0x1e1c: 0xc451, 0x1e1d: 0xc471, - 0x1e1e: 0xc491, 0x1e1f: 0xc4b1, 0x1e20: 0xc4d1, 0x1e21: 0xc4f1, 0x1e22: 0xc511, 0x1e23: 0xc531, - 0x1e24: 0xc551, 0x1e25: 0xc571, 0x1e26: 0xc591, 0x1e27: 0xc5b1, 0x1e28: 0xc5d1, 0x1e29: 0xc5f1, - 0x1e2a: 0xc611, 0x1e2b: 0xc631, 0x1e2c: 0xc651, 0x1e2d: 0xc671, 0x1e2e: 0xc691, 0x1e2f: 0xc6b1, - 0x1e30: 0xc6d1, 0x1e31: 0xc6f1, 0x1e32: 0xc711, 0x1e33: 0xc731, 0x1e34: 0xc751, 0x1e35: 0xc771, - 0x1e36: 0xc791, 0x1e37: 0xc7b1, 0x1e38: 0xc7d1, 0x1e39: 0xc7f1, 0x1e3a: 0xc811, 0x1e3b: 0xc831, - 0x1e3c: 0x0040, 0x1e3d: 0x0040, 0x1e3e: 0x0040, 0x1e3f: 0x0040, + 0x1e00: 0x2811, 0x1e01: 0x2819, 0x1e02: 0x2821, 0x1e03: 0x2829, 0x1e04: 0x2831, 0x1e05: 0x2839, + 0x1e06: 0x2839, 0x1e07: 0x2841, 0x1e08: 0x2849, 0x1e09: 0x2851, 0x1e0a: 0x2859, 0x1e0b: 0x2861, + 0x1e0c: 0x2869, 0x1e0d: 0x2871, 0x1e0e: 0x2879, 0x1e0f: 0x2881, 0x1e10: 0x2889, 0x1e11: 0x2891, + 0x1e12: 0x2899, 0x1e13: 0x28a1, 0x1e14: 0x28a9, 0x1e15: 0x28b1, 0x1e16: 0x28b9, 0x1e17: 0x28c1, + 0x1e18: 0x28c9, 0x1e19: 0x8c35, 0x1e1a: 0x28d1, 0x1e1b: 0x28d9, 0x1e1c: 0x28e1, 0x1e1d: 0x24d9, + 0x1e1e: 0x28e9, 0x1e1f: 0x28f1, 0x1e20: 0x8c55, 0x1e21: 0x8c75, 0x1e22: 0x28f9, 0x1e23: 0x2901, + 0x1e24: 0x2909, 0x1e25: 0x2911, 0x1e26: 0x2919, 0x1e27: 0x2921, 0x1e28: 0x2040, 0x1e29: 0x2929, + 0x1e2a: 0x2931, 0x1e2b: 0x2931, 0x1e2c: 0x8c95, 0x1e2d: 0x2939, 0x1e2e: 0x2941, 0x1e2f: 0x2949, + 0x1e30: 0x2951, 0x1e31: 0x8cb5, 0x1e32: 0x2959, 0x1e33: 0x2961, 0x1e34: 0x2040, 0x1e35: 0x2969, + 0x1e36: 0x2971, 0x1e37: 0x2979, 0x1e38: 0x2981, 0x1e39: 0x2989, 0x1e3a: 0x2991, 0x1e3b: 0x8cd5, + 0x1e3c: 0x2999, 0x1e3d: 0x8cf5, 0x1e3e: 0x29a1, 0x1e3f: 0x29a9, // Block 0x79, offset 0x1e40 - 0x1e40: 0xcb61, 0x1e41: 0xcb81, 0x1e42: 0xcba1, 0x1e43: 0x8b55, 0x1e44: 0xcbc1, 0x1e45: 0xcbe1, - 0x1e46: 0xcc01, 0x1e47: 0xcc21, 0x1e48: 0xcc41, 0x1e49: 0xcc61, 0x1e4a: 0xcc81, 0x1e4b: 0xcca1, - 0x1e4c: 0xccc1, 0x1e4d: 0x8b75, 0x1e4e: 0xcce1, 0x1e4f: 0xcd01, 0x1e50: 0xcd21, 0x1e51: 0xcd41, - 0x1e52: 0x8b95, 0x1e53: 0xcd61, 0x1e54: 0xcd81, 0x1e55: 0xc491, 0x1e56: 0x8bb5, 0x1e57: 0xcda1, - 0x1e58: 0xcdc1, 0x1e59: 0xcde1, 0x1e5a: 0xce01, 0x1e5b: 0xce21, 0x1e5c: 0x8bd5, 0x1e5d: 0xce41, - 0x1e5e: 0xce61, 0x1e5f: 0xce81, 0x1e60: 0xcea1, 0x1e61: 0xcec1, 0x1e62: 0xc7f1, 0x1e63: 0xcee1, - 0x1e64: 0xcf01, 0x1e65: 0xcf21, 0x1e66: 0xcf41, 0x1e67: 0xcf61, 0x1e68: 0xcf81, 0x1e69: 0xcfa1, - 0x1e6a: 0xcfc1, 0x1e6b: 0xcfe1, 0x1e6c: 0xd001, 0x1e6d: 0xd021, 0x1e6e: 0xd041, 0x1e6f: 0xd061, - 0x1e70: 0xd081, 0x1e71: 0xd0a1, 0x1e72: 0xd0a1, 0x1e73: 0xd0a1, 0x1e74: 0x8bf5, 0x1e75: 0xd0c1, - 0x1e76: 0xd0e1, 0x1e77: 0xd101, 0x1e78: 0x8c15, 0x1e79: 0xd121, 0x1e7a: 0xd141, 0x1e7b: 0xd161, - 0x1e7c: 0xd181, 0x1e7d: 0xd1a1, 0x1e7e: 0xd1c1, 0x1e7f: 0xd1e1, + 0x1e40: 0x29b1, 0x1e41: 0x29b9, 0x1e42: 0x29c1, 0x1e43: 0x29c9, 0x1e44: 0x29d1, 0x1e45: 0x29d9, + 0x1e46: 0x29e1, 0x1e47: 0x29e9, 0x1e48: 0x29f1, 0x1e49: 0x8d15, 0x1e4a: 0x29f9, 0x1e4b: 0x2a01, + 0x1e4c: 0x2a09, 0x1e4d: 0x2a11, 0x1e4e: 0x2a19, 0x1e4f: 0x8d35, 0x1e50: 0x2a21, 0x1e51: 0x8d55, + 0x1e52: 0x8d75, 0x1e53: 0x2a29, 0x1e54: 0x2a31, 0x1e55: 0x2a31, 0x1e56: 0x2a39, 0x1e57: 0x8d95, + 0x1e58: 0x8db5, 0x1e59: 0x2a41, 0x1e5a: 0x2a49, 0x1e5b: 0x2a51, 0x1e5c: 0x2a59, 0x1e5d: 0x2a61, + 0x1e5e: 0x2a69, 0x1e5f: 0x2a71, 0x1e60: 0x2a79, 0x1e61: 0x2a81, 0x1e62: 0x2a89, 0x1e63: 0x2a91, + 0x1e64: 0x8dd5, 0x1e65: 0x2a99, 0x1e66: 0x2aa1, 0x1e67: 0x2aa9, 0x1e68: 0x2ab1, 0x1e69: 0x2aa9, + 0x1e6a: 0x2ab9, 0x1e6b: 0x2ac1, 0x1e6c: 0x2ac9, 0x1e6d: 0x2ad1, 0x1e6e: 0x2ad9, 0x1e6f: 0x2ae1, + 0x1e70: 0x2ae9, 0x1e71: 0x2af1, 0x1e72: 0x2af9, 0x1e73: 0x2b01, 0x1e74: 0x2b09, 0x1e75: 0x2b11, + 0x1e76: 0x2b19, 0x1e77: 0x2b21, 0x1e78: 0x8df5, 0x1e79: 0x2b29, 0x1e7a: 0x2b31, 0x1e7b: 0x2b39, + 0x1e7c: 0x2b41, 0x1e7d: 0x2b49, 0x1e7e: 0x8e15, 0x1e7f: 0x2b51, // Block 0x7a, offset 0x1e80 - 0x1e80: 0xd201, 0x1e81: 0xd221, 0x1e82: 0xd241, 0x1e83: 0xd261, 0x1e84: 0xd281, 0x1e85: 0xd2a1, - 0x1e86: 0xd2a1, 0x1e87: 0xd2c1, 0x1e88: 0xd2e1, 0x1e89: 0xd301, 0x1e8a: 0xd321, 0x1e8b: 0xd341, - 0x1e8c: 0xd361, 0x1e8d: 0xd381, 0x1e8e: 0xd3a1, 0x1e8f: 0xd3c1, 0x1e90: 0xd3e1, 0x1e91: 0xd401, - 0x1e92: 0xd421, 0x1e93: 0xd441, 0x1e94: 0xd461, 0x1e95: 0xd481, 0x1e96: 0xd4a1, 0x1e97: 0xd4c1, - 0x1e98: 0xd4e1, 0x1e99: 0x8c35, 0x1e9a: 0xd501, 0x1e9b: 0xd521, 0x1e9c: 0xd541, 0x1e9d: 0xc371, - 0x1e9e: 0xd561, 0x1e9f: 0xd581, 0x1ea0: 0x8c55, 0x1ea1: 0x8c75, 0x1ea2: 0xd5a1, 0x1ea3: 0xd5c1, - 0x1ea4: 0xd5e1, 0x1ea5: 0xd601, 0x1ea6: 0xd621, 0x1ea7: 0xd641, 0x1ea8: 0x2040, 0x1ea9: 0xd661, - 0x1eaa: 0xd681, 0x1eab: 0xd681, 0x1eac: 0x8c95, 0x1ead: 0xd6a1, 0x1eae: 0xd6c1, 0x1eaf: 0xd6e1, - 0x1eb0: 0xd701, 0x1eb1: 0x8cb5, 0x1eb2: 0xd721, 0x1eb3: 0xd741, 0x1eb4: 0x2040, 0x1eb5: 0xd761, - 0x1eb6: 0xd781, 0x1eb7: 0xd7a1, 0x1eb8: 0xd7c1, 0x1eb9: 0xd7e1, 0x1eba: 0xd801, 0x1ebb: 0x8cd5, - 0x1ebc: 0xd821, 0x1ebd: 0x8cf5, 0x1ebe: 0xd841, 0x1ebf: 0xd861, + 0x1e80: 0x2b59, 0x1e81: 0x2b61, 0x1e82: 0x2b69, 0x1e83: 0x2b71, 0x1e84: 0x2b79, 0x1e85: 0x2b81, + 0x1e86: 0x2b89, 0x1e87: 0x2b91, 0x1e88: 0x2b99, 0x1e89: 0x2ba1, 0x1e8a: 0x8e35, 0x1e8b: 0x2ba9, + 0x1e8c: 0x2bb1, 0x1e8d: 0x2bb9, 0x1e8e: 0x2bc1, 0x1e8f: 0x2bc9, 0x1e90: 0x2bd1, 0x1e91: 0x2bd9, + 0x1e92: 0x2be1, 0x1e93: 0x2be9, 0x1e94: 0x2bf1, 0x1e95: 0x2bf9, 0x1e96: 0x2c01, 0x1e97: 0x2c09, + 0x1e98: 0x2c11, 0x1e99: 0x2c19, 0x1e9a: 0x2c21, 0x1e9b: 0x2c29, 0x1e9c: 0x2c31, 0x1e9d: 0x8e55, + 0x1e9e: 0x2c39, 0x1e9f: 0x2c41, 0x1ea0: 0x2c49, 0x1ea1: 0x2c51, 0x1ea2: 0x2c59, 0x1ea3: 0x8e75, + 0x1ea4: 0x2c61, 0x1ea5: 0x2c69, 0x1ea6: 0x2c71, 0x1ea7: 0x2c79, 0x1ea8: 0x2c81, 0x1ea9: 0x2c89, + 0x1eaa: 0x2c91, 0x1eab: 0x2c99, 0x1eac: 0x7f0d, 0x1ead: 0x2ca1, 0x1eae: 0x2ca9, 0x1eaf: 0x2cb1, + 0x1eb0: 0x8e95, 0x1eb1: 0x2cb9, 0x1eb2: 0x2cc1, 0x1eb3: 0x2cc9, 0x1eb4: 0x2cd1, 0x1eb5: 0x2cd9, + 0x1eb6: 0x2ce1, 0x1eb7: 0x8eb5, 0x1eb8: 0x8ed5, 0x1eb9: 0x8ef5, 0x1eba: 0x2ce9, 0x1ebb: 0x8f15, + 0x1ebc: 0x2cf1, 0x1ebd: 0x2cf9, 0x1ebe: 0x2d01, 0x1ebf: 0x2d09, // Block 0x7b, offset 0x1ec0 - 0x1ec0: 0xd881, 0x1ec1: 0xd8a1, 0x1ec2: 0xd8c1, 0x1ec3: 0xd8e1, 0x1ec4: 0xd901, 0x1ec5: 0xd921, - 0x1ec6: 0xd941, 0x1ec7: 0xd961, 0x1ec8: 0xd981, 0x1ec9: 0x8d15, 0x1eca: 0xd9a1, 0x1ecb: 0xd9c1, - 0x1ecc: 0xd9e1, 0x1ecd: 0xda01, 0x1ece: 0xda21, 0x1ecf: 0x8d35, 0x1ed0: 0xda41, 0x1ed1: 0x8d55, - 0x1ed2: 0x8d75, 0x1ed3: 0xda61, 0x1ed4: 0xda81, 0x1ed5: 0xda81, 0x1ed6: 0xdaa1, 0x1ed7: 0x8d95, - 0x1ed8: 0x8db5, 0x1ed9: 0xdac1, 0x1eda: 0xdae1, 0x1edb: 0xdb01, 0x1edc: 0xdb21, 0x1edd: 0xdb41, - 0x1ede: 0xdb61, 0x1edf: 0xdb81, 0x1ee0: 0xdba1, 0x1ee1: 0xdbc1, 0x1ee2: 0xdbe1, 0x1ee3: 0xdc01, - 0x1ee4: 0x8dd5, 0x1ee5: 0xdc21, 0x1ee6: 0xdc41, 0x1ee7: 0xdc61, 0x1ee8: 0xdc81, 0x1ee9: 0xdc61, - 0x1eea: 0xdca1, 0x1eeb: 0xdcc1, 0x1eec: 0xdce1, 0x1eed: 0xdd01, 0x1eee: 0xdd21, 0x1eef: 0xdd41, - 0x1ef0: 0xdd61, 0x1ef1: 0xdd81, 0x1ef2: 0xdda1, 0x1ef3: 0xddc1, 0x1ef4: 0xdde1, 0x1ef5: 0xde01, - 0x1ef6: 0xde21, 0x1ef7: 0xde41, 0x1ef8: 0x8df5, 0x1ef9: 0xde61, 0x1efa: 0xde81, 0x1efb: 0xdea1, - 0x1efc: 0xdec1, 0x1efd: 0xdee1, 0x1efe: 0x8e15, 0x1eff: 0xdf01, + 0x1ec0: 0x2d11, 0x1ec1: 0x2d19, 0x1ec2: 0x2d21, 0x1ec3: 0x2d29, 0x1ec4: 0x2d31, 0x1ec5: 0x2d39, + 0x1ec6: 0x8f35, 0x1ec7: 0x2d41, 0x1ec8: 0x2d49, 0x1ec9: 0x2d51, 0x1eca: 0x2d59, 0x1ecb: 0x2d61, + 0x1ecc: 0x2d69, 0x1ecd: 0x8f55, 0x1ece: 0x2d71, 0x1ecf: 0x2d79, 0x1ed0: 0x8f75, 0x1ed1: 0x8f95, + 0x1ed2: 0x2d81, 0x1ed3: 0x2d89, 0x1ed4: 0x2d91, 0x1ed5: 0x2d99, 0x1ed6: 0x2da1, 0x1ed7: 0x2da9, + 0x1ed8: 0x2db1, 0x1ed9: 0x2db9, 0x1eda: 0x2dc1, 0x1edb: 0x8fb5, 0x1edc: 0x2dc9, 0x1edd: 0x8fd5, + 0x1ede: 0x2dd1, 0x1edf: 0x2040, 0x1ee0: 0x2dd9, 0x1ee1: 0x2de1, 0x1ee2: 0x2de9, 0x1ee3: 0x8ff5, + 0x1ee4: 0x2df1, 0x1ee5: 0x2df9, 0x1ee6: 0x9015, 0x1ee7: 0x9035, 0x1ee8: 0x2e01, 0x1ee9: 0x2e09, + 0x1eea: 0x2e11, 0x1eeb: 0x2e19, 0x1eec: 0x2e21, 0x1eed: 0x2e21, 0x1eee: 0x2e29, 0x1eef: 0x2e31, + 0x1ef0: 0x2e39, 0x1ef1: 0x2e41, 0x1ef2: 0x2e49, 0x1ef3: 0x2e51, 0x1ef4: 0x2e59, 0x1ef5: 0x9055, + 0x1ef6: 0x2e61, 0x1ef7: 0x9075, 0x1ef8: 0x2e69, 0x1ef9: 0x9095, 0x1efa: 0x2e71, 0x1efb: 0x90b5, + 0x1efc: 0x90d5, 0x1efd: 0x90f5, 0x1efe: 0x2e79, 0x1eff: 0x2e81, // Block 0x7c, offset 0x1f00 - 0x1f00: 0xe601, 0x1f01: 0xe621, 0x1f02: 0xe641, 0x1f03: 0xe661, 0x1f04: 0xe681, 0x1f05: 0xe6a1, - 0x1f06: 0x8f35, 0x1f07: 0xe6c1, 0x1f08: 0xe6e1, 0x1f09: 0xe701, 0x1f0a: 0xe721, 0x1f0b: 0xe741, - 0x1f0c: 0xe761, 0x1f0d: 0x8f55, 0x1f0e: 0xe781, 0x1f0f: 0xe7a1, 0x1f10: 0x8f75, 0x1f11: 0x8f95, - 0x1f12: 0xe7c1, 0x1f13: 0xe7e1, 0x1f14: 0xe801, 0x1f15: 0xe821, 0x1f16: 0xe841, 0x1f17: 0xe861, - 0x1f18: 0xe881, 0x1f19: 0xe8a1, 0x1f1a: 0xe8c1, 0x1f1b: 0x8fb5, 0x1f1c: 0xe8e1, 0x1f1d: 0x8fd5, - 0x1f1e: 0xe901, 0x1f1f: 0x2040, 0x1f20: 0xe921, 0x1f21: 0xe941, 0x1f22: 0xe961, 0x1f23: 0x8ff5, - 0x1f24: 0xe981, 0x1f25: 0xe9a1, 0x1f26: 0x9015, 0x1f27: 0x9035, 0x1f28: 0xe9c1, 0x1f29: 0xe9e1, - 0x1f2a: 0xea01, 0x1f2b: 0xea21, 0x1f2c: 0xea41, 0x1f2d: 0xea41, 0x1f2e: 0xea61, 0x1f2f: 0xea81, - 0x1f30: 0xeaa1, 0x1f31: 0xeac1, 0x1f32: 0xeae1, 0x1f33: 0xeb01, 0x1f34: 0xeb21, 0x1f35: 0x9055, - 0x1f36: 0xeb41, 0x1f37: 0x9075, 0x1f38: 0xeb61, 0x1f39: 0x9095, 0x1f3a: 0xeb81, 0x1f3b: 0x90b5, - 0x1f3c: 0x90d5, 0x1f3d: 0x90f5, 0x1f3e: 0xeba1, 0x1f3f: 0xebc1, + 0x1f00: 0x2e89, 0x1f01: 0x9115, 0x1f02: 0x9135, 0x1f03: 0x9155, 0x1f04: 0x9175, 0x1f05: 0x2e91, + 0x1f06: 0x2e99, 0x1f07: 0x2e99, 0x1f08: 0x2ea1, 0x1f09: 0x2ea9, 0x1f0a: 0x2eb1, 0x1f0b: 0x2eb9, + 0x1f0c: 0x2ec1, 0x1f0d: 0x9195, 0x1f0e: 0x2ec9, 0x1f0f: 0x2ed1, 0x1f10: 0x2ed9, 0x1f11: 0x2ee1, + 0x1f12: 0x91b5, 0x1f13: 0x2ee9, 0x1f14: 0x91d5, 0x1f15: 0x91f5, 0x1f16: 0x2ef1, 0x1f17: 0x2ef9, + 0x1f18: 0x2f01, 0x1f19: 0x2f09, 0x1f1a: 0x2f11, 0x1f1b: 0x2f19, 0x1f1c: 0x9215, 0x1f1d: 0x9235, + 0x1f1e: 0x9255, 0x1f1f: 0x2040, 0x1f20: 0x2f21, 0x1f21: 0x9275, 0x1f22: 0x2f29, 0x1f23: 0x2f31, + 0x1f24: 0x2f39, 0x1f25: 0x9295, 0x1f26: 0x2f41, 0x1f27: 0x2f49, 0x1f28: 0x2f51, 0x1f29: 0x2f59, + 0x1f2a: 0x2f61, 0x1f2b: 0x92b5, 0x1f2c: 0x2f69, 0x1f2d: 0x2f71, 0x1f2e: 0x2f79, 0x1f2f: 0x2f81, + 0x1f30: 0x2f89, 0x1f31: 0x2f91, 0x1f32: 0x92d5, 0x1f33: 0x92f5, 0x1f34: 0x2f99, 0x1f35: 0x9315, + 0x1f36: 0x2fa1, 0x1f37: 0x9335, 0x1f38: 0x2fa9, 0x1f39: 0x2fb1, 0x1f3a: 0x2fb9, 0x1f3b: 0x9355, + 0x1f3c: 0x9375, 0x1f3d: 0x2fc1, 0x1f3e: 0x9395, 0x1f3f: 0x2fc9, // Block 0x7d, offset 0x1f40 - 0x1f40: 0xebe1, 0x1f41: 0x9115, 0x1f42: 0x9135, 0x1f43: 0x9155, 0x1f44: 0x9175, 0x1f45: 0xec01, - 0x1f46: 0xec21, 0x1f47: 0xec21, 0x1f48: 0xec41, 0x1f49: 0xec61, 0x1f4a: 0xec81, 0x1f4b: 0xeca1, - 0x1f4c: 0xecc1, 0x1f4d: 0x9195, 0x1f4e: 0xece1, 0x1f4f: 0xed01, 0x1f50: 0xed21, 0x1f51: 0xed41, - 0x1f52: 0x91b5, 0x1f53: 0xed61, 0x1f54: 0x91d5, 0x1f55: 0x91f5, 0x1f56: 0xed81, 0x1f57: 0xeda1, - 0x1f58: 0xedc1, 0x1f59: 0xede1, 0x1f5a: 0xee01, 0x1f5b: 0xee21, 0x1f5c: 0x9215, 0x1f5d: 0x9235, - 0x1f5e: 0x9255, 0x1f5f: 0x2040, 0x1f60: 0xee41, 0x1f61: 0x9275, 0x1f62: 0xee61, 0x1f63: 0xee81, - 0x1f64: 0xeea1, 0x1f65: 0x9295, 0x1f66: 0xeec1, 0x1f67: 0xeee1, 0x1f68: 0xef01, 0x1f69: 0xef21, - 0x1f6a: 0xef41, 0x1f6b: 0x92b5, 0x1f6c: 0xef61, 0x1f6d: 0xef81, 0x1f6e: 0xefa1, 0x1f6f: 0xefc1, - 0x1f70: 0xefe1, 0x1f71: 0xf001, 0x1f72: 0x92d5, 0x1f73: 0x92f5, 0x1f74: 0xf021, 0x1f75: 0x9315, - 0x1f76: 0xf041, 0x1f77: 0x9335, 0x1f78: 0xf061, 0x1f79: 0xf081, 0x1f7a: 0xf0a1, 0x1f7b: 0x9355, - 0x1f7c: 0x9375, 0x1f7d: 0xf0c1, 0x1f7e: 0x9395, 0x1f7f: 0xf0e1, + 0x1f40: 0x93b5, 0x1f41: 0x2fd1, 0x1f42: 0x2fd9, 0x1f43: 0x2fe1, 0x1f44: 0x2fe9, 0x1f45: 0x2ff1, + 0x1f46: 0x2ff9, 0x1f47: 0x93d5, 0x1f48: 0x93f5, 0x1f49: 0x9415, 0x1f4a: 0x9435, 0x1f4b: 0x2a29, + 0x1f4c: 0x3001, 0x1f4d: 0x3009, 0x1f4e: 0x3011, 0x1f4f: 0x3019, 0x1f50: 0x3021, 0x1f51: 0x3029, + 0x1f52: 0x3031, 0x1f53: 0x3039, 0x1f54: 0x3041, 0x1f55: 0x3049, 0x1f56: 0x3051, 0x1f57: 0x9455, + 0x1f58: 0x3059, 0x1f59: 0x3061, 0x1f5a: 0x3069, 0x1f5b: 0x3071, 0x1f5c: 0x3079, 0x1f5d: 0x3081, + 0x1f5e: 0x3089, 0x1f5f: 0x3091, 0x1f60: 0x3099, 0x1f61: 0x30a1, 0x1f62: 0x30a9, 0x1f63: 0x30b1, + 0x1f64: 0x9475, 0x1f65: 0x9495, 0x1f66: 0x94b5, 0x1f67: 0x30b9, 0x1f68: 0x30c1, 0x1f69: 0x30c9, + 0x1f6a: 0x30d1, 0x1f6b: 0x94d5, 0x1f6c: 0x30d9, 0x1f6d: 0x94f5, 0x1f6e: 0x30e1, 0x1f6f: 0x30e9, + 0x1f70: 0x9515, 0x1f71: 0x9535, 0x1f72: 0x30f1, 0x1f73: 0x30f9, 0x1f74: 0x3101, 0x1f75: 0x3109, + 0x1f76: 0x3111, 0x1f77: 0x3119, 0x1f78: 0x3121, 0x1f79: 0x3129, 0x1f7a: 0x3131, 0x1f7b: 0x3139, + 0x1f7c: 0x3141, 0x1f7d: 0x3149, 0x1f7e: 0x3151, 0x1f7f: 0x2040, // Block 0x7e, offset 0x1f80 - 0x1f80: 0xf721, 0x1f81: 0xf741, 0x1f82: 0xf761, 0x1f83: 0xf781, 0x1f84: 0xf7a1, 0x1f85: 0x9555, - 0x1f86: 0xf7c1, 0x1f87: 0xf7e1, 0x1f88: 0xf801, 0x1f89: 0xf821, 0x1f8a: 0xf841, 0x1f8b: 0x9575, - 0x1f8c: 0x9595, 0x1f8d: 0xf861, 0x1f8e: 0xf881, 0x1f8f: 0xf8a1, 0x1f90: 0xf8c1, 0x1f91: 0xf8e1, - 0x1f92: 0xf901, 0x1f93: 0x95b5, 0x1f94: 0xf921, 0x1f95: 0xf941, 0x1f96: 0xf961, 0x1f97: 0xf981, - 0x1f98: 0x95d5, 0x1f99: 0x95f5, 0x1f9a: 0xf9a1, 0x1f9b: 0xf9c1, 0x1f9c: 0xf9e1, 0x1f9d: 0x9615, - 0x1f9e: 0xfa01, 0x1f9f: 0xfa21, 0x1fa0: 0x684d, 0x1fa1: 0x9635, 0x1fa2: 0xfa41, 0x1fa3: 0xfa61, - 0x1fa4: 0xfa81, 0x1fa5: 0x9655, 0x1fa6: 0xfaa1, 0x1fa7: 0xfac1, 0x1fa8: 0xfae1, 0x1fa9: 0xfb01, - 0x1faa: 0xfb21, 0x1fab: 0xfb41, 0x1fac: 0xfb61, 0x1fad: 0x9675, 0x1fae: 0xfb81, 0x1faf: 0xfba1, - 0x1fb0: 0xfbc1, 0x1fb1: 0x9695, 0x1fb2: 0xfbe1, 0x1fb3: 0xfc01, 0x1fb4: 0xfc21, 0x1fb5: 0xfc41, - 0x1fb6: 0x7b6d, 0x1fb7: 0x96b5, 0x1fb8: 0xfc61, 0x1fb9: 0xfc81, 0x1fba: 0xfca1, 0x1fbb: 0x96d5, - 0x1fbc: 0xfcc1, 0x1fbd: 0x96f5, 0x1fbe: 0xfce1, 0x1fbf: 0xfce1, + 0x1f80: 0x3159, 0x1f81: 0x3161, 0x1f82: 0x3169, 0x1f83: 0x3171, 0x1f84: 0x3179, 0x1f85: 0x9555, + 0x1f86: 0x3181, 0x1f87: 0x3189, 0x1f88: 0x3191, 0x1f89: 0x3199, 0x1f8a: 0x31a1, 0x1f8b: 0x9575, + 0x1f8c: 0x9595, 0x1f8d: 0x31a9, 0x1f8e: 0x31b1, 0x1f8f: 0x31b9, 0x1f90: 0x31c1, 0x1f91: 0x31c9, + 0x1f92: 0x31d1, 0x1f93: 0x95b5, 0x1f94: 0x31d9, 0x1f95: 0x31e1, 0x1f96: 0x31e9, 0x1f97: 0x31f1, + 0x1f98: 0x95d5, 0x1f99: 0x95f5, 0x1f9a: 0x31f9, 0x1f9b: 0x3201, 0x1f9c: 0x3209, 0x1f9d: 0x9615, + 0x1f9e: 0x3211, 0x1f9f: 0x3219, 0x1fa0: 0x684d, 0x1fa1: 0x9635, 0x1fa2: 0x3221, 0x1fa3: 0x3229, + 0x1fa4: 0x3231, 0x1fa5: 0x9655, 0x1fa6: 0x3239, 0x1fa7: 0x3241, 0x1fa8: 0x3249, 0x1fa9: 0x3251, + 0x1faa: 0x3259, 0x1fab: 0x3261, 0x1fac: 0x3269, 0x1fad: 0x9675, 0x1fae: 0x3271, 0x1faf: 0x3279, + 0x1fb0: 0x3281, 0x1fb1: 0x9695, 0x1fb2: 0x3289, 0x1fb3: 0x3291, 0x1fb4: 0x3299, 0x1fb5: 0x32a1, + 0x1fb6: 0x7b6d, 0x1fb7: 0x96b5, 0x1fb8: 0x32a9, 0x1fb9: 0x32b1, 0x1fba: 0x32b9, 0x1fbb: 0x96d5, + 0x1fbc: 0x32c1, 0x1fbd: 0x96f5, 0x1fbe: 0x32c9, 0x1fbf: 0x32c9, // Block 0x7f, offset 0x1fc0 - 0x1fc0: 0xfd01, 0x1fc1: 0x9715, 0x1fc2: 0xfd21, 0x1fc3: 0xfd41, 0x1fc4: 0xfd61, 0x1fc5: 0xfd81, - 0x1fc6: 0xfda1, 0x1fc7: 0xfdc1, 0x1fc8: 0xfde1, 0x1fc9: 0x9735, 0x1fca: 0xfe01, 0x1fcb: 0xfe21, - 0x1fcc: 0xfe41, 0x1fcd: 0xfe61, 0x1fce: 0xfe81, 0x1fcf: 0xfea1, 0x1fd0: 0x9755, 0x1fd1: 0xfec1, - 0x1fd2: 0x9775, 0x1fd3: 0x9795, 0x1fd4: 0x97b5, 0x1fd5: 0xfee1, 0x1fd6: 0xff01, 0x1fd7: 0xff21, - 0x1fd8: 0xff41, 0x1fd9: 0xff61, 0x1fda: 0xff81, 0x1fdb: 0xffa1, 0x1fdc: 0xffc1, 0x1fdd: 0x97d5, + 0x1fc0: 0x32d1, 0x1fc1: 0x9715, 0x1fc2: 0x32d9, 0x1fc3: 0x32e1, 0x1fc4: 0x32e9, 0x1fc5: 0x32f1, + 0x1fc6: 0x32f9, 0x1fc7: 0x3301, 0x1fc8: 0x3309, 0x1fc9: 0x9735, 0x1fca: 0x3311, 0x1fcb: 0x3319, + 0x1fcc: 0x3321, 0x1fcd: 0x3329, 0x1fce: 0x3331, 0x1fcf: 0x3339, 0x1fd0: 0x9755, 0x1fd1: 0x3341, + 0x1fd2: 0x9775, 0x1fd3: 0x9795, 0x1fd4: 0x97b5, 0x1fd5: 0x3349, 0x1fd6: 0x3351, 0x1fd7: 0x3359, + 0x1fd8: 0x3361, 0x1fd9: 0x3369, 0x1fda: 0x3371, 0x1fdb: 0x3379, 0x1fdc: 0x3381, 0x1fdd: 0x97d5, 0x1fde: 0x0040, 0x1fdf: 0x0040, 0x1fe0: 0x0040, 0x1fe1: 0x0040, 0x1fe2: 0x0040, 0x1fe3: 0x0040, 0x1fe4: 0x0040, 0x1fe5: 0x0040, 0x1fe6: 0x0040, 0x1fe7: 0x0040, 0x1fe8: 0x0040, 0x1fe9: 0x0040, 0x1fea: 0x0040, 0x1feb: 0x0040, 0x1fec: 0x0040, 0x1fed: 0x0040, 0x1fee: 0x0040, 0x1fef: 0x0040, @@ -2134,7 +2277,7 @@ var idnaIndex = [2368]uint16{ 0x1b8: 0xd6, 0x1b9: 0xd7, 0x1ba: 0xd8, 0x1bb: 0xd9, 0x1bc: 0xda, 0x1bd: 0xdb, 0x1be: 0xdc, 0x1bf: 0x37, // Block 0x7, offset 0x1c0 0x1c0: 0x38, 0x1c1: 0xdd, 0x1c2: 0xde, 0x1c3: 0xdf, 0x1c4: 0xe0, 0x1c5: 0x39, 0x1c6: 0x3a, 0x1c7: 0xe1, - 0x1c8: 0xe2, 0x1c9: 0x3b, 0x1ca: 0x3c, 0x1cb: 0x3d, 0x1cc: 0x3e, 0x1cd: 0x3f, 0x1ce: 0x40, 0x1cf: 0x41, + 0x1c8: 0xe2, 0x1c9: 0x3b, 0x1ca: 0x3c, 0x1cb: 0x3d, 0x1cc: 0xe3, 0x1cd: 0xe4, 0x1ce: 0x3e, 0x1cf: 0x3f, 0x1d0: 0xa0, 0x1d1: 0xa0, 0x1d2: 0xa0, 0x1d3: 0xa0, 0x1d4: 0xa0, 0x1d5: 0xa0, 0x1d6: 0xa0, 0x1d7: 0xa0, 0x1d8: 0xa0, 0x1d9: 0xa0, 0x1da: 0xa0, 0x1db: 0xa0, 0x1dc: 0xa0, 0x1dd: 0xa0, 0x1de: 0xa0, 0x1df: 0xa0, 0x1e0: 0xa0, 0x1e1: 0xa0, 0x1e2: 0xa0, 0x1e3: 0xa0, 0x1e4: 0xa0, 0x1e5: 0xa0, 0x1e6: 0xa0, 0x1e7: 0xa0, @@ -2167,143 +2310,143 @@ var idnaIndex = [2368]uint16{ 0x2a0: 0xa0, 0x2a1: 0xa0, 0x2a2: 0xa0, 0x2a3: 0xa0, 0x2a4: 0xa0, 0x2a5: 0xa0, 0x2a6: 0xa0, 0x2a7: 0xa0, 0x2a8: 0xa0, 0x2a9: 0xa0, 0x2aa: 0xa0, 0x2ab: 0xa0, 0x2ac: 0xa0, 0x2ad: 0xa0, 0x2ae: 0xa0, 0x2af: 0xa0, 0x2b0: 0xa0, 0x2b1: 0xa0, 0x2b2: 0xa0, 0x2b3: 0xa0, 0x2b4: 0xa0, 0x2b5: 0xa0, 0x2b6: 0xa0, 0x2b7: 0xa0, - 0x2b8: 0xa0, 0x2b9: 0xa0, 0x2ba: 0xa0, 0x2bb: 0xa0, 0x2bc: 0xa0, 0x2bd: 0xa0, 0x2be: 0xa0, 0x2bf: 0xe3, + 0x2b8: 0xa0, 0x2b9: 0xa0, 0x2ba: 0xa0, 0x2bb: 0xa0, 0x2bc: 0xa0, 0x2bd: 0xa0, 0x2be: 0xa0, 0x2bf: 0xe5, // Block 0xb, offset 0x2c0 0x2c0: 0xa0, 0x2c1: 0xa0, 0x2c2: 0xa0, 0x2c3: 0xa0, 0x2c4: 0xa0, 0x2c5: 0xa0, 0x2c6: 0xa0, 0x2c7: 0xa0, 0x2c8: 0xa0, 0x2c9: 0xa0, 0x2ca: 0xa0, 0x2cb: 0xa0, 0x2cc: 0xa0, 0x2cd: 0xa0, 0x2ce: 0xa0, 0x2cf: 0xa0, - 0x2d0: 0xa0, 0x2d1: 0xa0, 0x2d2: 0xe4, 0x2d3: 0xe5, 0x2d4: 0xa0, 0x2d5: 0xa0, 0x2d6: 0xa0, 0x2d7: 0xa0, - 0x2d8: 0xe6, 0x2d9: 0x42, 0x2da: 0x43, 0x2db: 0xe7, 0x2dc: 0x44, 0x2dd: 0x45, 0x2de: 0x46, 0x2df: 0xe8, - 0x2e0: 0xe9, 0x2e1: 0xea, 0x2e2: 0xeb, 0x2e3: 0xec, 0x2e4: 0xed, 0x2e5: 0xee, 0x2e6: 0xef, 0x2e7: 0xf0, - 0x2e8: 0xf1, 0x2e9: 0xf2, 0x2ea: 0xf3, 0x2eb: 0xf4, 0x2ec: 0xf5, 0x2ed: 0xf6, 0x2ee: 0xf7, 0x2ef: 0xf8, + 0x2d0: 0xa0, 0x2d1: 0xa0, 0x2d2: 0xe6, 0x2d3: 0xe7, 0x2d4: 0xa0, 0x2d5: 0xa0, 0x2d6: 0xa0, 0x2d7: 0xa0, + 0x2d8: 0xe8, 0x2d9: 0x40, 0x2da: 0x41, 0x2db: 0xe9, 0x2dc: 0x42, 0x2dd: 0x43, 0x2de: 0x44, 0x2df: 0xea, + 0x2e0: 0xeb, 0x2e1: 0xec, 0x2e2: 0xed, 0x2e3: 0xee, 0x2e4: 0xef, 0x2e5: 0xf0, 0x2e6: 0xf1, 0x2e7: 0xf2, + 0x2e8: 0xf3, 0x2e9: 0xf4, 0x2ea: 0xf5, 0x2eb: 0xf6, 0x2ec: 0xf7, 0x2ed: 0xf8, 0x2ee: 0xf9, 0x2ef: 0xfa, 0x2f0: 0xa0, 0x2f1: 0xa0, 0x2f2: 0xa0, 0x2f3: 0xa0, 0x2f4: 0xa0, 0x2f5: 0xa0, 0x2f6: 0xa0, 0x2f7: 0xa0, 0x2f8: 0xa0, 0x2f9: 0xa0, 0x2fa: 0xa0, 0x2fb: 0xa0, 0x2fc: 0xa0, 0x2fd: 0xa0, 0x2fe: 0xa0, 0x2ff: 0xa0, // Block 0xc, offset 0x300 0x300: 0xa0, 0x301: 0xa0, 0x302: 0xa0, 0x303: 0xa0, 0x304: 0xa0, 0x305: 0xa0, 0x306: 0xa0, 0x307: 0xa0, 0x308: 0xa0, 0x309: 0xa0, 0x30a: 0xa0, 0x30b: 0xa0, 0x30c: 0xa0, 0x30d: 0xa0, 0x30e: 0xa0, 0x30f: 0xa0, 0x310: 0xa0, 0x311: 0xa0, 0x312: 0xa0, 0x313: 0xa0, 0x314: 0xa0, 0x315: 0xa0, 0x316: 0xa0, 0x317: 0xa0, - 0x318: 0xa0, 0x319: 0xa0, 0x31a: 0xa0, 0x31b: 0xa0, 0x31c: 0xa0, 0x31d: 0xa0, 0x31e: 0xf9, 0x31f: 0xfa, + 0x318: 0xa0, 0x319: 0xa0, 0x31a: 0xa0, 0x31b: 0xa0, 0x31c: 0xa0, 0x31d: 0xa0, 0x31e: 0xfb, 0x31f: 0xfc, // Block 0xd, offset 0x340 - 0x340: 0xfb, 0x341: 0xfb, 0x342: 0xfb, 0x343: 0xfb, 0x344: 0xfb, 0x345: 0xfb, 0x346: 0xfb, 0x347: 0xfb, - 0x348: 0xfb, 0x349: 0xfb, 0x34a: 0xfb, 0x34b: 0xfb, 0x34c: 0xfb, 0x34d: 0xfb, 0x34e: 0xfb, 0x34f: 0xfb, - 0x350: 0xfb, 0x351: 0xfb, 0x352: 0xfb, 0x353: 0xfb, 0x354: 0xfb, 0x355: 0xfb, 0x356: 0xfb, 0x357: 0xfb, - 0x358: 0xfb, 0x359: 0xfb, 0x35a: 0xfb, 0x35b: 0xfb, 0x35c: 0xfb, 0x35d: 0xfb, 0x35e: 0xfb, 0x35f: 0xfb, - 0x360: 0xfb, 0x361: 0xfb, 0x362: 0xfb, 0x363: 0xfb, 0x364: 0xfb, 0x365: 0xfb, 0x366: 0xfb, 0x367: 0xfb, - 0x368: 0xfb, 0x369: 0xfb, 0x36a: 0xfb, 0x36b: 0xfb, 0x36c: 0xfb, 0x36d: 0xfb, 0x36e: 0xfb, 0x36f: 0xfb, - 0x370: 0xfb, 0x371: 0xfb, 0x372: 0xfb, 0x373: 0xfb, 0x374: 0xfb, 0x375: 0xfb, 0x376: 0xfb, 0x377: 0xfb, - 0x378: 0xfb, 0x379: 0xfb, 0x37a: 0xfb, 0x37b: 0xfb, 0x37c: 0xfb, 0x37d: 0xfb, 0x37e: 0xfb, 0x37f: 0xfb, + 0x340: 0xfd, 0x341: 0xfd, 0x342: 0xfd, 0x343: 0xfd, 0x344: 0xfd, 0x345: 0xfd, 0x346: 0xfd, 0x347: 0xfd, + 0x348: 0xfd, 0x349: 0xfd, 0x34a: 0xfd, 0x34b: 0xfd, 0x34c: 0xfd, 0x34d: 0xfd, 0x34e: 0xfd, 0x34f: 0xfd, + 0x350: 0xfd, 0x351: 0xfd, 0x352: 0xfd, 0x353: 0xfd, 0x354: 0xfd, 0x355: 0xfd, 0x356: 0xfd, 0x357: 0xfd, + 0x358: 0xfd, 0x359: 0xfd, 0x35a: 0xfd, 0x35b: 0xfd, 0x35c: 0xfd, 0x35d: 0xfd, 0x35e: 0xfd, 0x35f: 0xfd, + 0x360: 0xfd, 0x361: 0xfd, 0x362: 0xfd, 0x363: 0xfd, 0x364: 0xfd, 0x365: 0xfd, 0x366: 0xfd, 0x367: 0xfd, + 0x368: 0xfd, 0x369: 0xfd, 0x36a: 0xfd, 0x36b: 0xfd, 0x36c: 0xfd, 0x36d: 0xfd, 0x36e: 0xfd, 0x36f: 0xfd, + 0x370: 0xfd, 0x371: 0xfd, 0x372: 0xfd, 0x373: 0xfd, 0x374: 0xfd, 0x375: 0xfd, 0x376: 0xfd, 0x377: 0xfd, + 0x378: 0xfd, 0x379: 0xfd, 0x37a: 0xfd, 0x37b: 0xfd, 0x37c: 0xfd, 0x37d: 0xfd, 0x37e: 0xfd, 0x37f: 0xfd, // Block 0xe, offset 0x380 - 0x380: 0xfb, 0x381: 0xfb, 0x382: 0xfb, 0x383: 0xfb, 0x384: 0xfb, 0x385: 0xfb, 0x386: 0xfb, 0x387: 0xfb, - 0x388: 0xfb, 0x389: 0xfb, 0x38a: 0xfb, 0x38b: 0xfb, 0x38c: 0xfb, 0x38d: 0xfb, 0x38e: 0xfb, 0x38f: 0xfb, - 0x390: 0xfb, 0x391: 0xfb, 0x392: 0xfb, 0x393: 0xfb, 0x394: 0xfb, 0x395: 0xfb, 0x396: 0xfb, 0x397: 0xfb, - 0x398: 0xfb, 0x399: 0xfb, 0x39a: 0xfb, 0x39b: 0xfb, 0x39c: 0xfb, 0x39d: 0xfb, 0x39e: 0xfb, 0x39f: 0xfb, - 0x3a0: 0xfb, 0x3a1: 0xfb, 0x3a2: 0xfb, 0x3a3: 0xfb, 0x3a4: 0xfc, 0x3a5: 0xfd, 0x3a6: 0xfe, 0x3a7: 0xff, - 0x3a8: 0x47, 0x3a9: 0x100, 0x3aa: 0x101, 0x3ab: 0x48, 0x3ac: 0x49, 0x3ad: 0x4a, 0x3ae: 0x4b, 0x3af: 0x4c, - 0x3b0: 0x102, 0x3b1: 0x4d, 0x3b2: 0x4e, 0x3b3: 0x4f, 0x3b4: 0x50, 0x3b5: 0x51, 0x3b6: 0x103, 0x3b7: 0x52, - 0x3b8: 0x53, 0x3b9: 0x54, 0x3ba: 0x55, 0x3bb: 0x56, 0x3bc: 0x57, 0x3bd: 0x58, 0x3be: 0x59, 0x3bf: 0x5a, + 0x380: 0xfd, 0x381: 0xfd, 0x382: 0xfd, 0x383: 0xfd, 0x384: 0xfd, 0x385: 0xfd, 0x386: 0xfd, 0x387: 0xfd, + 0x388: 0xfd, 0x389: 0xfd, 0x38a: 0xfd, 0x38b: 0xfd, 0x38c: 0xfd, 0x38d: 0xfd, 0x38e: 0xfd, 0x38f: 0xfd, + 0x390: 0xfd, 0x391: 0xfd, 0x392: 0xfd, 0x393: 0xfd, 0x394: 0xfd, 0x395: 0xfd, 0x396: 0xfd, 0x397: 0xfd, + 0x398: 0xfd, 0x399: 0xfd, 0x39a: 0xfd, 0x39b: 0xfd, 0x39c: 0xfd, 0x39d: 0xfd, 0x39e: 0xfd, 0x39f: 0xfd, + 0x3a0: 0xfd, 0x3a1: 0xfd, 0x3a2: 0xfd, 0x3a3: 0xfd, 0x3a4: 0xfe, 0x3a5: 0xff, 0x3a6: 0x100, 0x3a7: 0x101, + 0x3a8: 0x45, 0x3a9: 0x102, 0x3aa: 0x103, 0x3ab: 0x46, 0x3ac: 0x47, 0x3ad: 0x48, 0x3ae: 0x49, 0x3af: 0x4a, + 0x3b0: 0x104, 0x3b1: 0x4b, 0x3b2: 0x4c, 0x3b3: 0x4d, 0x3b4: 0x4e, 0x3b5: 0x4f, 0x3b6: 0x105, 0x3b7: 0x50, + 0x3b8: 0x51, 0x3b9: 0x52, 0x3ba: 0x53, 0x3bb: 0x54, 0x3bc: 0x55, 0x3bd: 0x56, 0x3be: 0x57, 0x3bf: 0x58, // Block 0xf, offset 0x3c0 - 0x3c0: 0x104, 0x3c1: 0x105, 0x3c2: 0xa0, 0x3c3: 0x106, 0x3c4: 0x107, 0x3c5: 0x9c, 0x3c6: 0x108, 0x3c7: 0x109, - 0x3c8: 0xfb, 0x3c9: 0xfb, 0x3ca: 0x10a, 0x3cb: 0x10b, 0x3cc: 0x10c, 0x3cd: 0x10d, 0x3ce: 0x10e, 0x3cf: 0x10f, - 0x3d0: 0x110, 0x3d1: 0xa0, 0x3d2: 0x111, 0x3d3: 0x112, 0x3d4: 0x113, 0x3d5: 0x114, 0x3d6: 0xfb, 0x3d7: 0xfb, - 0x3d8: 0xa0, 0x3d9: 0xa0, 0x3da: 0xa0, 0x3db: 0xa0, 0x3dc: 0x115, 0x3dd: 0x116, 0x3de: 0xfb, 0x3df: 0xfb, - 0x3e0: 0x117, 0x3e1: 0x118, 0x3e2: 0x119, 0x3e3: 0x11a, 0x3e4: 0x11b, 0x3e5: 0xfb, 0x3e6: 0x11c, 0x3e7: 0x11d, - 0x3e8: 0x11e, 0x3e9: 0x11f, 0x3ea: 0x120, 0x3eb: 0x5b, 0x3ec: 0x121, 0x3ed: 0x122, 0x3ee: 0x5c, 0x3ef: 0xfb, - 0x3f0: 0x123, 0x3f1: 0x124, 0x3f2: 0x125, 0x3f3: 0x126, 0x3f4: 0x127, 0x3f5: 0xfb, 0x3f6: 0xfb, 0x3f7: 0xfb, - 0x3f8: 0xfb, 0x3f9: 0x128, 0x3fa: 0x129, 0x3fb: 0xfb, 0x3fc: 0x12a, 0x3fd: 0x12b, 0x3fe: 0x12c, 0x3ff: 0x12d, + 0x3c0: 0x106, 0x3c1: 0x107, 0x3c2: 0xa0, 0x3c3: 0x108, 0x3c4: 0x109, 0x3c5: 0x9c, 0x3c6: 0x10a, 0x3c7: 0x10b, + 0x3c8: 0xfd, 0x3c9: 0xfd, 0x3ca: 0x10c, 0x3cb: 0x10d, 0x3cc: 0x10e, 0x3cd: 0x10f, 0x3ce: 0x110, 0x3cf: 0x111, + 0x3d0: 0x112, 0x3d1: 0xa0, 0x3d2: 0x113, 0x3d3: 0x114, 0x3d4: 0x115, 0x3d5: 0x116, 0x3d6: 0xfd, 0x3d7: 0xfd, + 0x3d8: 0xa0, 0x3d9: 0xa0, 0x3da: 0xa0, 0x3db: 0xa0, 0x3dc: 0x117, 0x3dd: 0x118, 0x3de: 0xfd, 0x3df: 0xfd, + 0x3e0: 0x119, 0x3e1: 0x11a, 0x3e2: 0x11b, 0x3e3: 0x11c, 0x3e4: 0x11d, 0x3e5: 0xfd, 0x3e6: 0x11e, 0x3e7: 0x11f, + 0x3e8: 0x120, 0x3e9: 0x121, 0x3ea: 0x122, 0x3eb: 0x59, 0x3ec: 0x123, 0x3ed: 0x124, 0x3ee: 0x5a, 0x3ef: 0xfd, + 0x3f0: 0x125, 0x3f1: 0x126, 0x3f2: 0x127, 0x3f3: 0x128, 0x3f4: 0x129, 0x3f5: 0xfd, 0x3f6: 0xfd, 0x3f7: 0xfd, + 0x3f8: 0xfd, 0x3f9: 0x12a, 0x3fa: 0x12b, 0x3fb: 0xfd, 0x3fc: 0x12c, 0x3fd: 0x12d, 0x3fe: 0x12e, 0x3ff: 0x12f, // Block 0x10, offset 0x400 - 0x400: 0x12e, 0x401: 0x12f, 0x402: 0x130, 0x403: 0x131, 0x404: 0x132, 0x405: 0x133, 0x406: 0x134, 0x407: 0x135, - 0x408: 0x136, 0x409: 0xfb, 0x40a: 0x137, 0x40b: 0x138, 0x40c: 0x5d, 0x40d: 0x5e, 0x40e: 0xfb, 0x40f: 0xfb, - 0x410: 0x139, 0x411: 0x13a, 0x412: 0x13b, 0x413: 0x13c, 0x414: 0xfb, 0x415: 0xfb, 0x416: 0x13d, 0x417: 0x13e, - 0x418: 0x13f, 0x419: 0x140, 0x41a: 0x141, 0x41b: 0x142, 0x41c: 0x143, 0x41d: 0xfb, 0x41e: 0xfb, 0x41f: 0xfb, - 0x420: 0x144, 0x421: 0xfb, 0x422: 0x145, 0x423: 0x146, 0x424: 0x5f, 0x425: 0x147, 0x426: 0x148, 0x427: 0x149, - 0x428: 0x14a, 0x429: 0x14b, 0x42a: 0x14c, 0x42b: 0x14d, 0x42c: 0xfb, 0x42d: 0xfb, 0x42e: 0xfb, 0x42f: 0xfb, - 0x430: 0x14e, 0x431: 0x14f, 0x432: 0x150, 0x433: 0xfb, 0x434: 0x151, 0x435: 0x152, 0x436: 0x153, 0x437: 0xfb, - 0x438: 0xfb, 0x439: 0xfb, 0x43a: 0xfb, 0x43b: 0x154, 0x43c: 0xfb, 0x43d: 0xfb, 0x43e: 0x155, 0x43f: 0x156, + 0x400: 0x130, 0x401: 0x131, 0x402: 0x132, 0x403: 0x133, 0x404: 0x134, 0x405: 0x135, 0x406: 0x136, 0x407: 0x137, + 0x408: 0x138, 0x409: 0xfd, 0x40a: 0x139, 0x40b: 0x13a, 0x40c: 0x5b, 0x40d: 0x5c, 0x40e: 0xfd, 0x40f: 0xfd, + 0x410: 0x13b, 0x411: 0x13c, 0x412: 0x13d, 0x413: 0x13e, 0x414: 0xfd, 0x415: 0xfd, 0x416: 0x13f, 0x417: 0x140, + 0x418: 0x141, 0x419: 0x142, 0x41a: 0x143, 0x41b: 0x144, 0x41c: 0x145, 0x41d: 0xfd, 0x41e: 0xfd, 0x41f: 0xfd, + 0x420: 0x146, 0x421: 0xfd, 0x422: 0x147, 0x423: 0x148, 0x424: 0x5d, 0x425: 0x149, 0x426: 0x14a, 0x427: 0x14b, + 0x428: 0x14c, 0x429: 0x14d, 0x42a: 0x14e, 0x42b: 0x14f, 0x42c: 0xfd, 0x42d: 0xfd, 0x42e: 0xfd, 0x42f: 0xfd, + 0x430: 0x150, 0x431: 0x151, 0x432: 0x152, 0x433: 0xfd, 0x434: 0x153, 0x435: 0x154, 0x436: 0x155, 0x437: 0xfd, + 0x438: 0xfd, 0x439: 0xfd, 0x43a: 0xfd, 0x43b: 0x156, 0x43c: 0xfd, 0x43d: 0xfd, 0x43e: 0x157, 0x43f: 0x158, // Block 0x11, offset 0x440 0x440: 0xa0, 0x441: 0xa0, 0x442: 0xa0, 0x443: 0xa0, 0x444: 0xa0, 0x445: 0xa0, 0x446: 0xa0, 0x447: 0xa0, - 0x448: 0xa0, 0x449: 0xa0, 0x44a: 0xa0, 0x44b: 0xa0, 0x44c: 0xa0, 0x44d: 0xa0, 0x44e: 0x157, 0x44f: 0xfb, - 0x450: 0x9c, 0x451: 0x158, 0x452: 0xa0, 0x453: 0xa0, 0x454: 0xa0, 0x455: 0x159, 0x456: 0xfb, 0x457: 0xfb, - 0x458: 0xfb, 0x459: 0xfb, 0x45a: 0xfb, 0x45b: 0xfb, 0x45c: 0xfb, 0x45d: 0xfb, 0x45e: 0xfb, 0x45f: 0xfb, - 0x460: 0xfb, 0x461: 0xfb, 0x462: 0xfb, 0x463: 0xfb, 0x464: 0xfb, 0x465: 0xfb, 0x466: 0xfb, 0x467: 0xfb, - 0x468: 0xfb, 0x469: 0xfb, 0x46a: 0xfb, 0x46b: 0xfb, 0x46c: 0xfb, 0x46d: 0xfb, 0x46e: 0xfb, 0x46f: 0xfb, - 0x470: 0xfb, 0x471: 0xfb, 0x472: 0xfb, 0x473: 0xfb, 0x474: 0xfb, 0x475: 0xfb, 0x476: 0xfb, 0x477: 0xfb, - 0x478: 0xfb, 0x479: 0xfb, 0x47a: 0xfb, 0x47b: 0xfb, 0x47c: 0xfb, 0x47d: 0xfb, 0x47e: 0xfb, 0x47f: 0xfb, + 0x448: 0xa0, 0x449: 0xa0, 0x44a: 0xa0, 0x44b: 0xa0, 0x44c: 0xa0, 0x44d: 0xa0, 0x44e: 0x159, 0x44f: 0xfd, + 0x450: 0x9c, 0x451: 0x15a, 0x452: 0xa0, 0x453: 0xa0, 0x454: 0xa0, 0x455: 0x15b, 0x456: 0xfd, 0x457: 0xfd, + 0x458: 0xfd, 0x459: 0xfd, 0x45a: 0xfd, 0x45b: 0xfd, 0x45c: 0xfd, 0x45d: 0xfd, 0x45e: 0xfd, 0x45f: 0xfd, + 0x460: 0xfd, 0x461: 0xfd, 0x462: 0xfd, 0x463: 0xfd, 0x464: 0xfd, 0x465: 0xfd, 0x466: 0xfd, 0x467: 0xfd, + 0x468: 0xfd, 0x469: 0xfd, 0x46a: 0xfd, 0x46b: 0xfd, 0x46c: 0xfd, 0x46d: 0xfd, 0x46e: 0xfd, 0x46f: 0xfd, + 0x470: 0xfd, 0x471: 0xfd, 0x472: 0xfd, 0x473: 0xfd, 0x474: 0xfd, 0x475: 0xfd, 0x476: 0xfd, 0x477: 0xfd, + 0x478: 0xfd, 0x479: 0xfd, 0x47a: 0xfd, 0x47b: 0xfd, 0x47c: 0xfd, 0x47d: 0xfd, 0x47e: 0xfd, 0x47f: 0xfd, // Block 0x12, offset 0x480 0x480: 0xa0, 0x481: 0xa0, 0x482: 0xa0, 0x483: 0xa0, 0x484: 0xa0, 0x485: 0xa0, 0x486: 0xa0, 0x487: 0xa0, 0x488: 0xa0, 0x489: 0xa0, 0x48a: 0xa0, 0x48b: 0xa0, 0x48c: 0xa0, 0x48d: 0xa0, 0x48e: 0xa0, 0x48f: 0xa0, - 0x490: 0x15a, 0x491: 0xfb, 0x492: 0xfb, 0x493: 0xfb, 0x494: 0xfb, 0x495: 0xfb, 0x496: 0xfb, 0x497: 0xfb, - 0x498: 0xfb, 0x499: 0xfb, 0x49a: 0xfb, 0x49b: 0xfb, 0x49c: 0xfb, 0x49d: 0xfb, 0x49e: 0xfb, 0x49f: 0xfb, - 0x4a0: 0xfb, 0x4a1: 0xfb, 0x4a2: 0xfb, 0x4a3: 0xfb, 0x4a4: 0xfb, 0x4a5: 0xfb, 0x4a6: 0xfb, 0x4a7: 0xfb, - 0x4a8: 0xfb, 0x4a9: 0xfb, 0x4aa: 0xfb, 0x4ab: 0xfb, 0x4ac: 0xfb, 0x4ad: 0xfb, 0x4ae: 0xfb, 0x4af: 0xfb, - 0x4b0: 0xfb, 0x4b1: 0xfb, 0x4b2: 0xfb, 0x4b3: 0xfb, 0x4b4: 0xfb, 0x4b5: 0xfb, 0x4b6: 0xfb, 0x4b7: 0xfb, - 0x4b8: 0xfb, 0x4b9: 0xfb, 0x4ba: 0xfb, 0x4bb: 0xfb, 0x4bc: 0xfb, 0x4bd: 0xfb, 0x4be: 0xfb, 0x4bf: 0xfb, + 0x490: 0x15c, 0x491: 0xfd, 0x492: 0xfd, 0x493: 0xfd, 0x494: 0xfd, 0x495: 0xfd, 0x496: 0xfd, 0x497: 0xfd, + 0x498: 0xfd, 0x499: 0xfd, 0x49a: 0xfd, 0x49b: 0xfd, 0x49c: 0xfd, 0x49d: 0xfd, 0x49e: 0xfd, 0x49f: 0xfd, + 0x4a0: 0xfd, 0x4a1: 0xfd, 0x4a2: 0xfd, 0x4a3: 0xfd, 0x4a4: 0xfd, 0x4a5: 0xfd, 0x4a6: 0xfd, 0x4a7: 0xfd, + 0x4a8: 0xfd, 0x4a9: 0xfd, 0x4aa: 0xfd, 0x4ab: 0xfd, 0x4ac: 0xfd, 0x4ad: 0xfd, 0x4ae: 0xfd, 0x4af: 0xfd, + 0x4b0: 0xfd, 0x4b1: 0xfd, 0x4b2: 0xfd, 0x4b3: 0xfd, 0x4b4: 0xfd, 0x4b5: 0xfd, 0x4b6: 0xfd, 0x4b7: 0xfd, + 0x4b8: 0xfd, 0x4b9: 0xfd, 0x4ba: 0xfd, 0x4bb: 0xfd, 0x4bc: 0xfd, 0x4bd: 0xfd, 0x4be: 0xfd, 0x4bf: 0xfd, // Block 0x13, offset 0x4c0 - 0x4c0: 0xfb, 0x4c1: 0xfb, 0x4c2: 0xfb, 0x4c3: 0xfb, 0x4c4: 0xfb, 0x4c5: 0xfb, 0x4c6: 0xfb, 0x4c7: 0xfb, - 0x4c8: 0xfb, 0x4c9: 0xfb, 0x4ca: 0xfb, 0x4cb: 0xfb, 0x4cc: 0xfb, 0x4cd: 0xfb, 0x4ce: 0xfb, 0x4cf: 0xfb, + 0x4c0: 0xfd, 0x4c1: 0xfd, 0x4c2: 0xfd, 0x4c3: 0xfd, 0x4c4: 0xfd, 0x4c5: 0xfd, 0x4c6: 0xfd, 0x4c7: 0xfd, + 0x4c8: 0xfd, 0x4c9: 0xfd, 0x4ca: 0xfd, 0x4cb: 0xfd, 0x4cc: 0xfd, 0x4cd: 0xfd, 0x4ce: 0xfd, 0x4cf: 0xfd, 0x4d0: 0xa0, 0x4d1: 0xa0, 0x4d2: 0xa0, 0x4d3: 0xa0, 0x4d4: 0xa0, 0x4d5: 0xa0, 0x4d6: 0xa0, 0x4d7: 0xa0, - 0x4d8: 0xa0, 0x4d9: 0x15b, 0x4da: 0xfb, 0x4db: 0xfb, 0x4dc: 0xfb, 0x4dd: 0xfb, 0x4de: 0xfb, 0x4df: 0xfb, - 0x4e0: 0xfb, 0x4e1: 0xfb, 0x4e2: 0xfb, 0x4e3: 0xfb, 0x4e4: 0xfb, 0x4e5: 0xfb, 0x4e6: 0xfb, 0x4e7: 0xfb, - 0x4e8: 0xfb, 0x4e9: 0xfb, 0x4ea: 0xfb, 0x4eb: 0xfb, 0x4ec: 0xfb, 0x4ed: 0xfb, 0x4ee: 0xfb, 0x4ef: 0xfb, - 0x4f0: 0xfb, 0x4f1: 0xfb, 0x4f2: 0xfb, 0x4f3: 0xfb, 0x4f4: 0xfb, 0x4f5: 0xfb, 0x4f6: 0xfb, 0x4f7: 0xfb, - 0x4f8: 0xfb, 0x4f9: 0xfb, 0x4fa: 0xfb, 0x4fb: 0xfb, 0x4fc: 0xfb, 0x4fd: 0xfb, 0x4fe: 0xfb, 0x4ff: 0xfb, + 0x4d8: 0xa0, 0x4d9: 0x15d, 0x4da: 0xfd, 0x4db: 0xfd, 0x4dc: 0xfd, 0x4dd: 0xfd, 0x4de: 0xfd, 0x4df: 0xfd, + 0x4e0: 0xfd, 0x4e1: 0xfd, 0x4e2: 0xfd, 0x4e3: 0xfd, 0x4e4: 0xfd, 0x4e5: 0xfd, 0x4e6: 0xfd, 0x4e7: 0xfd, + 0x4e8: 0xfd, 0x4e9: 0xfd, 0x4ea: 0xfd, 0x4eb: 0xfd, 0x4ec: 0xfd, 0x4ed: 0xfd, 0x4ee: 0xfd, 0x4ef: 0xfd, + 0x4f0: 0xfd, 0x4f1: 0xfd, 0x4f2: 0xfd, 0x4f3: 0xfd, 0x4f4: 0xfd, 0x4f5: 0xfd, 0x4f6: 0xfd, 0x4f7: 0xfd, + 0x4f8: 0xfd, 0x4f9: 0xfd, 0x4fa: 0xfd, 0x4fb: 0xfd, 0x4fc: 0xfd, 0x4fd: 0xfd, 0x4fe: 0xfd, 0x4ff: 0xfd, // Block 0x14, offset 0x500 - 0x500: 0xfb, 0x501: 0xfb, 0x502: 0xfb, 0x503: 0xfb, 0x504: 0xfb, 0x505: 0xfb, 0x506: 0xfb, 0x507: 0xfb, - 0x508: 0xfb, 0x509: 0xfb, 0x50a: 0xfb, 0x50b: 0xfb, 0x50c: 0xfb, 0x50d: 0xfb, 0x50e: 0xfb, 0x50f: 0xfb, - 0x510: 0xfb, 0x511: 0xfb, 0x512: 0xfb, 0x513: 0xfb, 0x514: 0xfb, 0x515: 0xfb, 0x516: 0xfb, 0x517: 0xfb, - 0x518: 0xfb, 0x519: 0xfb, 0x51a: 0xfb, 0x51b: 0xfb, 0x51c: 0xfb, 0x51d: 0xfb, 0x51e: 0xfb, 0x51f: 0xfb, + 0x500: 0xfd, 0x501: 0xfd, 0x502: 0xfd, 0x503: 0xfd, 0x504: 0xfd, 0x505: 0xfd, 0x506: 0xfd, 0x507: 0xfd, + 0x508: 0xfd, 0x509: 0xfd, 0x50a: 0xfd, 0x50b: 0xfd, 0x50c: 0xfd, 0x50d: 0xfd, 0x50e: 0xfd, 0x50f: 0xfd, + 0x510: 0xfd, 0x511: 0xfd, 0x512: 0xfd, 0x513: 0xfd, 0x514: 0xfd, 0x515: 0xfd, 0x516: 0xfd, 0x517: 0xfd, + 0x518: 0xfd, 0x519: 0xfd, 0x51a: 0xfd, 0x51b: 0xfd, 0x51c: 0xfd, 0x51d: 0xfd, 0x51e: 0xfd, 0x51f: 0xfd, 0x520: 0xa0, 0x521: 0xa0, 0x522: 0xa0, 0x523: 0xa0, 0x524: 0xa0, 0x525: 0xa0, 0x526: 0xa0, 0x527: 0xa0, - 0x528: 0x14d, 0x529: 0x15c, 0x52a: 0xfb, 0x52b: 0x15d, 0x52c: 0x15e, 0x52d: 0x15f, 0x52e: 0x160, 0x52f: 0xfb, - 0x530: 0xfb, 0x531: 0xfb, 0x532: 0xfb, 0x533: 0xfb, 0x534: 0xfb, 0x535: 0xfb, 0x536: 0xfb, 0x537: 0xfb, - 0x538: 0xfb, 0x539: 0x161, 0x53a: 0x162, 0x53b: 0xfb, 0x53c: 0xa0, 0x53d: 0x163, 0x53e: 0x164, 0x53f: 0x165, + 0x528: 0x14f, 0x529: 0x15e, 0x52a: 0xfd, 0x52b: 0x15f, 0x52c: 0x160, 0x52d: 0x161, 0x52e: 0x162, 0x52f: 0xfd, + 0x530: 0xfd, 0x531: 0xfd, 0x532: 0xfd, 0x533: 0xfd, 0x534: 0xfd, 0x535: 0xfd, 0x536: 0xfd, 0x537: 0xfd, + 0x538: 0xfd, 0x539: 0x163, 0x53a: 0x164, 0x53b: 0xfd, 0x53c: 0xa0, 0x53d: 0x165, 0x53e: 0x166, 0x53f: 0x167, // Block 0x15, offset 0x540 0x540: 0xa0, 0x541: 0xa0, 0x542: 0xa0, 0x543: 0xa0, 0x544: 0xa0, 0x545: 0xa0, 0x546: 0xa0, 0x547: 0xa0, 0x548: 0xa0, 0x549: 0xa0, 0x54a: 0xa0, 0x54b: 0xa0, 0x54c: 0xa0, 0x54d: 0xa0, 0x54e: 0xa0, 0x54f: 0xa0, 0x550: 0xa0, 0x551: 0xa0, 0x552: 0xa0, 0x553: 0xa0, 0x554: 0xa0, 0x555: 0xa0, 0x556: 0xa0, 0x557: 0xa0, - 0x558: 0xa0, 0x559: 0xa0, 0x55a: 0xa0, 0x55b: 0xa0, 0x55c: 0xa0, 0x55d: 0xa0, 0x55e: 0xa0, 0x55f: 0x166, + 0x558: 0xa0, 0x559: 0xa0, 0x55a: 0xa0, 0x55b: 0xa0, 0x55c: 0xa0, 0x55d: 0xa0, 0x55e: 0xa0, 0x55f: 0x168, 0x560: 0xa0, 0x561: 0xa0, 0x562: 0xa0, 0x563: 0xa0, 0x564: 0xa0, 0x565: 0xa0, 0x566: 0xa0, 0x567: 0xa0, 0x568: 0xa0, 0x569: 0xa0, 0x56a: 0xa0, 0x56b: 0xa0, 0x56c: 0xa0, 0x56d: 0xa0, 0x56e: 0xa0, 0x56f: 0xa0, - 0x570: 0xa0, 0x571: 0xa0, 0x572: 0xa0, 0x573: 0x167, 0x574: 0x168, 0x575: 0xfb, 0x576: 0xfb, 0x577: 0xfb, - 0x578: 0xfb, 0x579: 0xfb, 0x57a: 0xfb, 0x57b: 0xfb, 0x57c: 0xfb, 0x57d: 0xfb, 0x57e: 0xfb, 0x57f: 0xfb, + 0x570: 0xa0, 0x571: 0xa0, 0x572: 0xa0, 0x573: 0x169, 0x574: 0x16a, 0x575: 0xfd, 0x576: 0xfd, 0x577: 0xfd, + 0x578: 0xfd, 0x579: 0xfd, 0x57a: 0xfd, 0x57b: 0xfd, 0x57c: 0xfd, 0x57d: 0xfd, 0x57e: 0xfd, 0x57f: 0xfd, // Block 0x16, offset 0x580 - 0x580: 0xa0, 0x581: 0xa0, 0x582: 0xa0, 0x583: 0xa0, 0x584: 0x169, 0x585: 0x16a, 0x586: 0xa0, 0x587: 0xa0, - 0x588: 0xa0, 0x589: 0xa0, 0x58a: 0xa0, 0x58b: 0x16b, 0x58c: 0xfb, 0x58d: 0xfb, 0x58e: 0xfb, 0x58f: 0xfb, - 0x590: 0xfb, 0x591: 0xfb, 0x592: 0xfb, 0x593: 0xfb, 0x594: 0xfb, 0x595: 0xfb, 0x596: 0xfb, 0x597: 0xfb, - 0x598: 0xfb, 0x599: 0xfb, 0x59a: 0xfb, 0x59b: 0xfb, 0x59c: 0xfb, 0x59d: 0xfb, 0x59e: 0xfb, 0x59f: 0xfb, - 0x5a0: 0xfb, 0x5a1: 0xfb, 0x5a2: 0xfb, 0x5a3: 0xfb, 0x5a4: 0xfb, 0x5a5: 0xfb, 0x5a6: 0xfb, 0x5a7: 0xfb, - 0x5a8: 0xfb, 0x5a9: 0xfb, 0x5aa: 0xfb, 0x5ab: 0xfb, 0x5ac: 0xfb, 0x5ad: 0xfb, 0x5ae: 0xfb, 0x5af: 0xfb, - 0x5b0: 0xa0, 0x5b1: 0x16c, 0x5b2: 0x16d, 0x5b3: 0xfb, 0x5b4: 0xfb, 0x5b5: 0xfb, 0x5b6: 0xfb, 0x5b7: 0xfb, - 0x5b8: 0xfb, 0x5b9: 0xfb, 0x5ba: 0xfb, 0x5bb: 0xfb, 0x5bc: 0xfb, 0x5bd: 0xfb, 0x5be: 0xfb, 0x5bf: 0xfb, + 0x580: 0xa0, 0x581: 0xa0, 0x582: 0xa0, 0x583: 0xa0, 0x584: 0x16b, 0x585: 0x16c, 0x586: 0xa0, 0x587: 0xa0, + 0x588: 0xa0, 0x589: 0xa0, 0x58a: 0xa0, 0x58b: 0x16d, 0x58c: 0xfd, 0x58d: 0xfd, 0x58e: 0xfd, 0x58f: 0xfd, + 0x590: 0xfd, 0x591: 0xfd, 0x592: 0xfd, 0x593: 0xfd, 0x594: 0xfd, 0x595: 0xfd, 0x596: 0xfd, 0x597: 0xfd, + 0x598: 0xfd, 0x599: 0xfd, 0x59a: 0xfd, 0x59b: 0xfd, 0x59c: 0xfd, 0x59d: 0xfd, 0x59e: 0xfd, 0x59f: 0xfd, + 0x5a0: 0xfd, 0x5a1: 0xfd, 0x5a2: 0xfd, 0x5a3: 0xfd, 0x5a4: 0xfd, 0x5a5: 0xfd, 0x5a6: 0xfd, 0x5a7: 0xfd, + 0x5a8: 0xfd, 0x5a9: 0xfd, 0x5aa: 0xfd, 0x5ab: 0xfd, 0x5ac: 0xfd, 0x5ad: 0xfd, 0x5ae: 0xfd, 0x5af: 0xfd, + 0x5b0: 0xa0, 0x5b1: 0x16e, 0x5b2: 0x16f, 0x5b3: 0xfd, 0x5b4: 0xfd, 0x5b5: 0xfd, 0x5b6: 0xfd, 0x5b7: 0xfd, + 0x5b8: 0xfd, 0x5b9: 0xfd, 0x5ba: 0xfd, 0x5bb: 0xfd, 0x5bc: 0xfd, 0x5bd: 0xfd, 0x5be: 0xfd, 0x5bf: 0xfd, // Block 0x17, offset 0x5c0 - 0x5c0: 0x9c, 0x5c1: 0x9c, 0x5c2: 0x9c, 0x5c3: 0x16e, 0x5c4: 0x16f, 0x5c5: 0x170, 0x5c6: 0x171, 0x5c7: 0x172, - 0x5c8: 0x9c, 0x5c9: 0x173, 0x5ca: 0xfb, 0x5cb: 0x174, 0x5cc: 0x9c, 0x5cd: 0x175, 0x5ce: 0xfb, 0x5cf: 0xfb, - 0x5d0: 0x60, 0x5d1: 0x61, 0x5d2: 0x62, 0x5d3: 0x63, 0x5d4: 0x64, 0x5d5: 0x65, 0x5d6: 0x66, 0x5d7: 0x67, - 0x5d8: 0x68, 0x5d9: 0x69, 0x5da: 0x6a, 0x5db: 0x6b, 0x5dc: 0x6c, 0x5dd: 0x6d, 0x5de: 0x6e, 0x5df: 0x6f, + 0x5c0: 0x9c, 0x5c1: 0x9c, 0x5c2: 0x9c, 0x5c3: 0x170, 0x5c4: 0x171, 0x5c5: 0x172, 0x5c6: 0x173, 0x5c7: 0x174, + 0x5c8: 0x9c, 0x5c9: 0x175, 0x5ca: 0xfd, 0x5cb: 0x176, 0x5cc: 0x9c, 0x5cd: 0x177, 0x5ce: 0xfd, 0x5cf: 0xfd, + 0x5d0: 0x5e, 0x5d1: 0x5f, 0x5d2: 0x60, 0x5d3: 0x61, 0x5d4: 0x62, 0x5d5: 0x63, 0x5d6: 0x64, 0x5d7: 0x65, + 0x5d8: 0x66, 0x5d9: 0x67, 0x5da: 0x68, 0x5db: 0x69, 0x5dc: 0x6a, 0x5dd: 0x6b, 0x5de: 0x6c, 0x5df: 0x6d, 0x5e0: 0x9c, 0x5e1: 0x9c, 0x5e2: 0x9c, 0x5e3: 0x9c, 0x5e4: 0x9c, 0x5e5: 0x9c, 0x5e6: 0x9c, 0x5e7: 0x9c, - 0x5e8: 0x176, 0x5e9: 0x177, 0x5ea: 0x178, 0x5eb: 0xfb, 0x5ec: 0xfb, 0x5ed: 0xfb, 0x5ee: 0xfb, 0x5ef: 0xfb, - 0x5f0: 0xfb, 0x5f1: 0xfb, 0x5f2: 0xfb, 0x5f3: 0xfb, 0x5f4: 0xfb, 0x5f5: 0xfb, 0x5f6: 0xfb, 0x5f7: 0xfb, - 0x5f8: 0xfb, 0x5f9: 0xfb, 0x5fa: 0xfb, 0x5fb: 0xfb, 0x5fc: 0xfb, 0x5fd: 0xfb, 0x5fe: 0xfb, 0x5ff: 0xfb, + 0x5e8: 0x178, 0x5e9: 0x179, 0x5ea: 0x17a, 0x5eb: 0xfd, 0x5ec: 0xfd, 0x5ed: 0xfd, 0x5ee: 0xfd, 0x5ef: 0xfd, + 0x5f0: 0xfd, 0x5f1: 0xfd, 0x5f2: 0xfd, 0x5f3: 0xfd, 0x5f4: 0xfd, 0x5f5: 0xfd, 0x5f6: 0xfd, 0x5f7: 0xfd, + 0x5f8: 0xfd, 0x5f9: 0xfd, 0x5fa: 0xfd, 0x5fb: 0xfd, 0x5fc: 0xfd, 0x5fd: 0xfd, 0x5fe: 0xfd, 0x5ff: 0xfd, // Block 0x18, offset 0x600 - 0x600: 0x179, 0x601: 0xfb, 0x602: 0xfb, 0x603: 0xfb, 0x604: 0x17a, 0x605: 0x17b, 0x606: 0xfb, 0x607: 0xfb, - 0x608: 0xfb, 0x609: 0xfb, 0x60a: 0xfb, 0x60b: 0x17c, 0x60c: 0xfb, 0x60d: 0xfb, 0x60e: 0xfb, 0x60f: 0xfb, - 0x610: 0xfb, 0x611: 0xfb, 0x612: 0xfb, 0x613: 0xfb, 0x614: 0xfb, 0x615: 0xfb, 0x616: 0xfb, 0x617: 0xfb, - 0x618: 0xfb, 0x619: 0xfb, 0x61a: 0xfb, 0x61b: 0xfb, 0x61c: 0xfb, 0x61d: 0xfb, 0x61e: 0xfb, 0x61f: 0xfb, - 0x620: 0x123, 0x621: 0x123, 0x622: 0x123, 0x623: 0x17d, 0x624: 0x70, 0x625: 0x17e, 0x626: 0xfb, 0x627: 0xfb, - 0x628: 0xfb, 0x629: 0xfb, 0x62a: 0xfb, 0x62b: 0xfb, 0x62c: 0xfb, 0x62d: 0xfb, 0x62e: 0xfb, 0x62f: 0xfb, - 0x630: 0xfb, 0x631: 0x17f, 0x632: 0x180, 0x633: 0xfb, 0x634: 0x181, 0x635: 0xfb, 0x636: 0xfb, 0x637: 0xfb, - 0x638: 0x71, 0x639: 0x72, 0x63a: 0x73, 0x63b: 0x182, 0x63c: 0xfb, 0x63d: 0xfb, 0x63e: 0xfb, 0x63f: 0xfb, + 0x600: 0x17b, 0x601: 0xfd, 0x602: 0xfd, 0x603: 0xfd, 0x604: 0x17c, 0x605: 0x17d, 0x606: 0xfd, 0x607: 0xfd, + 0x608: 0xfd, 0x609: 0xfd, 0x60a: 0xfd, 0x60b: 0x17e, 0x60c: 0xfd, 0x60d: 0xfd, 0x60e: 0xfd, 0x60f: 0xfd, + 0x610: 0xfd, 0x611: 0xfd, 0x612: 0xfd, 0x613: 0xfd, 0x614: 0xfd, 0x615: 0xfd, 0x616: 0xfd, 0x617: 0xfd, + 0x618: 0xfd, 0x619: 0xfd, 0x61a: 0xfd, 0x61b: 0xfd, 0x61c: 0xfd, 0x61d: 0xfd, 0x61e: 0xfd, 0x61f: 0xfd, + 0x620: 0x125, 0x621: 0x125, 0x622: 0x125, 0x623: 0x17f, 0x624: 0x6e, 0x625: 0x180, 0x626: 0xfd, 0x627: 0xfd, + 0x628: 0xfd, 0x629: 0xfd, 0x62a: 0xfd, 0x62b: 0xfd, 0x62c: 0xfd, 0x62d: 0xfd, 0x62e: 0xfd, 0x62f: 0xfd, + 0x630: 0xfd, 0x631: 0x181, 0x632: 0x182, 0x633: 0xfd, 0x634: 0x183, 0x635: 0xfd, 0x636: 0xfd, 0x637: 0xfd, + 0x638: 0x6f, 0x639: 0x70, 0x63a: 0x71, 0x63b: 0x184, 0x63c: 0xfd, 0x63d: 0xfd, 0x63e: 0xfd, 0x63f: 0xfd, // Block 0x19, offset 0x640 - 0x640: 0x183, 0x641: 0x9c, 0x642: 0x184, 0x643: 0x185, 0x644: 0x74, 0x645: 0x75, 0x646: 0x186, 0x647: 0x187, - 0x648: 0x76, 0x649: 0x188, 0x64a: 0xfb, 0x64b: 0xfb, 0x64c: 0x9c, 0x64d: 0x9c, 0x64e: 0x9c, 0x64f: 0x9c, + 0x640: 0x185, 0x641: 0x9c, 0x642: 0x186, 0x643: 0x187, 0x644: 0x72, 0x645: 0x73, 0x646: 0x188, 0x647: 0x189, + 0x648: 0x74, 0x649: 0x18a, 0x64a: 0xfd, 0x64b: 0xfd, 0x64c: 0x9c, 0x64d: 0x9c, 0x64e: 0x9c, 0x64f: 0x9c, 0x650: 0x9c, 0x651: 0x9c, 0x652: 0x9c, 0x653: 0x9c, 0x654: 0x9c, 0x655: 0x9c, 0x656: 0x9c, 0x657: 0x9c, - 0x658: 0x9c, 0x659: 0x9c, 0x65a: 0x9c, 0x65b: 0x189, 0x65c: 0x9c, 0x65d: 0x18a, 0x65e: 0x9c, 0x65f: 0x18b, - 0x660: 0x18c, 0x661: 0x18d, 0x662: 0x18e, 0x663: 0xfb, 0x664: 0x9c, 0x665: 0x18f, 0x666: 0x9c, 0x667: 0x190, - 0x668: 0x9c, 0x669: 0x191, 0x66a: 0x192, 0x66b: 0x193, 0x66c: 0x9c, 0x66d: 0x9c, 0x66e: 0x194, 0x66f: 0x195, - 0x670: 0xfb, 0x671: 0xfb, 0x672: 0xfb, 0x673: 0xfb, 0x674: 0xfb, 0x675: 0xfb, 0x676: 0xfb, 0x677: 0xfb, - 0x678: 0xfb, 0x679: 0xfb, 0x67a: 0xfb, 0x67b: 0xfb, 0x67c: 0xfb, 0x67d: 0xfb, 0x67e: 0xfb, 0x67f: 0xfb, + 0x658: 0x9c, 0x659: 0x9c, 0x65a: 0x9c, 0x65b: 0x18b, 0x65c: 0x9c, 0x65d: 0x18c, 0x65e: 0x9c, 0x65f: 0x18d, + 0x660: 0x18e, 0x661: 0x18f, 0x662: 0x190, 0x663: 0xfd, 0x664: 0x9c, 0x665: 0x191, 0x666: 0x9c, 0x667: 0x192, + 0x668: 0x9c, 0x669: 0x193, 0x66a: 0x194, 0x66b: 0x195, 0x66c: 0x9c, 0x66d: 0x9c, 0x66e: 0x196, 0x66f: 0x197, + 0x670: 0xfd, 0x671: 0xfd, 0x672: 0xfd, 0x673: 0xfd, 0x674: 0xfd, 0x675: 0xfd, 0x676: 0xfd, 0x677: 0xfd, + 0x678: 0xfd, 0x679: 0xfd, 0x67a: 0xfd, 0x67b: 0xfd, 0x67c: 0xfd, 0x67d: 0xfd, 0x67e: 0xfd, 0x67f: 0xfd, // Block 0x1a, offset 0x680 0x680: 0xa0, 0x681: 0xa0, 0x682: 0xa0, 0x683: 0xa0, 0x684: 0xa0, 0x685: 0xa0, 0x686: 0xa0, 0x687: 0xa0, 0x688: 0xa0, 0x689: 0xa0, 0x68a: 0xa0, 0x68b: 0xa0, 0x68c: 0xa0, 0x68d: 0xa0, 0x68e: 0xa0, 0x68f: 0xa0, 0x690: 0xa0, 0x691: 0xa0, 0x692: 0xa0, 0x693: 0xa0, 0x694: 0xa0, 0x695: 0xa0, 0x696: 0xa0, 0x697: 0xa0, - 0x698: 0xa0, 0x699: 0xa0, 0x69a: 0xa0, 0x69b: 0x196, 0x69c: 0xa0, 0x69d: 0xa0, 0x69e: 0xa0, 0x69f: 0xa0, + 0x698: 0xa0, 0x699: 0xa0, 0x69a: 0xa0, 0x69b: 0x198, 0x69c: 0xa0, 0x69d: 0xa0, 0x69e: 0xa0, 0x69f: 0xa0, 0x6a0: 0xa0, 0x6a1: 0xa0, 0x6a2: 0xa0, 0x6a3: 0xa0, 0x6a4: 0xa0, 0x6a5: 0xa0, 0x6a6: 0xa0, 0x6a7: 0xa0, 0x6a8: 0xa0, 0x6a9: 0xa0, 0x6aa: 0xa0, 0x6ab: 0xa0, 0x6ac: 0xa0, 0x6ad: 0xa0, 0x6ae: 0xa0, 0x6af: 0xa0, 0x6b0: 0xa0, 0x6b1: 0xa0, 0x6b2: 0xa0, 0x6b3: 0xa0, 0x6b4: 0xa0, 0x6b5: 0xa0, 0x6b6: 0xa0, 0x6b7: 0xa0, @@ -2312,8 +2455,8 @@ var idnaIndex = [2368]uint16{ 0x6c0: 0xa0, 0x6c1: 0xa0, 0x6c2: 0xa0, 0x6c3: 0xa0, 0x6c4: 0xa0, 0x6c5: 0xa0, 0x6c6: 0xa0, 0x6c7: 0xa0, 0x6c8: 0xa0, 0x6c9: 0xa0, 0x6ca: 0xa0, 0x6cb: 0xa0, 0x6cc: 0xa0, 0x6cd: 0xa0, 0x6ce: 0xa0, 0x6cf: 0xa0, 0x6d0: 0xa0, 0x6d1: 0xa0, 0x6d2: 0xa0, 0x6d3: 0xa0, 0x6d4: 0xa0, 0x6d5: 0xa0, 0x6d6: 0xa0, 0x6d7: 0xa0, - 0x6d8: 0xa0, 0x6d9: 0xa0, 0x6da: 0xa0, 0x6db: 0xa0, 0x6dc: 0x197, 0x6dd: 0xa0, 0x6de: 0xa0, 0x6df: 0xa0, - 0x6e0: 0x198, 0x6e1: 0xa0, 0x6e2: 0xa0, 0x6e3: 0xa0, 0x6e4: 0xa0, 0x6e5: 0xa0, 0x6e6: 0xa0, 0x6e7: 0xa0, + 0x6d8: 0xa0, 0x6d9: 0xa0, 0x6da: 0xa0, 0x6db: 0xa0, 0x6dc: 0x199, 0x6dd: 0xa0, 0x6de: 0xa0, 0x6df: 0xa0, + 0x6e0: 0x19a, 0x6e1: 0xa0, 0x6e2: 0xa0, 0x6e3: 0xa0, 0x6e4: 0xa0, 0x6e5: 0xa0, 0x6e6: 0xa0, 0x6e7: 0xa0, 0x6e8: 0xa0, 0x6e9: 0xa0, 0x6ea: 0xa0, 0x6eb: 0xa0, 0x6ec: 0xa0, 0x6ed: 0xa0, 0x6ee: 0xa0, 0x6ef: 0xa0, 0x6f0: 0xa0, 0x6f1: 0xa0, 0x6f2: 0xa0, 0x6f3: 0xa0, 0x6f4: 0xa0, 0x6f5: 0xa0, 0x6f6: 0xa0, 0x6f7: 0xa0, 0x6f8: 0xa0, 0x6f9: 0xa0, 0x6fa: 0xa0, 0x6fb: 0xa0, 0x6fc: 0xa0, 0x6fd: 0xa0, 0x6fe: 0xa0, 0x6ff: 0xa0, @@ -2325,34 +2468,34 @@ var idnaIndex = [2368]uint16{ 0x720: 0xa0, 0x721: 0xa0, 0x722: 0xa0, 0x723: 0xa0, 0x724: 0xa0, 0x725: 0xa0, 0x726: 0xa0, 0x727: 0xa0, 0x728: 0xa0, 0x729: 0xa0, 0x72a: 0xa0, 0x72b: 0xa0, 0x72c: 0xa0, 0x72d: 0xa0, 0x72e: 0xa0, 0x72f: 0xa0, 0x730: 0xa0, 0x731: 0xa0, 0x732: 0xa0, 0x733: 0xa0, 0x734: 0xa0, 0x735: 0xa0, 0x736: 0xa0, 0x737: 0xa0, - 0x738: 0xa0, 0x739: 0xa0, 0x73a: 0x199, 0x73b: 0xa0, 0x73c: 0xa0, 0x73d: 0xa0, 0x73e: 0xa0, 0x73f: 0xa0, + 0x738: 0xa0, 0x739: 0xa0, 0x73a: 0x19b, 0x73b: 0xa0, 0x73c: 0xa0, 0x73d: 0xa0, 0x73e: 0xa0, 0x73f: 0xa0, // Block 0x1d, offset 0x740 0x740: 0xa0, 0x741: 0xa0, 0x742: 0xa0, 0x743: 0xa0, 0x744: 0xa0, 0x745: 0xa0, 0x746: 0xa0, 0x747: 0xa0, 0x748: 0xa0, 0x749: 0xa0, 0x74a: 0xa0, 0x74b: 0xa0, 0x74c: 0xa0, 0x74d: 0xa0, 0x74e: 0xa0, 0x74f: 0xa0, 0x750: 0xa0, 0x751: 0xa0, 0x752: 0xa0, 0x753: 0xa0, 0x754: 0xa0, 0x755: 0xa0, 0x756: 0xa0, 0x757: 0xa0, 0x758: 0xa0, 0x759: 0xa0, 0x75a: 0xa0, 0x75b: 0xa0, 0x75c: 0xa0, 0x75d: 0xa0, 0x75e: 0xa0, 0x75f: 0xa0, 0x760: 0xa0, 0x761: 0xa0, 0x762: 0xa0, 0x763: 0xa0, 0x764: 0xa0, 0x765: 0xa0, 0x766: 0xa0, 0x767: 0xa0, - 0x768: 0xa0, 0x769: 0xa0, 0x76a: 0xa0, 0x76b: 0xa0, 0x76c: 0xa0, 0x76d: 0xa0, 0x76e: 0xa0, 0x76f: 0x19a, - 0x770: 0xfb, 0x771: 0xfb, 0x772: 0xfb, 0x773: 0xfb, 0x774: 0xfb, 0x775: 0xfb, 0x776: 0xfb, 0x777: 0xfb, - 0x778: 0xfb, 0x779: 0xfb, 0x77a: 0xfb, 0x77b: 0xfb, 0x77c: 0xfb, 0x77d: 0xfb, 0x77e: 0xfb, 0x77f: 0xfb, + 0x768: 0xa0, 0x769: 0xa0, 0x76a: 0xa0, 0x76b: 0xa0, 0x76c: 0xa0, 0x76d: 0xa0, 0x76e: 0xa0, 0x76f: 0x19c, + 0x770: 0xfd, 0x771: 0xfd, 0x772: 0xfd, 0x773: 0xfd, 0x774: 0xfd, 0x775: 0xfd, 0x776: 0xfd, 0x777: 0xfd, + 0x778: 0xfd, 0x779: 0xfd, 0x77a: 0xfd, 0x77b: 0xfd, 0x77c: 0xfd, 0x77d: 0xfd, 0x77e: 0xfd, 0x77f: 0xfd, // Block 0x1e, offset 0x780 - 0x780: 0xfb, 0x781: 0xfb, 0x782: 0xfb, 0x783: 0xfb, 0x784: 0xfb, 0x785: 0xfb, 0x786: 0xfb, 0x787: 0xfb, - 0x788: 0xfb, 0x789: 0xfb, 0x78a: 0xfb, 0x78b: 0xfb, 0x78c: 0xfb, 0x78d: 0xfb, 0x78e: 0xfb, 0x78f: 0xfb, - 0x790: 0xfb, 0x791: 0xfb, 0x792: 0xfb, 0x793: 0xfb, 0x794: 0xfb, 0x795: 0xfb, 0x796: 0xfb, 0x797: 0xfb, - 0x798: 0xfb, 0x799: 0xfb, 0x79a: 0xfb, 0x79b: 0xfb, 0x79c: 0xfb, 0x79d: 0xfb, 0x79e: 0xfb, 0x79f: 0xfb, - 0x7a0: 0x77, 0x7a1: 0x78, 0x7a2: 0x79, 0x7a3: 0x19b, 0x7a4: 0x7a, 0x7a5: 0x7b, 0x7a6: 0x19c, 0x7a7: 0x7c, - 0x7a8: 0x7d, 0x7a9: 0xfb, 0x7aa: 0xfb, 0x7ab: 0xfb, 0x7ac: 0xfb, 0x7ad: 0xfb, 0x7ae: 0xfb, 0x7af: 0xfb, - 0x7b0: 0xfb, 0x7b1: 0xfb, 0x7b2: 0xfb, 0x7b3: 0xfb, 0x7b4: 0xfb, 0x7b5: 0xfb, 0x7b6: 0xfb, 0x7b7: 0xfb, - 0x7b8: 0xfb, 0x7b9: 0xfb, 0x7ba: 0xfb, 0x7bb: 0xfb, 0x7bc: 0xfb, 0x7bd: 0xfb, 0x7be: 0xfb, 0x7bf: 0xfb, + 0x780: 0xfd, 0x781: 0xfd, 0x782: 0xfd, 0x783: 0xfd, 0x784: 0xfd, 0x785: 0xfd, 0x786: 0xfd, 0x787: 0xfd, + 0x788: 0xfd, 0x789: 0xfd, 0x78a: 0xfd, 0x78b: 0xfd, 0x78c: 0xfd, 0x78d: 0xfd, 0x78e: 0xfd, 0x78f: 0xfd, + 0x790: 0xfd, 0x791: 0xfd, 0x792: 0xfd, 0x793: 0xfd, 0x794: 0xfd, 0x795: 0xfd, 0x796: 0xfd, 0x797: 0xfd, + 0x798: 0xfd, 0x799: 0xfd, 0x79a: 0xfd, 0x79b: 0xfd, 0x79c: 0xfd, 0x79d: 0xfd, 0x79e: 0xfd, 0x79f: 0xfd, + 0x7a0: 0x75, 0x7a1: 0x76, 0x7a2: 0x77, 0x7a3: 0x78, 0x7a4: 0x79, 0x7a5: 0x7a, 0x7a6: 0x7b, 0x7a7: 0x7c, + 0x7a8: 0x7d, 0x7a9: 0xfd, 0x7aa: 0xfd, 0x7ab: 0xfd, 0x7ac: 0xfd, 0x7ad: 0xfd, 0x7ae: 0xfd, 0x7af: 0xfd, + 0x7b0: 0xfd, 0x7b1: 0xfd, 0x7b2: 0xfd, 0x7b3: 0xfd, 0x7b4: 0xfd, 0x7b5: 0xfd, 0x7b6: 0xfd, 0x7b7: 0xfd, + 0x7b8: 0xfd, 0x7b9: 0xfd, 0x7ba: 0xfd, 0x7bb: 0xfd, 0x7bc: 0xfd, 0x7bd: 0xfd, 0x7be: 0xfd, 0x7bf: 0xfd, // Block 0x1f, offset 0x7c0 0x7c0: 0xa0, 0x7c1: 0xa0, 0x7c2: 0xa0, 0x7c3: 0xa0, 0x7c4: 0xa0, 0x7c5: 0xa0, 0x7c6: 0xa0, 0x7c7: 0xa0, - 0x7c8: 0xa0, 0x7c9: 0xa0, 0x7ca: 0xa0, 0x7cb: 0xa0, 0x7cc: 0xa0, 0x7cd: 0x19d, 0x7ce: 0xfb, 0x7cf: 0xfb, - 0x7d0: 0xfb, 0x7d1: 0xfb, 0x7d2: 0xfb, 0x7d3: 0xfb, 0x7d4: 0xfb, 0x7d5: 0xfb, 0x7d6: 0xfb, 0x7d7: 0xfb, - 0x7d8: 0xfb, 0x7d9: 0xfb, 0x7da: 0xfb, 0x7db: 0xfb, 0x7dc: 0xfb, 0x7dd: 0xfb, 0x7de: 0xfb, 0x7df: 0xfb, - 0x7e0: 0xfb, 0x7e1: 0xfb, 0x7e2: 0xfb, 0x7e3: 0xfb, 0x7e4: 0xfb, 0x7e5: 0xfb, 0x7e6: 0xfb, 0x7e7: 0xfb, - 0x7e8: 0xfb, 0x7e9: 0xfb, 0x7ea: 0xfb, 0x7eb: 0xfb, 0x7ec: 0xfb, 0x7ed: 0xfb, 0x7ee: 0xfb, 0x7ef: 0xfb, - 0x7f0: 0xfb, 0x7f1: 0xfb, 0x7f2: 0xfb, 0x7f3: 0xfb, 0x7f4: 0xfb, 0x7f5: 0xfb, 0x7f6: 0xfb, 0x7f7: 0xfb, - 0x7f8: 0xfb, 0x7f9: 0xfb, 0x7fa: 0xfb, 0x7fb: 0xfb, 0x7fc: 0xfb, 0x7fd: 0xfb, 0x7fe: 0xfb, 0x7ff: 0xfb, + 0x7c8: 0xa0, 0x7c9: 0xa0, 0x7ca: 0xa0, 0x7cb: 0xa0, 0x7cc: 0xa0, 0x7cd: 0x19d, 0x7ce: 0xfd, 0x7cf: 0xfd, + 0x7d0: 0xfd, 0x7d1: 0xfd, 0x7d2: 0xfd, 0x7d3: 0xfd, 0x7d4: 0xfd, 0x7d5: 0xfd, 0x7d6: 0xfd, 0x7d7: 0xfd, + 0x7d8: 0xfd, 0x7d9: 0xfd, 0x7da: 0xfd, 0x7db: 0xfd, 0x7dc: 0xfd, 0x7dd: 0xfd, 0x7de: 0xfd, 0x7df: 0xfd, + 0x7e0: 0xfd, 0x7e1: 0xfd, 0x7e2: 0xfd, 0x7e3: 0xfd, 0x7e4: 0xfd, 0x7e5: 0xfd, 0x7e6: 0xfd, 0x7e7: 0xfd, + 0x7e8: 0xfd, 0x7e9: 0xfd, 0x7ea: 0xfd, 0x7eb: 0xfd, 0x7ec: 0xfd, 0x7ed: 0xfd, 0x7ee: 0xfd, 0x7ef: 0xfd, + 0x7f0: 0xfd, 0x7f1: 0xfd, 0x7f2: 0xfd, 0x7f3: 0xfd, 0x7f4: 0xfd, 0x7f5: 0xfd, 0x7f6: 0xfd, 0x7f7: 0xfd, + 0x7f8: 0xfd, 0x7f9: 0xfd, 0x7fa: 0xfd, 0x7fb: 0xfd, 0x7fc: 0xfd, 0x7fd: 0xfd, 0x7fe: 0xfd, 0x7ff: 0xfd, // Block 0x20, offset 0x800 0x810: 0x0d, 0x811: 0x0e, 0x812: 0x0f, 0x813: 0x10, 0x814: 0x11, 0x815: 0x0b, 0x816: 0x12, 0x817: 0x07, 0x818: 0x13, 0x819: 0x0b, 0x81a: 0x0b, 0x81b: 0x14, 0x81c: 0x0b, 0x81d: 0x15, 0x81e: 0x16, 0x81f: 0x17, @@ -2370,14 +2513,14 @@ var idnaIndex = [2368]uint16{ 0x870: 0x0b, 0x871: 0x0b, 0x872: 0x0b, 0x873: 0x0b, 0x874: 0x0b, 0x875: 0x0b, 0x876: 0x0b, 0x877: 0x0b, 0x878: 0x0b, 0x879: 0x0b, 0x87a: 0x0b, 0x87b: 0x0b, 0x87c: 0x0b, 0x87d: 0x0b, 0x87e: 0x0b, 0x87f: 0x0b, // Block 0x22, offset 0x880 - 0x880: 0x19e, 0x881: 0x19f, 0x882: 0xfb, 0x883: 0xfb, 0x884: 0x1a0, 0x885: 0x1a0, 0x886: 0x1a0, 0x887: 0x1a1, - 0x888: 0xfb, 0x889: 0xfb, 0x88a: 0xfb, 0x88b: 0xfb, 0x88c: 0xfb, 0x88d: 0xfb, 0x88e: 0xfb, 0x88f: 0xfb, - 0x890: 0xfb, 0x891: 0xfb, 0x892: 0xfb, 0x893: 0xfb, 0x894: 0xfb, 0x895: 0xfb, 0x896: 0xfb, 0x897: 0xfb, - 0x898: 0xfb, 0x899: 0xfb, 0x89a: 0xfb, 0x89b: 0xfb, 0x89c: 0xfb, 0x89d: 0xfb, 0x89e: 0xfb, 0x89f: 0xfb, - 0x8a0: 0xfb, 0x8a1: 0xfb, 0x8a2: 0xfb, 0x8a3: 0xfb, 0x8a4: 0xfb, 0x8a5: 0xfb, 0x8a6: 0xfb, 0x8a7: 0xfb, - 0x8a8: 0xfb, 0x8a9: 0xfb, 0x8aa: 0xfb, 0x8ab: 0xfb, 0x8ac: 0xfb, 0x8ad: 0xfb, 0x8ae: 0xfb, 0x8af: 0xfb, - 0x8b0: 0xfb, 0x8b1: 0xfb, 0x8b2: 0xfb, 0x8b3: 0xfb, 0x8b4: 0xfb, 0x8b5: 0xfb, 0x8b6: 0xfb, 0x8b7: 0xfb, - 0x8b8: 0xfb, 0x8b9: 0xfb, 0x8ba: 0xfb, 0x8bb: 0xfb, 0x8bc: 0xfb, 0x8bd: 0xfb, 0x8be: 0xfb, 0x8bf: 0xfb, + 0x880: 0x19e, 0x881: 0x19f, 0x882: 0xfd, 0x883: 0xfd, 0x884: 0x1a0, 0x885: 0x1a0, 0x886: 0x1a0, 0x887: 0x1a1, + 0x888: 0xfd, 0x889: 0xfd, 0x88a: 0xfd, 0x88b: 0xfd, 0x88c: 0xfd, 0x88d: 0xfd, 0x88e: 0xfd, 0x88f: 0xfd, + 0x890: 0xfd, 0x891: 0xfd, 0x892: 0xfd, 0x893: 0xfd, 0x894: 0xfd, 0x895: 0xfd, 0x896: 0xfd, 0x897: 0xfd, + 0x898: 0xfd, 0x899: 0xfd, 0x89a: 0xfd, 0x89b: 0xfd, 0x89c: 0xfd, 0x89d: 0xfd, 0x89e: 0xfd, 0x89f: 0xfd, + 0x8a0: 0xfd, 0x8a1: 0xfd, 0x8a2: 0xfd, 0x8a3: 0xfd, 0x8a4: 0xfd, 0x8a5: 0xfd, 0x8a6: 0xfd, 0x8a7: 0xfd, + 0x8a8: 0xfd, 0x8a9: 0xfd, 0x8aa: 0xfd, 0x8ab: 0xfd, 0x8ac: 0xfd, 0x8ad: 0xfd, 0x8ae: 0xfd, 0x8af: 0xfd, + 0x8b0: 0xfd, 0x8b1: 0xfd, 0x8b2: 0xfd, 0x8b3: 0xfd, 0x8b4: 0xfd, 0x8b5: 0xfd, 0x8b6: 0xfd, 0x8b7: 0xfd, + 0x8b8: 0xfd, 0x8b9: 0xfd, 0x8ba: 0xfd, 0x8bb: 0xfd, 0x8bc: 0xfd, 0x8bd: 0xfd, 0x8be: 0xfd, 0x8bf: 0xfd, // Block 0x23, offset 0x8c0 0x8c0: 0x0b, 0x8c1: 0x0b, 0x8c2: 0x0b, 0x8c3: 0x0b, 0x8c4: 0x0b, 0x8c5: 0x0b, 0x8c6: 0x0b, 0x8c7: 0x0b, 0x8c8: 0x0b, 0x8c9: 0x0b, 0x8ca: 0x0b, 0x8cb: 0x0b, 0x8cc: 0x0b, 0x8cd: 0x0b, 0x8ce: 0x0b, 0x8cf: 0x0b, @@ -2393,10 +2536,10 @@ var idnaIndex = [2368]uint16{ } // idnaSparseOffset: 292 entries, 584 bytes -var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x85, 0x8b, 0x94, 0xa4, 0xb2, 0xbd, 0xca, 0xdb, 0xe5, 0xec, 0xf9, 0x10a, 0x111, 0x11c, 0x12b, 0x139, 0x143, 0x145, 0x14a, 0x14d, 0x150, 0x152, 0x15e, 0x169, 0x171, 0x177, 0x17d, 0x182, 0x187, 0x18a, 0x18e, 0x194, 0x199, 0x1a5, 0x1af, 0x1b5, 0x1c6, 0x1d0, 0x1d3, 0x1db, 0x1de, 0x1eb, 0x1f3, 0x1f7, 0x1fe, 0x206, 0x216, 0x222, 0x225, 0x22f, 0x23b, 0x247, 0x253, 0x25b, 0x260, 0x26d, 0x27e, 0x282, 0x28d, 0x291, 0x29a, 0x2a2, 0x2a8, 0x2ad, 0x2b0, 0x2b4, 0x2ba, 0x2be, 0x2c2, 0x2c6, 0x2cc, 0x2d4, 0x2db, 0x2e6, 0x2f0, 0x2f4, 0x2f7, 0x2fd, 0x301, 0x303, 0x306, 0x308, 0x30b, 0x315, 0x318, 0x327, 0x32b, 0x330, 0x333, 0x337, 0x33c, 0x341, 0x347, 0x358, 0x368, 0x36e, 0x372, 0x381, 0x386, 0x38e, 0x398, 0x3a3, 0x3ab, 0x3bc, 0x3c5, 0x3d5, 0x3e2, 0x3ee, 0x3f3, 0x400, 0x404, 0x409, 0x40b, 0x40d, 0x411, 0x413, 0x417, 0x420, 0x426, 0x42a, 0x43a, 0x444, 0x449, 0x44c, 0x452, 0x459, 0x45e, 0x462, 0x468, 0x46d, 0x476, 0x47b, 0x481, 0x488, 0x48f, 0x496, 0x49a, 0x49f, 0x4a2, 0x4a7, 0x4b3, 0x4b9, 0x4be, 0x4c5, 0x4cd, 0x4d2, 0x4d6, 0x4e6, 0x4ed, 0x4f1, 0x4f5, 0x4fc, 0x4fe, 0x501, 0x504, 0x508, 0x511, 0x515, 0x51d, 0x525, 0x52d, 0x539, 0x545, 0x54b, 0x554, 0x560, 0x567, 0x570, 0x57b, 0x582, 0x591, 0x59e, 0x5ab, 0x5b4, 0x5b8, 0x5c7, 0x5cf, 0x5da, 0x5e3, 0x5e9, 0x5f1, 0x5fa, 0x605, 0x608, 0x614, 0x61d, 0x620, 0x625, 0x62e, 0x633, 0x640, 0x64b, 0x654, 0x65e, 0x661, 0x66b, 0x674, 0x680, 0x68d, 0x69a, 0x6a8, 0x6af, 0x6b3, 0x6b7, 0x6ba, 0x6bf, 0x6c2, 0x6c7, 0x6ca, 0x6d1, 0x6d8, 0x6dc, 0x6e7, 0x6ea, 0x6ed, 0x6f0, 0x6f6, 0x6fc, 0x705, 0x708, 0x70b, 0x70e, 0x711, 0x718, 0x71b, 0x720, 0x72a, 0x72d, 0x731, 0x740, 0x74c, 0x750, 0x755, 0x759, 0x75e, 0x762, 0x767, 0x770, 0x77b, 0x781, 0x787, 0x78d, 0x793, 0x79c, 0x79f, 0x7a2, 0x7a6, 0x7aa, 0x7ae, 0x7b4, 0x7ba, 0x7bf, 0x7c2, 0x7d2, 0x7d9, 0x7dc, 0x7e1, 0x7e5, 0x7eb, 0x7f2, 0x7f6, 0x7fa, 0x803, 0x80a, 0x80f, 0x813, 0x821, 0x824, 0x827, 0x82b, 0x82f, 0x832, 0x842, 0x853, 0x856, 0x85b, 0x85d, 0x85f} +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x85, 0x8b, 0x94, 0xa4, 0xb2, 0xbd, 0xca, 0xdb, 0xe5, 0xec, 0xf9, 0x10a, 0x111, 0x11c, 0x12b, 0x139, 0x143, 0x145, 0x14a, 0x14d, 0x150, 0x152, 0x15e, 0x169, 0x171, 0x177, 0x17d, 0x182, 0x187, 0x18a, 0x18e, 0x194, 0x199, 0x1a5, 0x1af, 0x1b5, 0x1c6, 0x1d0, 0x1d3, 0x1db, 0x1de, 0x1eb, 0x1f3, 0x1f7, 0x1fe, 0x206, 0x216, 0x222, 0x225, 0x22f, 0x23b, 0x247, 0x253, 0x25b, 0x260, 0x26d, 0x27e, 0x282, 0x28d, 0x291, 0x29a, 0x2a2, 0x2a8, 0x2ad, 0x2b0, 0x2b4, 0x2ba, 0x2be, 0x2c2, 0x2c6, 0x2cc, 0x2d4, 0x2db, 0x2e6, 0x2f0, 0x2f4, 0x2f7, 0x2fd, 0x301, 0x303, 0x306, 0x308, 0x30b, 0x315, 0x318, 0x327, 0x32b, 0x32f, 0x331, 0x33a, 0x33d, 0x341, 0x346, 0x34b, 0x351, 0x362, 0x372, 0x378, 0x37c, 0x38b, 0x390, 0x398, 0x3a2, 0x3ad, 0x3b5, 0x3c6, 0x3cf, 0x3df, 0x3ec, 0x3f8, 0x3fd, 0x40a, 0x40e, 0x413, 0x415, 0x417, 0x41b, 0x41d, 0x421, 0x42a, 0x430, 0x434, 0x444, 0x44e, 0x453, 0x456, 0x45c, 0x463, 0x468, 0x46c, 0x472, 0x477, 0x480, 0x485, 0x48b, 0x492, 0x499, 0x4a0, 0x4a4, 0x4a9, 0x4ac, 0x4b1, 0x4bd, 0x4c3, 0x4c8, 0x4cf, 0x4d7, 0x4dc, 0x4e0, 0x4f0, 0x4f7, 0x4fb, 0x4ff, 0x506, 0x508, 0x50b, 0x50e, 0x512, 0x51b, 0x51f, 0x527, 0x52f, 0x537, 0x543, 0x54f, 0x555, 0x55e, 0x56a, 0x571, 0x57a, 0x585, 0x58c, 0x59b, 0x5a8, 0x5b5, 0x5be, 0x5c2, 0x5d1, 0x5d9, 0x5e4, 0x5ed, 0x5f3, 0x5fb, 0x604, 0x60f, 0x612, 0x61e, 0x627, 0x62a, 0x62f, 0x638, 0x63d, 0x64a, 0x655, 0x65e, 0x668, 0x66b, 0x675, 0x67e, 0x68a, 0x697, 0x6a4, 0x6b2, 0x6b9, 0x6bd, 0x6c1, 0x6c4, 0x6c9, 0x6cc, 0x6d1, 0x6d4, 0x6db, 0x6e2, 0x6e6, 0x6f1, 0x6f4, 0x6f7, 0x6fa, 0x700, 0x706, 0x70f, 0x712, 0x715, 0x718, 0x71b, 0x722, 0x725, 0x72a, 0x734, 0x737, 0x73b, 0x74a, 0x756, 0x75a, 0x75f, 0x763, 0x768, 0x76c, 0x771, 0x77a, 0x785, 0x78b, 0x791, 0x797, 0x79d, 0x7a6, 0x7a9, 0x7ac, 0x7b0, 0x7b4, 0x7b8, 0x7be, 0x7c4, 0x7c9, 0x7cc, 0x7dc, 0x7e3, 0x7e6, 0x7eb, 0x7ef, 0x7f5, 0x7fc, 0x800, 0x804, 0x80d, 0x814, 0x819, 0x81d, 0x82b, 0x82e, 0x831, 0x835, 0x839, 0x83c, 0x83f, 0x844, 0x846, 0x848} -// idnaSparseValues: 2146 entries, 8584 bytes -var idnaSparseValues = [2146]valueRange{ +// idnaSparseValues: 2123 entries, 8492 bytes +var idnaSparseValues = [2123]valueRange{ // Block 0x0, offset 0x0 {value: 0x0000, lo: 0x07}, {value: 0xe105, lo: 0x80, hi: 0x96}, @@ -2427,15 +2570,15 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x2, offset 0x19 {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0xaf}, - {value: 0x0249, lo: 0xb0, hi: 0xb0}, + {value: 0x00a9, lo: 0xb0, hi: 0xb0}, {value: 0x037d, lo: 0xb1, hi: 0xb1}, - {value: 0x0259, lo: 0xb2, hi: 0xb2}, - {value: 0x0269, lo: 0xb3, hi: 0xb3}, + {value: 0x00b1, lo: 0xb2, hi: 0xb2}, + {value: 0x00b9, lo: 0xb3, hi: 0xb3}, {value: 0x034d, lo: 0xb4, hi: 0xb4}, {value: 0x0395, lo: 0xb5, hi: 0xb5}, {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, - {value: 0x0279, lo: 0xb7, hi: 0xb7}, - {value: 0x0289, lo: 0xb8, hi: 0xb8}, + {value: 0x00c1, lo: 0xb7, hi: 0xb7}, + {value: 0x00c9, lo: 0xb8, hi: 0xb8}, {value: 0x0008, lo: 0xb9, hi: 0xbf}, // Block 0x3, offset 0x25 {value: 0x0000, lo: 0x01}, @@ -2457,7 +2600,7 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x6, offset 0x33 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x86}, - {value: 0x0401, lo: 0x87, hi: 0x87}, + {value: 0x0131, lo: 0x87, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x88}, {value: 0x0018, lo: 0x89, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0x8c}, @@ -2643,7 +2786,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x81, hi: 0xb0}, {value: 0x3308, lo: 0xb1, hi: 0xb1}, {value: 0x0008, lo: 0xb2, hi: 0xb2}, - {value: 0x08f1, lo: 0xb3, hi: 0xb3}, + {value: 0x01f1, lo: 0xb3, hi: 0xb3}, {value: 0x3308, lo: 0xb4, hi: 0xb9}, {value: 0x3b08, lo: 0xba, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbe}, @@ -2666,8 +2809,8 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8e, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0x9b}, - {value: 0x0961, lo: 0x9c, hi: 0x9c}, - {value: 0x0999, lo: 0x9d, hi: 0x9d}, + {value: 0x0201, lo: 0x9c, hi: 0x9c}, + {value: 0x0209, lo: 0x9d, hi: 0x9d}, {value: 0x0008, lo: 0x9e, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, // Block 0x18, offset 0xf9 @@ -3075,13 +3218,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbe, hi: 0xbf}, // Block 0x44, offset 0x260 {value: 0x0000, lo: 0x0c}, - {value: 0x0e29, lo: 0x80, hi: 0x80}, - {value: 0x0e41, lo: 0x81, hi: 0x81}, - {value: 0x0e59, lo: 0x82, hi: 0x82}, - {value: 0x0e71, lo: 0x83, hi: 0x83}, - {value: 0x0e89, lo: 0x84, hi: 0x85}, - {value: 0x0ea1, lo: 0x86, hi: 0x86}, - {value: 0x0eb9, lo: 0x87, hi: 0x87}, + {value: 0x02a9, lo: 0x80, hi: 0x80}, + {value: 0x02b1, lo: 0x81, hi: 0x81}, + {value: 0x02b9, lo: 0x82, hi: 0x82}, + {value: 0x02c1, lo: 0x83, hi: 0x83}, + {value: 0x02c9, lo: 0x84, hi: 0x85}, + {value: 0x02d1, lo: 0x86, hi: 0x86}, + {value: 0x02d9, lo: 0x87, hi: 0x87}, {value: 0x057d, lo: 0x88, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, {value: 0x059d, lo: 0x90, hi: 0xba}, @@ -3133,18 +3276,18 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x83, hi: 0x83}, {value: 0x0008, lo: 0x84, hi: 0x84}, {value: 0x0018, lo: 0x85, hi: 0x88}, - {value: 0x24c1, lo: 0x89, hi: 0x89}, + {value: 0x0851, lo: 0x89, hi: 0x89}, {value: 0x0018, lo: 0x8a, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, // Block 0x4a, offset 0x29a {value: 0x0000, lo: 0x07}, {value: 0x0018, lo: 0x80, hi: 0xab}, - {value: 0x24f1, lo: 0xac, hi: 0xac}, - {value: 0x2529, lo: 0xad, hi: 0xad}, + {value: 0x0859, lo: 0xac, hi: 0xac}, + {value: 0x0861, lo: 0xad, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xae}, - {value: 0x2579, lo: 0xaf, hi: 0xaf}, - {value: 0x25b1, lo: 0xb0, hi: 0xb0}, + {value: 0x0869, lo: 0xaf, hi: 0xaf}, + {value: 0x0871, lo: 0xb0, hi: 0xb0}, {value: 0x0018, lo: 0xb1, hi: 0xbf}, // Block 0x4b, offset 0x2a2 {value: 0x0000, lo: 0x05}, @@ -3166,19 +3309,19 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x4e, offset 0x2b0 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, - {value: 0x28c1, lo: 0x8c, hi: 0x8c}, + {value: 0x0929, lo: 0x8c, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0xbf}, // Block 0x4f, offset 0x2b4 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0xb3}, {value: 0x0e7e, lo: 0xb4, hi: 0xb4}, - {value: 0x292a, lo: 0xb5, hi: 0xb5}, + {value: 0x0932, lo: 0xb5, hi: 0xb5}, {value: 0x0e9e, lo: 0xb6, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, // Block 0x50, offset 0x2ba {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x9b}, - {value: 0x2941, lo: 0x9c, hi: 0x9c}, + {value: 0x0939, lo: 0x9c, hi: 0x9c}, {value: 0x0018, lo: 0x9d, hi: 0xbf}, // Block 0x51, offset 0x2be {value: 0x0000, lo: 0x03}, @@ -3277,16 +3420,16 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x80, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0x98}, {value: 0x3308, lo: 0x99, hi: 0x9a}, - {value: 0x29e2, lo: 0x9b, hi: 0x9b}, - {value: 0x2a0a, lo: 0x9c, hi: 0x9c}, + {value: 0x096a, lo: 0x9b, hi: 0x9b}, + {value: 0x0972, lo: 0x9c, hi: 0x9c}, {value: 0x0008, lo: 0x9d, hi: 0x9e}, - {value: 0x2a31, lo: 0x9f, hi: 0x9f}, + {value: 0x0979, lo: 0x9f, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa0}, {value: 0x0008, lo: 0xa1, hi: 0xbf}, // Block 0x61, offset 0x315 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbe}, - {value: 0x2a69, lo: 0xbf, hi: 0xbf}, + {value: 0x0981, lo: 0xbf, hi: 0xbf}, // Block 0x62, offset 0x318 {value: 0x0000, lo: 0x0e}, {value: 0x0040, lo: 0x80, hi: 0x84}, @@ -3309,46 +3452,58 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa4, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, // Block 0x64, offset 0x32b - {value: 0x0030, lo: 0x04}, - {value: 0x2aa2, lo: 0x80, hi: 0x9d}, - {value: 0x305a, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x03}, + {value: 0x098a, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0x9f}, - {value: 0x30a2, lo: 0xa0, hi: 0xbf}, - // Block 0x65, offset 0x330 + {value: 0x0a82, lo: 0xa0, hi: 0xbf}, + // Block 0x65, offset 0x32f + {value: 0x0008, lo: 0x01}, + {value: 0x0d19, lo: 0x80, hi: 0xbf}, + // Block 0x66, offset 0x331 + {value: 0x0008, lo: 0x08}, + {value: 0x0f19, lo: 0x80, hi: 0xb0}, + {value: 0x4045, lo: 0xb1, hi: 0xb1}, + {value: 0x10a1, lo: 0xb2, hi: 0xb3}, + {value: 0x4065, lo: 0xb4, hi: 0xb4}, + {value: 0x10b1, lo: 0xb5, hi: 0xb7}, + {value: 0x4085, lo: 0xb8, hi: 0xb8}, + {value: 0x4085, lo: 0xb9, hi: 0xb9}, + {value: 0x10c9, lo: 0xba, hi: 0xbf}, + // Block 0x67, offset 0x33a {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x66, offset 0x333 + // Block 0x68, offset 0x33d {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x8c}, {value: 0x0040, lo: 0x8d, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, - // Block 0x67, offset 0x337 + // Block 0x69, offset 0x341 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xbd}, {value: 0x0018, lo: 0xbe, hi: 0xbf}, - // Block 0x68, offset 0x33c + // Block 0x6a, offset 0x346 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xbf}, - // Block 0x69, offset 0x341 + // Block 0x6b, offset 0x34b {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xa5}, {value: 0x0018, lo: 0xa6, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb1}, {value: 0x0018, lo: 0xb2, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0x6a, offset 0x347 + // Block 0x6c, offset 0x351 {value: 0x0000, lo: 0x10}, {value: 0x0040, lo: 0x80, hi: 0x81}, {value: 0xe00d, lo: 0x82, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0x83}, {value: 0x03f5, lo: 0x84, hi: 0x84}, - {value: 0x1329, lo: 0x85, hi: 0x85}, + {value: 0x0479, lo: 0x85, hi: 0x85}, {value: 0x447d, lo: 0x86, hi: 0x86}, {value: 0xe07d, lo: 0x87, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x88}, @@ -3357,10 +3512,10 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8b, hi: 0xb4}, {value: 0xe01d, lo: 0xb5, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xb7}, - {value: 0x2009, lo: 0xb8, hi: 0xb8}, - {value: 0x6ec1, lo: 0xb9, hi: 0xb9}, + {value: 0x0741, lo: 0xb8, hi: 0xb8}, + {value: 0x13f1, lo: 0xb9, hi: 0xb9}, {value: 0x0008, lo: 0xba, hi: 0xbf}, - // Block 0x6b, offset 0x358 + // Block 0x6d, offset 0x362 {value: 0x0000, lo: 0x0f}, {value: 0x0008, lo: 0x80, hi: 0x81}, {value: 0x3308, lo: 0x82, hi: 0x82}, @@ -3377,19 +3532,19 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x6c, offset 0x368 + // Block 0x6e, offset 0x372 {value: 0x0000, lo: 0x05}, {value: 0x0208, lo: 0x80, hi: 0xb1}, {value: 0x0108, lo: 0xb2, hi: 0xb2}, {value: 0x0008, lo: 0xb3, hi: 0xb3}, {value: 0x0018, lo: 0xb4, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0x6d, offset 0x36e + // Block 0x6f, offset 0x378 {value: 0x0000, lo: 0x03}, {value: 0x3008, lo: 0x80, hi: 0x81}, {value: 0x0008, lo: 0x82, hi: 0xb3}, {value: 0x3008, lo: 0xb4, hi: 0xbf}, - // Block 0x6e, offset 0x372 + // Block 0x70, offset 0x37c {value: 0x0000, lo: 0x0e}, {value: 0x3008, lo: 0x80, hi: 0x83}, {value: 0x3b08, lo: 0x84, hi: 0x84}, @@ -3405,13 +3560,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbc, hi: 0xbc}, {value: 0x0008, lo: 0xbd, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0x6f, offset 0x381 + // Block 0x71, offset 0x38b {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa5}, {value: 0x3308, lo: 0xa6, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x70, offset 0x386 + // Block 0x72, offset 0x390 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x3308, lo: 0x87, hi: 0x91}, @@ -3420,7 +3575,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x94, hi: 0x9e}, {value: 0x0018, lo: 0x9f, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x71, offset 0x38e + // Block 0x73, offset 0x398 {value: 0x0000, lo: 0x09}, {value: 0x3308, lo: 0x80, hi: 0x82}, {value: 0x3008, lo: 0x83, hi: 0x83}, @@ -3431,7 +3586,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xba, hi: 0xbb}, {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbf}, - // Block 0x72, offset 0x398 + // Block 0x74, offset 0x3a2 {value: 0x0000, lo: 0x0a}, {value: 0x3808, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x8d}, @@ -3443,7 +3598,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xa5, hi: 0xa5}, {value: 0x0008, lo: 0xa6, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0x73, offset 0x3a3 + // Block 0x75, offset 0x3ad {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xa8}, {value: 0x3308, lo: 0xa9, hi: 0xae}, @@ -3452,7 +3607,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb3, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x74, offset 0x3ab + // Block 0x76, offset 0x3b5 {value: 0x0000, lo: 0x10}, {value: 0x0008, lo: 0x80, hi: 0x82}, {value: 0x3308, lo: 0x83, hi: 0x83}, @@ -3470,7 +3625,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbc}, {value: 0x3008, lo: 0xbd, hi: 0xbd}, {value: 0x0008, lo: 0xbe, hi: 0xbf}, - // Block 0x75, offset 0x3bc + // Block 0x77, offset 0x3c6 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb0}, @@ -3480,7 +3635,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb7, hi: 0xb8}, {value: 0x0008, lo: 0xb9, hi: 0xbd}, {value: 0x3308, lo: 0xbe, hi: 0xbf}, - // Block 0x76, offset 0x3c5 + // Block 0x78, offset 0x3cf {value: 0x0000, lo: 0x0f}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x81}, @@ -3497,7 +3652,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb5, hi: 0xb5}, {value: 0x3b08, lo: 0xb6, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x77, offset 0x3d5 + // Block 0x79, offset 0x3df {value: 0x0000, lo: 0x0c}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x86}, @@ -3511,26 +3666,26 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa8, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x78, offset 0x3e2 + // Block 0x7a, offset 0x3ec {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x9a}, {value: 0x0018, lo: 0x9b, hi: 0x9b}, {value: 0x449d, lo: 0x9c, hi: 0x9c}, {value: 0x44b5, lo: 0x9d, hi: 0x9d}, - {value: 0x2971, lo: 0x9e, hi: 0x9e}, + {value: 0x0941, lo: 0x9e, hi: 0x9e}, {value: 0xe06d, lo: 0x9f, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa8}, - {value: 0x6ed9, lo: 0xa9, hi: 0xa9}, + {value: 0x13f9, lo: 0xa9, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x44cd, lo: 0xb0, hi: 0xbf}, - // Block 0x79, offset 0x3ee + // Block 0x7b, offset 0x3f8 {value: 0x0000, lo: 0x04}, {value: 0x44ed, lo: 0x80, hi: 0x8f}, {value: 0x450d, lo: 0x90, hi: 0x9f}, {value: 0x452d, lo: 0xa0, hi: 0xaf}, {value: 0x450d, lo: 0xb0, hi: 0xbf}, - // Block 0x7a, offset 0x3f3 + // Block 0x7c, offset 0x3fd {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0xa2}, {value: 0x3008, lo: 0xa3, hi: 0xa4}, @@ -3544,76 +3699,76 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x7b, offset 0x400 + // Block 0x7d, offset 0x40a {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbf}, - // Block 0x7c, offset 0x404 + // Block 0x7e, offset 0x40e {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8a}, {value: 0x0018, lo: 0x8b, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x7d, offset 0x409 + // Block 0x7f, offset 0x413 {value: 0x0000, lo: 0x01}, {value: 0x0040, lo: 0x80, hi: 0xbf}, - // Block 0x7e, offset 0x40b + // Block 0x80, offset 0x415 {value: 0x0020, lo: 0x01}, {value: 0x454d, lo: 0x80, hi: 0xbf}, - // Block 0x7f, offset 0x40d + // Block 0x81, offset 0x417 {value: 0x0020, lo: 0x03}, {value: 0x4d4d, lo: 0x80, hi: 0x94}, {value: 0x4b0d, lo: 0x95, hi: 0x95}, {value: 0x4fed, lo: 0x96, hi: 0xbf}, - // Block 0x80, offset 0x411 + // Block 0x82, offset 0x41b {value: 0x0020, lo: 0x01}, {value: 0x552d, lo: 0x80, hi: 0xbf}, - // Block 0x81, offset 0x413 + // Block 0x83, offset 0x41d {value: 0x0020, lo: 0x03}, {value: 0x5d2d, lo: 0x80, hi: 0x84}, {value: 0x568d, lo: 0x85, hi: 0x85}, {value: 0x5dcd, lo: 0x86, hi: 0xbf}, - // Block 0x82, offset 0x417 + // Block 0x84, offset 0x421 {value: 0x0020, lo: 0x08}, {value: 0x6b8d, lo: 0x80, hi: 0x8f}, {value: 0x6d4d, lo: 0x90, hi: 0x90}, {value: 0x6d8d, lo: 0x91, hi: 0xab}, - {value: 0x6ef1, lo: 0xac, hi: 0xac}, + {value: 0x1401, lo: 0xac, hi: 0xac}, {value: 0x70ed, lo: 0xad, hi: 0xad}, {value: 0x0040, lo: 0xae, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x710d, lo: 0xb0, hi: 0xbf}, - // Block 0x83, offset 0x420 + // Block 0x85, offset 0x42a {value: 0x0020, lo: 0x05}, {value: 0x730d, lo: 0x80, hi: 0xad}, {value: 0x656d, lo: 0xae, hi: 0xae}, {value: 0x78cd, lo: 0xaf, hi: 0xb5}, {value: 0x6f8d, lo: 0xb6, hi: 0xb6}, {value: 0x79ad, lo: 0xb7, hi: 0xbf}, - // Block 0x84, offset 0x426 - {value: 0x0028, lo: 0x03}, - {value: 0x7c71, lo: 0x80, hi: 0x82}, - {value: 0x7c31, lo: 0x83, hi: 0x83}, - {value: 0x7ce9, lo: 0x84, hi: 0xbf}, - // Block 0x85, offset 0x42a - {value: 0x0038, lo: 0x0f}, - {value: 0x9e01, lo: 0x80, hi: 0x83}, - {value: 0x9ea9, lo: 0x84, hi: 0x85}, - {value: 0x9ee1, lo: 0x86, hi: 0x87}, - {value: 0x9f19, lo: 0x88, hi: 0x8f}, + // Block 0x86, offset 0x430 + {value: 0x0008, lo: 0x03}, + {value: 0x1751, lo: 0x80, hi: 0x82}, + {value: 0x1741, lo: 0x83, hi: 0x83}, + {value: 0x1769, lo: 0x84, hi: 0xbf}, + // Block 0x87, offset 0x434 + {value: 0x0008, lo: 0x0f}, + {value: 0x1d81, lo: 0x80, hi: 0x83}, + {value: 0x1d99, lo: 0x84, hi: 0x85}, + {value: 0x1da1, lo: 0x86, hi: 0x87}, + {value: 0x1da9, lo: 0x88, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x90}, {value: 0x0040, lo: 0x91, hi: 0x91}, - {value: 0xa0d9, lo: 0x92, hi: 0x97}, - {value: 0xa1f1, lo: 0x98, hi: 0x9c}, - {value: 0xa2d1, lo: 0x9d, hi: 0xb3}, - {value: 0x9d91, lo: 0xb4, hi: 0xb4}, - {value: 0x9e01, lo: 0xb5, hi: 0xb5}, - {value: 0xa7d9, lo: 0xb6, hi: 0xbb}, - {value: 0xa8b9, lo: 0xbc, hi: 0xbc}, - {value: 0xa849, lo: 0xbd, hi: 0xbd}, - {value: 0xa929, lo: 0xbe, hi: 0xbf}, - // Block 0x86, offset 0x43a + {value: 0x1de9, lo: 0x92, hi: 0x97}, + {value: 0x1e11, lo: 0x98, hi: 0x9c}, + {value: 0x1e31, lo: 0x9d, hi: 0xb3}, + {value: 0x1d71, lo: 0xb4, hi: 0xb4}, + {value: 0x1d81, lo: 0xb5, hi: 0xb5}, + {value: 0x1ee9, lo: 0xb6, hi: 0xbb}, + {value: 0x1f09, lo: 0xbc, hi: 0xbc}, + {value: 0x1ef9, lo: 0xbd, hi: 0xbd}, + {value: 0x1f19, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x444 {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8c}, @@ -3624,24 +3779,24 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xbc, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbe}, {value: 0x0008, lo: 0xbf, hi: 0xbf}, - // Block 0x87, offset 0x444 + // Block 0x89, offset 0x44e {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x8d}, {value: 0x0040, lo: 0x8e, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0x88, offset 0x449 + // Block 0x8a, offset 0x453 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x89, offset 0x44c + // Block 0x8b, offset 0x456 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x82}, {value: 0x0040, lo: 0x83, hi: 0x86}, {value: 0x0018, lo: 0x87, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, - // Block 0x8a, offset 0x452 + // Block 0x8c, offset 0x45c {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x8e}, {value: 0x0040, lo: 0x8f, hi: 0x8f}, @@ -3649,31 +3804,31 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9d, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa0}, {value: 0x0040, lo: 0xa1, hi: 0xbf}, - // Block 0x8b, offset 0x459 + // Block 0x8d, offset 0x463 {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbc}, {value: 0x3308, lo: 0xbd, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0x8c, offset 0x45e + // Block 0x8e, offset 0x468 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x9c}, {value: 0x0040, lo: 0x9d, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x8d, offset 0x462 + // Block 0x8f, offset 0x46c {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x90}, {value: 0x0040, lo: 0x91, hi: 0x9f}, {value: 0x3308, lo: 0xa0, hi: 0xa0}, {value: 0x0018, lo: 0xa1, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x8e, offset 0x468 + // Block 0x90, offset 0x472 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xac}, {value: 0x0008, lo: 0xad, hi: 0xbf}, - // Block 0x8f, offset 0x46d + // Block 0x91, offset 0x477 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x81}, @@ -3683,20 +3838,20 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x90, hi: 0xb5}, {value: 0x3308, lo: 0xb6, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x90, offset 0x476 + // Block 0x92, offset 0x480 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9e}, {value: 0x0018, lo: 0x9f, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x91, offset 0x47b + // Block 0x93, offset 0x485 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0040, lo: 0x84, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0xbf}, - // Block 0x92, offset 0x481 + // Block 0x94, offset 0x48b {value: 0x0000, lo: 0x06}, {value: 0xe145, lo: 0x80, hi: 0x87}, {value: 0xe1c5, lo: 0x88, hi: 0x8f}, @@ -3704,7 +3859,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x8b0d, lo: 0x98, hi: 0x9f}, {value: 0x8b25, lo: 0xa0, hi: 0xa7}, {value: 0x0008, lo: 0xa8, hi: 0xbf}, - // Block 0x93, offset 0x488 + // Block 0x95, offset 0x492 {value: 0x0000, lo: 0x06}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9f}, @@ -3712,7 +3867,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xaa, hi: 0xaf}, {value: 0x8b25, lo: 0xb0, hi: 0xb7}, {value: 0x8b0d, lo: 0xb8, hi: 0xbf}, - // Block 0x94, offset 0x48f + // Block 0x96, offset 0x499 {value: 0x0000, lo: 0x06}, {value: 0xe145, lo: 0x80, hi: 0x87}, {value: 0xe1c5, lo: 0x88, hi: 0x8f}, @@ -3720,28 +3875,28 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x94, hi: 0x97}, {value: 0x0008, lo: 0x98, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x95, offset 0x496 + // Block 0x97, offset 0x4a0 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x96, offset 0x49a + // Block 0x98, offset 0x4a4 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xae}, {value: 0x0018, lo: 0xaf, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0x97, offset 0x49f + // Block 0x99, offset 0x4a9 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x98, offset 0x4a2 + // Block 0x9a, offset 0x4ac {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xbf}, - // Block 0x99, offset 0x4a7 + // Block 0x9b, offset 0x4b1 {value: 0x0000, lo: 0x0b}, {value: 0x0808, lo: 0x80, hi: 0x85}, {value: 0x0040, lo: 0x86, hi: 0x87}, @@ -3754,20 +3909,20 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xbc, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbe}, {value: 0x0808, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x4b3 + // Block 0x9c, offset 0x4bd {value: 0x0000, lo: 0x05}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x96}, {value: 0x0818, lo: 0x97, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb6}, {value: 0x0818, lo: 0xb7, hi: 0xbf}, - // Block 0x9b, offset 0x4b9 + // Block 0x9d, offset 0x4c3 {value: 0x0000, lo: 0x04}, {value: 0x0808, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0xa6}, {value: 0x0818, lo: 0xa7, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0x9c, offset 0x4be + // Block 0x9e, offset 0x4c8 {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb2}, @@ -3775,7 +3930,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xb4, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xba}, {value: 0x0818, lo: 0xbb, hi: 0xbf}, - // Block 0x9d, offset 0x4c5 + // Block 0x9f, offset 0x4cf {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0818, lo: 0x96, hi: 0x9b}, @@ -3784,18 +3939,18 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xa0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbe}, {value: 0x0818, lo: 0xbf, hi: 0xbf}, - // Block 0x9e, offset 0x4cd + // Block 0xa0, offset 0x4d7 {value: 0x0000, lo: 0x04}, {value: 0x0808, lo: 0x80, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbb}, {value: 0x0818, lo: 0xbc, hi: 0xbd}, {value: 0x0808, lo: 0xbe, hi: 0xbf}, - // Block 0x9f, offset 0x4d2 + // Block 0xa1, offset 0x4dc {value: 0x0000, lo: 0x03}, {value: 0x0818, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x91}, {value: 0x0818, lo: 0x92, hi: 0xbf}, - // Block 0xa0, offset 0x4d6 + // Block 0xa2, offset 0x4e0 {value: 0x0000, lo: 0x0f}, {value: 0x0808, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x83}, @@ -3812,7 +3967,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb8, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xa1, offset 0x4e6 + // Block 0xa3, offset 0x4f0 {value: 0x0000, lo: 0x06}, {value: 0x0818, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, @@ -3820,17 +3975,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xbc}, {value: 0x0818, lo: 0xbd, hi: 0xbf}, - // Block 0xa2, offset 0x4ed + // Block 0xa4, offset 0x4f7 {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0x9c}, {value: 0x0818, lo: 0x9d, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0xa3, offset 0x4f1 + // Block 0xa5, offset 0x4fb {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xb8}, {value: 0x0018, lo: 0xb9, hi: 0xbf}, - // Block 0xa4, offset 0x4f5 + // Block 0xa6, offset 0x4ff {value: 0x0000, lo: 0x06}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x97}, @@ -3838,23 +3993,23 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xa0, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xb7}, {value: 0x0818, lo: 0xb8, hi: 0xbf}, - // Block 0xa5, offset 0x4fc + // Block 0xa7, offset 0x506 {value: 0x0000, lo: 0x01}, {value: 0x0808, lo: 0x80, hi: 0xbf}, - // Block 0xa6, offset 0x4fe + // Block 0xa8, offset 0x508 {value: 0x0000, lo: 0x02}, {value: 0x0808, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0xbf}, - // Block 0xa7, offset 0x501 + // Block 0xa9, offset 0x50b {value: 0x0000, lo: 0x02}, {value: 0x03dd, lo: 0x80, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xbf}, - // Block 0xa8, offset 0x504 + // Block 0xaa, offset 0x50e {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xb9}, {value: 0x0818, lo: 0xba, hi: 0xbf}, - // Block 0xa9, offset 0x508 + // Block 0xab, offset 0x512 {value: 0x0000, lo: 0x08}, {value: 0x0908, lo: 0x80, hi: 0x80}, {value: 0x0a08, lo: 0x81, hi: 0xa1}, @@ -3864,12 +4019,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0808, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xaa, offset 0x511 + // Block 0xac, offset 0x51b {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0818, lo: 0xa0, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0xab, offset 0x515 + // Block 0xad, offset 0x51f {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xaa}, @@ -3878,7 +4033,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0808, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0xac, offset 0x51d + // Block 0xae, offset 0x527 {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0x9c}, {value: 0x0818, lo: 0x9d, hi: 0xa6}, @@ -3887,7 +4042,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0a08, lo: 0xb0, hi: 0xb2}, {value: 0x0c08, lo: 0xb3, hi: 0xb3}, {value: 0x0a08, lo: 0xb4, hi: 0xbf}, - // Block 0xad, offset 0x525 + // Block 0xaf, offset 0x52f {value: 0x0000, lo: 0x07}, {value: 0x0a08, lo: 0x80, hi: 0x84}, {value: 0x0808, lo: 0x85, hi: 0x85}, @@ -3896,7 +4051,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0c18, lo: 0x94, hi: 0x94}, {value: 0x0818, lo: 0x95, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xae, offset 0x52d + // Block 0xb0, offset 0x537 {value: 0x0000, lo: 0x0b}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0a08, lo: 0xb0, hi: 0xb0}, @@ -3909,7 +4064,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0a08, lo: 0xbb, hi: 0xbc}, {value: 0x0c08, lo: 0xbd, hi: 0xbd}, {value: 0x0a08, lo: 0xbe, hi: 0xbf}, - // Block 0xaf, offset 0x539 + // Block 0xb1, offset 0x543 {value: 0x0000, lo: 0x0b}, {value: 0x0808, lo: 0x80, hi: 0x80}, {value: 0x0a08, lo: 0x81, hi: 0x81}, @@ -3922,14 +4077,14 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8c, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xb0, offset 0x545 + // Block 0xb2, offset 0x54f {value: 0x0000, lo: 0x05}, {value: 0x3008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0xb7}, {value: 0x3308, lo: 0xb8, hi: 0xbf}, - // Block 0xb1, offset 0x54b + // Block 0xb3, offset 0x555 {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x85}, {value: 0x3b08, lo: 0x86, hi: 0x86}, @@ -3939,7 +4094,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa6, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xb2, offset 0x554 + // Block 0xb4, offset 0x55e {value: 0x0000, lo: 0x0b}, {value: 0x3308, lo: 0x80, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, @@ -3952,7 +4107,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbb, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbd}, {value: 0x0018, lo: 0xbe, hi: 0xbf}, - // Block 0xb3, offset 0x560 + // Block 0xb5, offset 0x56a {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x81}, {value: 0x0040, lo: 0x82, hi: 0x8f}, @@ -3960,7 +4115,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa9, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xb4, offset 0x567 + // Block 0xb6, offset 0x571 {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0xa6}, @@ -3970,7 +4125,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3b08, lo: 0xb3, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xbf}, - // Block 0xb5, offset 0x570 + // Block 0xb7, offset 0x57a {value: 0x0000, lo: 0x0a}, {value: 0x0018, lo: 0x80, hi: 0x83}, {value: 0x0008, lo: 0x84, hi: 0x84}, @@ -3982,7 +4137,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xb4, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xb6, offset 0x57b + // Block 0xb8, offset 0x585 {value: 0x0000, lo: 0x06}, {value: 0x3308, lo: 0x80, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, @@ -3990,7 +4145,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb3, hi: 0xb5}, {value: 0x3308, lo: 0xb6, hi: 0xbe}, {value: 0x3008, lo: 0xbf, hi: 0xbf}, - // Block 0xb7, offset 0x582 + // Block 0xb9, offset 0x58c {value: 0x0000, lo: 0x0e}, {value: 0x3808, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x84}, @@ -4006,7 +4161,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa0, hi: 0xa0}, {value: 0x0018, lo: 0xa1, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0xb8, offset 0x591 + // Block 0xba, offset 0x59b {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x91}, {value: 0x0040, lo: 0x92, hi: 0x92}, @@ -4020,7 +4175,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xb8, hi: 0xbd}, {value: 0x3308, lo: 0xbe, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x59e + // Block 0xbb, offset 0x5a8 {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4034,7 +4189,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xa9, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0xba, offset 0x5ab + // Block 0xbc, offset 0x5b5 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x3308, lo: 0x9f, hi: 0x9f}, @@ -4044,12 +4199,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xab, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xbb, offset 0x5b4 + // Block 0xbd, offset 0x5be {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xb4}, {value: 0x3008, lo: 0xb5, hi: 0xb7}, {value: 0x3308, lo: 0xb8, hi: 0xbf}, - // Block 0xbc, offset 0x5b8 + // Block 0xbe, offset 0x5c2 {value: 0x0000, lo: 0x0e}, {value: 0x3008, lo: 0x80, hi: 0x81}, {value: 0x3b08, lo: 0x82, hi: 0x82}, @@ -4065,7 +4220,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0x9e, hi: 0x9e}, {value: 0x0008, lo: 0x9f, hi: 0xa1}, {value: 0x0040, lo: 0xa2, hi: 0xbf}, - // Block 0xbd, offset 0x5c7 + // Block 0xbf, offset 0x5d1 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb2}, @@ -4074,7 +4229,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xba, hi: 0xba}, {value: 0x3008, lo: 0xbb, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0xbe, offset 0x5cf + // Block 0xc0, offset 0x5d9 {value: 0x0000, lo: 0x0a}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x3008, lo: 0x81, hi: 0x81}, @@ -4086,7 +4241,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x88, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xbf, offset 0x5da + // Block 0xc1, offset 0x5e4 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xae}, {value: 0x3008, lo: 0xaf, hi: 0xb1}, @@ -4096,14 +4251,14 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xc0, offset 0x5e3 + // Block 0xc2, offset 0x5ed {value: 0x0000, lo: 0x05}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x97}, {value: 0x0008, lo: 0x98, hi: 0x9b}, {value: 0x3308, lo: 0x9c, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0xc1, offset 0x5e9 + // Block 0xc3, offset 0x5f3 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb2}, @@ -4112,7 +4267,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbd, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xc2, offset 0x5f1 + // Block 0xc4, offset 0x5fb {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x83}, @@ -4122,7 +4277,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9a, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xac}, {value: 0x0040, lo: 0xad, hi: 0xbf}, - // Block 0xc3, offset 0x5fa + // Block 0xc5, offset 0x604 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0xaa}, {value: 0x3308, lo: 0xab, hi: 0xab}, @@ -4134,11 +4289,11 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb7, hi: 0xb7}, {value: 0x0008, lo: 0xb8, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xc4, offset 0x605 + // Block 0xc6, offset 0x60f {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x0040, lo: 0x8a, hi: 0xbf}, - // Block 0xc5, offset 0x608 + // Block 0xc7, offset 0x612 {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x9a}, {value: 0x0040, lo: 0x9b, hi: 0x9c}, @@ -4151,7 +4306,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0018, lo: 0xba, hi: 0xbf}, - // Block 0xc6, offset 0x614 + // Block 0xc8, offset 0x61e {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xab}, {value: 0x3008, lo: 0xac, hi: 0xae}, @@ -4161,17 +4316,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xba, hi: 0xba}, {value: 0x0018, lo: 0xbb, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0xc7, offset 0x61d + // Block 0xc9, offset 0x627 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x049d, lo: 0xa0, hi: 0xbf}, - // Block 0xc8, offset 0x620 + // Block 0xca, offset 0x62a {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xbe}, {value: 0x0008, lo: 0xbf, hi: 0xbf}, - // Block 0xc9, offset 0x625 + // Block 0xcb, offset 0x62f {value: 0x0000, lo: 0x08}, {value: 0x3008, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x81}, @@ -4181,13 +4336,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x87, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xca, offset 0x62e + // Block 0xcc, offset 0x638 {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xa9}, {value: 0x0008, lo: 0xaa, hi: 0xbf}, - // Block 0xcb, offset 0x633 + // Block 0xcd, offset 0x63d {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x90}, {value: 0x3008, lo: 0x91, hi: 0x93}, @@ -4201,7 +4356,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa3, hi: 0xa3}, {value: 0x3008, lo: 0xa4, hi: 0xa4}, {value: 0x0040, lo: 0xa5, hi: 0xbf}, - // Block 0xcc, offset 0x640 + // Block 0xce, offset 0x64a {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x8a}, @@ -4213,7 +4368,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xba, hi: 0xba}, {value: 0x3308, lo: 0xbb, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xcd, offset 0x64b + // Block 0xcf, offset 0x655 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x3b08, lo: 0x87, hi: 0x87}, @@ -4223,7 +4378,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0x97, hi: 0x98}, {value: 0x3308, lo: 0x99, hi: 0x9b}, {value: 0x0008, lo: 0x9c, hi: 0xbf}, - // Block 0xce, offset 0x654 + // Block 0xd0, offset 0x65e {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x3308, lo: 0x8a, hi: 0x96}, @@ -4234,11 +4389,11 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x9d, hi: 0x9d}, {value: 0x0018, lo: 0x9e, hi: 0xa2}, {value: 0x0040, lo: 0xa3, hi: 0xbf}, - // Block 0xcf, offset 0x65e + // Block 0xd1, offset 0x668 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xd0, offset 0x661 + // Block 0xd2, offset 0x66b {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x89}, @@ -4249,7 +4404,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb8, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x66b + // Block 0xd3, offset 0x675 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x85}, @@ -4259,7 +4414,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0008, lo: 0xb2, hi: 0xbf}, - // Block 0xd2, offset 0x674 + // Block 0xd4, offset 0x67e {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x91}, @@ -4272,7 +4427,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb4, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xd3, offset 0x680 + // Block 0xd5, offset 0x68a {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4286,7 +4441,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0xd4, offset 0x68d + // Block 0xd6, offset 0x697 {value: 0x0000, lo: 0x0c}, {value: 0x3308, lo: 0x80, hi: 0x83}, {value: 0x3b08, lo: 0x84, hi: 0x85}, @@ -4300,7 +4455,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa7, hi: 0xa8}, {value: 0x0040, lo: 0xa9, hi: 0xa9}, {value: 0x0008, lo: 0xaa, hi: 0xbf}, - // Block 0xd5, offset 0x69a + // Block 0xd7, offset 0x6a4 {value: 0x0000, lo: 0x0d}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x3008, lo: 0x8a, hi: 0x8e}, @@ -4315,7 +4470,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xbf}, - // Block 0xd6, offset 0x6a8 + // Block 0xd8, offset 0x6b2 {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xb2}, @@ -4323,41 +4478,41 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb5, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xd7, offset 0x6af + // Block 0xd9, offset 0x6b9 {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb0}, {value: 0x0040, lo: 0xb1, hi: 0xbf}, - // Block 0xd8, offset 0x6b3 + // Block 0xda, offset 0x6bd {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xd9, offset 0x6b7 + // Block 0xdb, offset 0x6c1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xda, offset 0x6ba + // Block 0xdc, offset 0x6c4 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0xdb, offset 0x6bf + // Block 0xdd, offset 0x6c9 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0040, lo: 0x84, hi: 0xbf}, - // Block 0xdc, offset 0x6c2 + // Block 0xde, offset 0x6cc {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0340, lo: 0xb0, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xdd, offset 0x6c7 + // Block 0xdf, offset 0x6d1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0xbf}, - // Block 0xde, offset 0x6ca + // Block 0xe0, offset 0x6d4 {value: 0x0000, lo: 0x06}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0x9f}, @@ -4365,7 +4520,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xaa, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0xdf, offset 0x6d1 + // Block 0xe1, offset 0x6db {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xad}, @@ -4373,12 +4528,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb0, hi: 0xb4}, {value: 0x0018, lo: 0xb5, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0xe0, offset 0x6d8 + // Block 0xe2, offset 0x6e2 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, - // Block 0xe1, offset 0x6dc + // Block 0xe3, offset 0x6e6 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0018, lo: 0x84, hi: 0x85}, @@ -4390,33 +4545,33 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa3, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbc}, {value: 0x0008, lo: 0xbd, hi: 0xbf}, - // Block 0xe2, offset 0x6e7 + // Block 0xe4, offset 0x6f1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0xbf}, - // Block 0xe3, offset 0x6ea + // Block 0xe5, offset 0x6f4 {value: 0x0000, lo: 0x02}, {value: 0xe105, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0xe4, offset 0x6ed + // Block 0xe6, offset 0x6f7 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0x9a}, {value: 0x0040, lo: 0x9b, hi: 0xbf}, - // Block 0xe5, offset 0x6f0 + // Block 0xe7, offset 0x6fa {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0x8e}, {value: 0x3308, lo: 0x8f, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x90}, {value: 0x3008, lo: 0x91, hi: 0xbf}, - // Block 0xe6, offset 0x6f6 + // Block 0xe8, offset 0x700 {value: 0x0000, lo: 0x05}, {value: 0x3008, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8e}, {value: 0x3308, lo: 0x8f, hi: 0x92}, {value: 0x0008, lo: 0x93, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0xe7, offset 0x6fc + // Block 0xe9, offset 0x706 {value: 0x0000, lo: 0x08}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa1}, @@ -4426,23 +4581,23 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa5, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0xe8, offset 0x705 + // Block 0xea, offset 0x70f {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0xe9, offset 0x708 + // Block 0xeb, offset 0x712 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0xbf}, - // Block 0xea, offset 0x70b + // Block 0xec, offset 0x715 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0xbf}, - // Block 0xeb, offset 0x70e + // Block 0xed, offset 0x718 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0xbf}, - // Block 0xec, offset 0x711 + // Block 0xee, offset 0x71b {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x92}, @@ -4450,17 +4605,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa4, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0xed, offset 0x718 + // Block 0xef, offset 0x722 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0xee, offset 0x71b + // Block 0xf0, offset 0x725 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xaa}, {value: 0x0040, lo: 0xab, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0xef, offset 0x720 + // Block 0xf1, offset 0x72a {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, @@ -4471,32 +4626,32 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0x9f, hi: 0x9f}, {value: 0x03c0, lo: 0xa0, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xbf}, - // Block 0xf0, offset 0x72a + // Block 0xf2, offset 0x734 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0xf1, offset 0x72d + // Block 0xf3, offset 0x737 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xa6}, {value: 0x0040, lo: 0xa7, hi: 0xa8}, {value: 0x0018, lo: 0xa9, hi: 0xbf}, - // Block 0xf2, offset 0x731 + // Block 0xf4, offset 0x73b {value: 0x0000, lo: 0x0e}, {value: 0x0018, lo: 0x80, hi: 0x9d}, - {value: 0xb609, lo: 0x9e, hi: 0x9e}, - {value: 0xb651, lo: 0x9f, hi: 0x9f}, - {value: 0xb699, lo: 0xa0, hi: 0xa0}, - {value: 0xb701, lo: 0xa1, hi: 0xa1}, - {value: 0xb769, lo: 0xa2, hi: 0xa2}, - {value: 0xb7d1, lo: 0xa3, hi: 0xa3}, - {value: 0xb839, lo: 0xa4, hi: 0xa4}, + {value: 0x2211, lo: 0x9e, hi: 0x9e}, + {value: 0x2219, lo: 0x9f, hi: 0x9f}, + {value: 0x2221, lo: 0xa0, hi: 0xa0}, + {value: 0x2229, lo: 0xa1, hi: 0xa1}, + {value: 0x2231, lo: 0xa2, hi: 0xa2}, + {value: 0x2239, lo: 0xa3, hi: 0xa3}, + {value: 0x2241, lo: 0xa4, hi: 0xa4}, {value: 0x3018, lo: 0xa5, hi: 0xa6}, {value: 0x3318, lo: 0xa7, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xac}, {value: 0x3018, lo: 0xad, hi: 0xb2}, {value: 0x0340, lo: 0xb3, hi: 0xba}, {value: 0x3318, lo: 0xbb, hi: 0xbf}, - // Block 0xf3, offset 0x740 + // Block 0xf5, offset 0x74a {value: 0x0000, lo: 0x0b}, {value: 0x3318, lo: 0x80, hi: 0x82}, {value: 0x0018, lo: 0x83, hi: 0x84}, @@ -4504,45 +4659,45 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0x8c, hi: 0xa9}, {value: 0x3318, lo: 0xaa, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xba}, - {value: 0xb8a1, lo: 0xbb, hi: 0xbb}, - {value: 0xb8e9, lo: 0xbc, hi: 0xbc}, - {value: 0xb931, lo: 0xbd, hi: 0xbd}, - {value: 0xb999, lo: 0xbe, hi: 0xbe}, - {value: 0xba01, lo: 0xbf, hi: 0xbf}, - // Block 0xf4, offset 0x74c + {value: 0x2249, lo: 0xbb, hi: 0xbb}, + {value: 0x2251, lo: 0xbc, hi: 0xbc}, + {value: 0x2259, lo: 0xbd, hi: 0xbd}, + {value: 0x2261, lo: 0xbe, hi: 0xbe}, + {value: 0x2269, lo: 0xbf, hi: 0xbf}, + // Block 0xf6, offset 0x756 {value: 0x0000, lo: 0x03}, - {value: 0xba69, lo: 0x80, hi: 0x80}, + {value: 0x2271, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0xa8}, {value: 0x0040, lo: 0xa9, hi: 0xbf}, - // Block 0xf5, offset 0x750 + // Block 0xf7, offset 0x75a {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x81}, {value: 0x3318, lo: 0x82, hi: 0x84}, {value: 0x0018, lo: 0x85, hi: 0x85}, {value: 0x0040, lo: 0x86, hi: 0xbf}, - // Block 0xf6, offset 0x755 + // Block 0xf8, offset 0x75f {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xbf}, - // Block 0xf7, offset 0x759 + // Block 0xf9, offset 0x763 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xf8, offset 0x75e + // Block 0xfa, offset 0x768 {value: 0x0000, lo: 0x03}, {value: 0x3308, lo: 0x80, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xba}, {value: 0x3308, lo: 0xbb, hi: 0xbf}, - // Block 0xf9, offset 0x762 + // Block 0xfb, offset 0x76c {value: 0x0000, lo: 0x04}, {value: 0x3308, lo: 0x80, hi: 0xac}, {value: 0x0018, lo: 0xad, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb5}, {value: 0x0018, lo: 0xb6, hi: 0xbf}, - // Block 0xfa, offset 0x767 + // Block 0xfc, offset 0x771 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x83}, {value: 0x3308, lo: 0x84, hi: 0x84}, @@ -4552,7 +4707,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa0, hi: 0xa0}, {value: 0x3308, lo: 0xa1, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0xfb, offset 0x770 + // Block 0xfd, offset 0x77a {value: 0x0000, lo: 0x0a}, {value: 0x3308, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4564,35 +4719,35 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa5, hi: 0xa5}, {value: 0x3308, lo: 0xa6, hi: 0xaa}, {value: 0x0040, lo: 0xab, hi: 0xbf}, - // Block 0xfc, offset 0x77b + // Block 0xfe, offset 0x785 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xac}, {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb6}, {value: 0x0008, lo: 0xb7, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0xfd, offset 0x781 + // Block 0xff, offset 0x78b {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x0040, lo: 0x8a, hi: 0x8d}, {value: 0x0008, lo: 0x8e, hi: 0x8e}, {value: 0x0018, lo: 0x8f, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0xbf}, - // Block 0xfe, offset 0x787 + // Block 0x100, offset 0x791 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xab}, {value: 0x3308, lo: 0xac, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xff, offset 0x78d + // Block 0x101, offset 0x797 {value: 0x0000, lo: 0x05}, {value: 0x0808, lo: 0x80, hi: 0x84}, {value: 0x0040, lo: 0x85, hi: 0x86}, {value: 0x0818, lo: 0x87, hi: 0x8f}, {value: 0x3308, lo: 0x90, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0xbf}, - // Block 0x100, offset 0x793 + // Block 0x102, offset 0x79d {value: 0x0000, lo: 0x08}, {value: 0x0a08, lo: 0x80, hi: 0x83}, {value: 0x3308, lo: 0x84, hi: 0x8a}, @@ -4602,71 +4757,71 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9a, hi: 0x9d}, {value: 0x0818, lo: 0x9e, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0x101, offset 0x79c + // Block 0x103, offset 0x7a6 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0xb0}, {value: 0x0818, lo: 0xb1, hi: 0xbf}, - // Block 0x102, offset 0x79f + // Block 0x104, offset 0x7a9 {value: 0x0000, lo: 0x02}, {value: 0x0818, lo: 0x80, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0x103, offset 0x7a2 + // Block 0x105, offset 0x7ac {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0818, lo: 0x81, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0x104, offset 0x7a6 + // Block 0x106, offset 0x7b0 {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0x105, offset 0x7aa + // Block 0x107, offset 0x7b4 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbf}, - // Block 0x106, offset 0x7ae + // Block 0x108, offset 0x7b8 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x93}, {value: 0x0040, lo: 0x94, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xb0}, {value: 0x0018, lo: 0xb1, hi: 0xbf}, - // Block 0x107, offset 0x7b4 + // Block 0x109, offset 0x7be {value: 0x0000, lo: 0x05}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x90}, {value: 0x0018, lo: 0x91, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0x108, offset 0x7ba + // Block 0x10a, offset 0x7c4 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x8f}, - {value: 0xc229, lo: 0x90, hi: 0x90}, + {value: 0x2491, lo: 0x90, hi: 0x90}, {value: 0x0018, lo: 0x91, hi: 0xad}, {value: 0x0040, lo: 0xae, hi: 0xbf}, - // Block 0x109, offset 0x7bf + // Block 0x10b, offset 0x7c9 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0xa5}, {value: 0x0018, lo: 0xa6, hi: 0xbf}, - // Block 0x10a, offset 0x7c2 + // Block 0x10c, offset 0x7cc {value: 0x0000, lo: 0x0f}, - {value: 0xc851, lo: 0x80, hi: 0x80}, - {value: 0xc8a1, lo: 0x81, hi: 0x81}, - {value: 0xc8f1, lo: 0x82, hi: 0x82}, - {value: 0xc941, lo: 0x83, hi: 0x83}, - {value: 0xc991, lo: 0x84, hi: 0x84}, - {value: 0xc9e1, lo: 0x85, hi: 0x85}, - {value: 0xca31, lo: 0x86, hi: 0x86}, - {value: 0xca81, lo: 0x87, hi: 0x87}, - {value: 0xcad1, lo: 0x88, hi: 0x88}, + {value: 0x2611, lo: 0x80, hi: 0x80}, + {value: 0x2619, lo: 0x81, hi: 0x81}, + {value: 0x2621, lo: 0x82, hi: 0x82}, + {value: 0x2629, lo: 0x83, hi: 0x83}, + {value: 0x2631, lo: 0x84, hi: 0x84}, + {value: 0x2639, lo: 0x85, hi: 0x85}, + {value: 0x2641, lo: 0x86, hi: 0x86}, + {value: 0x2649, lo: 0x87, hi: 0x87}, + {value: 0x2651, lo: 0x88, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, - {value: 0xcb21, lo: 0x90, hi: 0x90}, - {value: 0xcb41, lo: 0x91, hi: 0x91}, + {value: 0x2659, lo: 0x90, hi: 0x90}, + {value: 0x2661, lo: 0x91, hi: 0x91}, {value: 0x0040, lo: 0x92, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa5}, {value: 0x0040, lo: 0xa6, hi: 0xbf}, - // Block 0x10b, offset 0x7d2 + // Block 0x10d, offset 0x7dc {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x97}, {value: 0x0040, lo: 0x98, hi: 0x9f}, @@ -4674,29 +4829,29 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x10c, offset 0x7d9 + // Block 0x10e, offset 0x7e3 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xbf}, - // Block 0x10d, offset 0x7dc + // Block 0x10f, offset 0x7e6 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x98}, {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xbf}, - // Block 0x10e, offset 0x7e1 + // Block 0x110, offset 0x7eb {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, - // Block 0x10f, offset 0x7e5 + // Block 0x111, offset 0x7ef {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xbf}, - // Block 0x110, offset 0x7eb + // Block 0x112, offset 0x7f5 {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8f}, @@ -4704,17 +4859,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0x111, offset 0x7f2 + // Block 0x113, offset 0x7fc {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xb9}, {value: 0x0018, lo: 0xba, hi: 0xbf}, - // Block 0x112, offset 0x7f6 + // Block 0x114, offset 0x800 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0xbf}, - // Block 0x113, offset 0x7fa + // Block 0x115, offset 0x804 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x93}, {value: 0x0040, lo: 0x94, hi: 0x9f}, @@ -4724,7 +4879,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xb5, hi: 0xb7}, {value: 0x0018, lo: 0xb8, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x114, offset 0x803 + // Block 0x116, offset 0x80d {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8f}, @@ -4732,109 +4887,74 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa9, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x115, offset 0x80a + // Block 0x117, offset 0x814 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x82}, {value: 0x0040, lo: 0x83, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0xbf}, - // Block 0x116, offset 0x80f + // Block 0x118, offset 0x819 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x92}, {value: 0x0040, lo: 0x93, hi: 0x93}, {value: 0x0018, lo: 0x94, hi: 0xbf}, - // Block 0x117, offset 0x813 + // Block 0x119, offset 0x81d {value: 0x0000, lo: 0x0d}, {value: 0x0018, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0xaf}, - {value: 0x1f41, lo: 0xb0, hi: 0xb0}, - {value: 0x00c9, lo: 0xb1, hi: 0xb1}, - {value: 0x0069, lo: 0xb2, hi: 0xb2}, - {value: 0x0079, lo: 0xb3, hi: 0xb3}, - {value: 0x1f51, lo: 0xb4, hi: 0xb4}, - {value: 0x1f61, lo: 0xb5, hi: 0xb5}, - {value: 0x1f71, lo: 0xb6, hi: 0xb6}, - {value: 0x1f81, lo: 0xb7, hi: 0xb7}, - {value: 0x1f91, lo: 0xb8, hi: 0xb8}, - {value: 0x1fa1, lo: 0xb9, hi: 0xb9}, + {value: 0x06e1, lo: 0xb0, hi: 0xb0}, + {value: 0x0049, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb2, hi: 0xb2}, + {value: 0x0031, lo: 0xb3, hi: 0xb3}, + {value: 0x06e9, lo: 0xb4, hi: 0xb4}, + {value: 0x06f1, lo: 0xb5, hi: 0xb5}, + {value: 0x06f9, lo: 0xb6, hi: 0xb6}, + {value: 0x0701, lo: 0xb7, hi: 0xb7}, + {value: 0x0709, lo: 0xb8, hi: 0xb8}, + {value: 0x0711, lo: 0xb9, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x118, offset 0x821 + // Block 0x11a, offset 0x82b {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0x119, offset 0x824 + // Block 0x11b, offset 0x82e {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0x11a, offset 0x827 + // Block 0x11c, offset 0x831 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x11b, offset 0x82b + // Block 0x11d, offset 0x835 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa1}, {value: 0x0040, lo: 0xa2, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x11c, offset 0x82f + // Block 0x11e, offset 0x839 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xa0}, {value: 0x0040, lo: 0xa1, hi: 0xbf}, - // Block 0x11d, offset 0x832 - {value: 0x0020, lo: 0x0f}, - {value: 0xdf21, lo: 0x80, hi: 0x89}, - {value: 0x8e35, lo: 0x8a, hi: 0x8a}, - {value: 0xe061, lo: 0x8b, hi: 0x9c}, - {value: 0x8e55, lo: 0x9d, hi: 0x9d}, - {value: 0xe2a1, lo: 0x9e, hi: 0xa2}, - {value: 0x8e75, lo: 0xa3, hi: 0xa3}, - {value: 0xe341, lo: 0xa4, hi: 0xab}, - {value: 0x7f0d, lo: 0xac, hi: 0xac}, - {value: 0xe441, lo: 0xad, hi: 0xaf}, - {value: 0x8e95, lo: 0xb0, hi: 0xb0}, - {value: 0xe4a1, lo: 0xb1, hi: 0xb6}, - {value: 0x8eb5, lo: 0xb7, hi: 0xb9}, - {value: 0xe561, lo: 0xba, hi: 0xba}, - {value: 0x8f15, lo: 0xbb, hi: 0xbb}, - {value: 0xe581, lo: 0xbc, hi: 0xbf}, - // Block 0x11e, offset 0x842 - {value: 0x0020, lo: 0x10}, - {value: 0x93b5, lo: 0x80, hi: 0x80}, - {value: 0xf101, lo: 0x81, hi: 0x86}, - {value: 0x93d5, lo: 0x87, hi: 0x8a}, - {value: 0xda61, lo: 0x8b, hi: 0x8b}, - {value: 0xf1c1, lo: 0x8c, hi: 0x96}, - {value: 0x9455, lo: 0x97, hi: 0x97}, - {value: 0xf321, lo: 0x98, hi: 0xa3}, - {value: 0x9475, lo: 0xa4, hi: 0xa6}, - {value: 0xf4a1, lo: 0xa7, hi: 0xaa}, - {value: 0x94d5, lo: 0xab, hi: 0xab}, - {value: 0xf521, lo: 0xac, hi: 0xac}, - {value: 0x94f5, lo: 0xad, hi: 0xad}, - {value: 0xf541, lo: 0xae, hi: 0xaf}, - {value: 0x9515, lo: 0xb0, hi: 0xb1}, - {value: 0xf581, lo: 0xb2, hi: 0xbe}, - {value: 0x2040, lo: 0xbf, hi: 0xbf}, - // Block 0x11f, offset 0x853 + // Block 0x11f, offset 0x83c {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0xbf}, - // Block 0x120, offset 0x856 + // Block 0x120, offset 0x83f {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0340, lo: 0x81, hi: 0x81}, {value: 0x0040, lo: 0x82, hi: 0x9f}, {value: 0x0340, lo: 0xa0, hi: 0xbf}, - // Block 0x121, offset 0x85b + // Block 0x121, offset 0x844 {value: 0x0000, lo: 0x01}, {value: 0x0340, lo: 0x80, hi: 0xbf}, - // Block 0x122, offset 0x85d + // Block 0x122, offset 0x846 {value: 0x0000, lo: 0x01}, {value: 0x33c0, lo: 0x80, hi: 0xbf}, - // Block 0x123, offset 0x85f + // Block 0x123, offset 0x848 {value: 0x0000, lo: 0x02}, {value: 0x33c0, lo: 0x80, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, } -// Total table size 43370 bytes (42KiB); checksum: EBD909C0 +// Total table size 44953 bytes (43KiB); checksum: D51909DD diff --git a/vendor/golang.org/x/net/idna/tables15.0.0.go b/vendor/golang.org/x/net/idna/tables15.0.0.go new file mode 100644 index 0000000000..40033778f0 --- /dev/null +++ b/vendor/golang.org/x/net/idna/tables15.0.0.go @@ -0,0 +1,5145 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package idna + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +var mappings string = "" + // Size: 6704 bytes + " ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक" + + "़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱ" + + "ཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳ" + + "ɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧ" + + "ιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?" + + "′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83" + + "⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12" + + ")(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)" + + "(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전" + + ")(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(" + + "財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)21222324252627282930313233343" + + "5참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパート" + + "アルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキロ" + + "グラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノ" + + "ノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポ" + + "イントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリ" + + "ラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20" + + "点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlk" + + "lfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhah" + + "pinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日1" + + "8日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմ" + + "խיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּו" + + "ֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئم" + + "ئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحط" + + "مظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمي" + + "نجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترت" + + "زتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيس" + + "ىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميح" + + "مىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمى" + + "فخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنم" + + "ينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمين" + + "حيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليه" + + "وسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\\$%@ـًـَـُـِـّـْءآ" + + "أؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا\x22'/^|~¢£¬¦¥ːˑʙɓʣꭦʥʤɖɗᶑɘɞʩɤɢ" + + "ɠʛʜɧʄʪʫꞎɮʎøɶɷɺɾʀʨʦꭧʧʈⱱʏʡʢʘǀǁǂ𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκ" + + "λμνξοστυψ∇∂ϝабгежзиклмпруфхцчшыэюꚉәіјөүӏґѕџҫꙑұٮڡٯ0,1,2,3,4,5,6,7,8,9,(a" + + ")(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y" + + ")(z)〔s〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申" + + "割営配〔本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉" + + "卑博即卽卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢" + + "㠯巽帨帽幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最" + + "暜肭䏙朗望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸" + + "瑇瑜瑱璅瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦" + + "若茝荣莭茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷" + + "䧦雃嶲霣䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻" + +var mappingIndex = []uint16{ // 1729 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0004, 0x0005, 0x0008, 0x0009, 0x000a, + 0x000d, 0x0010, 0x0011, 0x0012, 0x0017, 0x001c, 0x0021, 0x0024, + 0x0027, 0x002a, 0x002b, 0x002e, 0x0031, 0x0034, 0x0035, 0x0036, + 0x0037, 0x0038, 0x0039, 0x003c, 0x003f, 0x0042, 0x0045, 0x0048, + 0x004b, 0x004c, 0x004d, 0x0051, 0x0054, 0x0055, 0x005a, 0x005e, + 0x0062, 0x0066, 0x006a, 0x006e, 0x0074, 0x007a, 0x0080, 0x0086, + 0x008c, 0x0092, 0x0098, 0x009e, 0x00a4, 0x00aa, 0x00b0, 0x00b6, + 0x00bc, 0x00c2, 0x00c8, 0x00ce, 0x00d4, 0x00da, 0x00e0, 0x00e6, + // Entry 40 - 7F + 0x00ec, 0x00f2, 0x00f8, 0x00fe, 0x0104, 0x010a, 0x0110, 0x0116, + 0x011c, 0x0122, 0x0128, 0x012e, 0x0137, 0x013d, 0x0146, 0x014c, + 0x0152, 0x0158, 0x015e, 0x0164, 0x016a, 0x0170, 0x0172, 0x0174, + 0x0176, 0x0178, 0x017a, 0x017c, 0x017e, 0x0180, 0x0181, 0x0182, + 0x0183, 0x0185, 0x0186, 0x0187, 0x0188, 0x0189, 0x018a, 0x018c, + 0x018d, 0x018e, 0x018f, 0x0191, 0x0193, 0x0195, 0x0197, 0x0199, + 0x019b, 0x019d, 0x019f, 0x01a0, 0x01a2, 0x01a4, 0x01a6, 0x01a8, + 0x01aa, 0x01ac, 0x01ae, 0x01b0, 0x01b1, 0x01b3, 0x01b5, 0x01b6, + // Entry 80 - BF + 0x01b8, 0x01ba, 0x01bc, 0x01be, 0x01c0, 0x01c2, 0x01c4, 0x01c6, + 0x01c8, 0x01ca, 0x01cc, 0x01ce, 0x01d0, 0x01d2, 0x01d4, 0x01d6, + 0x01d8, 0x01da, 0x01dc, 0x01de, 0x01e0, 0x01e2, 0x01e4, 0x01e5, + 0x01e7, 0x01e9, 0x01eb, 0x01ed, 0x01ef, 0x01f1, 0x01f3, 0x01f5, + 0x01f7, 0x01f9, 0x01fb, 0x01fd, 0x0202, 0x0207, 0x020c, 0x0211, + 0x0216, 0x021b, 0x0220, 0x0225, 0x022a, 0x022f, 0x0234, 0x0239, + 0x023e, 0x0243, 0x0248, 0x024d, 0x0252, 0x0257, 0x025c, 0x0261, + 0x0266, 0x026b, 0x0270, 0x0275, 0x027a, 0x027e, 0x0282, 0x0287, + // Entry C0 - FF + 0x0289, 0x028e, 0x0293, 0x0297, 0x029b, 0x02a0, 0x02a5, 0x02aa, + 0x02af, 0x02b1, 0x02b6, 0x02bb, 0x02c0, 0x02c2, 0x02c7, 0x02c8, + 0x02cd, 0x02d1, 0x02d5, 0x02da, 0x02e0, 0x02e9, 0x02ef, 0x02f8, + 0x02fa, 0x02fc, 0x02fe, 0x0300, 0x030c, 0x030d, 0x030e, 0x030f, + 0x0310, 0x0311, 0x0312, 0x0313, 0x0314, 0x0315, 0x0316, 0x0317, + 0x0319, 0x031b, 0x031d, 0x031e, 0x0320, 0x0322, 0x0324, 0x0326, + 0x0328, 0x032a, 0x032c, 0x032e, 0x0330, 0x0335, 0x033a, 0x0340, + 0x0345, 0x034a, 0x034f, 0x0354, 0x0359, 0x035e, 0x0363, 0x0368, + // Entry 100 - 13F + 0x036d, 0x0372, 0x0377, 0x037c, 0x0380, 0x0382, 0x0384, 0x0386, + 0x038a, 0x038c, 0x038e, 0x0393, 0x0399, 0x03a2, 0x03a8, 0x03b1, + 0x03b3, 0x03b5, 0x03b7, 0x03b9, 0x03bb, 0x03bd, 0x03bf, 0x03c1, + 0x03c3, 0x03c5, 0x03c7, 0x03cb, 0x03cf, 0x03d3, 0x03d7, 0x03db, + 0x03df, 0x03e3, 0x03e7, 0x03eb, 0x03ef, 0x03f3, 0x03ff, 0x0401, + 0x0406, 0x0408, 0x040a, 0x040c, 0x040e, 0x040f, 0x0413, 0x0417, + 0x041d, 0x0423, 0x0428, 0x042d, 0x0432, 0x0437, 0x043c, 0x0441, + 0x0446, 0x044b, 0x0450, 0x0455, 0x045a, 0x045f, 0x0464, 0x0469, + // Entry 140 - 17F + 0x046e, 0x0473, 0x0478, 0x047d, 0x0482, 0x0487, 0x048c, 0x0491, + 0x0496, 0x049b, 0x04a0, 0x04a5, 0x04aa, 0x04af, 0x04b4, 0x04bc, + 0x04c4, 0x04c9, 0x04ce, 0x04d3, 0x04d8, 0x04dd, 0x04e2, 0x04e7, + 0x04ec, 0x04f1, 0x04f6, 0x04fb, 0x0500, 0x0505, 0x050a, 0x050f, + 0x0514, 0x0519, 0x051e, 0x0523, 0x0528, 0x052d, 0x0532, 0x0537, + 0x053c, 0x0541, 0x0546, 0x054b, 0x0550, 0x0555, 0x055a, 0x055f, + 0x0564, 0x0569, 0x056e, 0x0573, 0x0578, 0x057a, 0x057c, 0x057e, + 0x0580, 0x0582, 0x0584, 0x0586, 0x0588, 0x058a, 0x058c, 0x058e, + // Entry 180 - 1BF + 0x0590, 0x0592, 0x0594, 0x0596, 0x059c, 0x05a2, 0x05a4, 0x05a6, + 0x05a8, 0x05aa, 0x05ac, 0x05ae, 0x05b0, 0x05b2, 0x05b4, 0x05b6, + 0x05b8, 0x05ba, 0x05bc, 0x05be, 0x05c0, 0x05c4, 0x05c8, 0x05cc, + 0x05d0, 0x05d4, 0x05d8, 0x05dc, 0x05e0, 0x05e4, 0x05e9, 0x05ee, + 0x05f3, 0x05f5, 0x05f7, 0x05fd, 0x0609, 0x0615, 0x0621, 0x062a, + 0x0636, 0x063f, 0x0648, 0x0657, 0x0663, 0x066c, 0x0675, 0x067e, + 0x068a, 0x0696, 0x069f, 0x06a8, 0x06ae, 0x06b7, 0x06c3, 0x06cf, + 0x06d5, 0x06e4, 0x06f6, 0x0705, 0x070e, 0x071d, 0x072c, 0x0738, + // Entry 1C0 - 1FF + 0x0741, 0x074a, 0x0753, 0x075f, 0x076e, 0x077a, 0x0783, 0x078c, + 0x0795, 0x079b, 0x07a1, 0x07a7, 0x07ad, 0x07b6, 0x07bf, 0x07ce, + 0x07d7, 0x07e3, 0x07f2, 0x07fb, 0x0801, 0x0807, 0x0816, 0x0822, + 0x0831, 0x083a, 0x0849, 0x084f, 0x0858, 0x0861, 0x086a, 0x0873, + 0x087c, 0x0888, 0x0891, 0x0897, 0x08a0, 0x08a9, 0x08b2, 0x08be, + 0x08c7, 0x08d0, 0x08d9, 0x08e8, 0x08f4, 0x08fa, 0x0909, 0x090f, + 0x091b, 0x0927, 0x0930, 0x0939, 0x0942, 0x094e, 0x0954, 0x095d, + 0x0969, 0x096f, 0x097e, 0x0987, 0x098b, 0x098f, 0x0993, 0x0997, + // Entry 200 - 23F + 0x099b, 0x099f, 0x09a3, 0x09a7, 0x09ab, 0x09af, 0x09b4, 0x09b9, + 0x09be, 0x09c3, 0x09c8, 0x09cd, 0x09d2, 0x09d7, 0x09dc, 0x09e1, + 0x09e6, 0x09eb, 0x09f0, 0x09f5, 0x09fa, 0x09fc, 0x09fe, 0x0a00, + 0x0a02, 0x0a04, 0x0a06, 0x0a0c, 0x0a12, 0x0a18, 0x0a1e, 0x0a2a, + 0x0a2c, 0x0a2e, 0x0a30, 0x0a32, 0x0a34, 0x0a36, 0x0a38, 0x0a3c, + 0x0a3e, 0x0a40, 0x0a42, 0x0a44, 0x0a46, 0x0a48, 0x0a4a, 0x0a4c, + 0x0a4e, 0x0a50, 0x0a52, 0x0a54, 0x0a56, 0x0a58, 0x0a5a, 0x0a5f, + 0x0a65, 0x0a6c, 0x0a74, 0x0a76, 0x0a78, 0x0a7a, 0x0a7c, 0x0a7e, + // Entry 240 - 27F + 0x0a80, 0x0a82, 0x0a84, 0x0a86, 0x0a88, 0x0a8a, 0x0a8c, 0x0a8e, + 0x0a90, 0x0a96, 0x0a98, 0x0a9a, 0x0a9c, 0x0a9e, 0x0aa0, 0x0aa2, + 0x0aa4, 0x0aa6, 0x0aa8, 0x0aaa, 0x0aac, 0x0aae, 0x0ab0, 0x0ab2, + 0x0ab4, 0x0ab9, 0x0abe, 0x0ac2, 0x0ac6, 0x0aca, 0x0ace, 0x0ad2, + 0x0ad6, 0x0ada, 0x0ade, 0x0ae2, 0x0ae7, 0x0aec, 0x0af1, 0x0af6, + 0x0afb, 0x0b00, 0x0b05, 0x0b0a, 0x0b0f, 0x0b14, 0x0b19, 0x0b1e, + 0x0b23, 0x0b28, 0x0b2d, 0x0b32, 0x0b37, 0x0b3c, 0x0b41, 0x0b46, + 0x0b4b, 0x0b50, 0x0b52, 0x0b54, 0x0b56, 0x0b58, 0x0b5a, 0x0b5c, + // Entry 280 - 2BF + 0x0b5e, 0x0b62, 0x0b66, 0x0b6a, 0x0b6e, 0x0b72, 0x0b76, 0x0b7a, + 0x0b7c, 0x0b7e, 0x0b80, 0x0b82, 0x0b86, 0x0b8a, 0x0b8e, 0x0b92, + 0x0b96, 0x0b9a, 0x0b9e, 0x0ba0, 0x0ba2, 0x0ba4, 0x0ba6, 0x0ba8, + 0x0baa, 0x0bac, 0x0bb0, 0x0bb4, 0x0bba, 0x0bc0, 0x0bc4, 0x0bc8, + 0x0bcc, 0x0bd0, 0x0bd4, 0x0bd8, 0x0bdc, 0x0be0, 0x0be4, 0x0be8, + 0x0bec, 0x0bf0, 0x0bf4, 0x0bf8, 0x0bfc, 0x0c00, 0x0c04, 0x0c08, + 0x0c0c, 0x0c10, 0x0c14, 0x0c18, 0x0c1c, 0x0c20, 0x0c24, 0x0c28, + 0x0c2c, 0x0c30, 0x0c34, 0x0c36, 0x0c38, 0x0c3a, 0x0c3c, 0x0c3e, + // Entry 2C0 - 2FF + 0x0c40, 0x0c42, 0x0c44, 0x0c46, 0x0c48, 0x0c4a, 0x0c4c, 0x0c4e, + 0x0c50, 0x0c52, 0x0c54, 0x0c56, 0x0c58, 0x0c5a, 0x0c5c, 0x0c5e, + 0x0c60, 0x0c62, 0x0c64, 0x0c66, 0x0c68, 0x0c6a, 0x0c6c, 0x0c6e, + 0x0c70, 0x0c72, 0x0c74, 0x0c76, 0x0c78, 0x0c7a, 0x0c7c, 0x0c7e, + 0x0c80, 0x0c82, 0x0c86, 0x0c8a, 0x0c8e, 0x0c92, 0x0c96, 0x0c9a, + 0x0c9e, 0x0ca2, 0x0ca4, 0x0ca8, 0x0cac, 0x0cb0, 0x0cb4, 0x0cb8, + 0x0cbc, 0x0cc0, 0x0cc4, 0x0cc8, 0x0ccc, 0x0cd0, 0x0cd4, 0x0cd8, + 0x0cdc, 0x0ce0, 0x0ce4, 0x0ce8, 0x0cec, 0x0cf0, 0x0cf4, 0x0cf8, + // Entry 300 - 33F + 0x0cfc, 0x0d00, 0x0d04, 0x0d08, 0x0d0c, 0x0d10, 0x0d14, 0x0d18, + 0x0d1c, 0x0d20, 0x0d24, 0x0d28, 0x0d2c, 0x0d30, 0x0d34, 0x0d38, + 0x0d3c, 0x0d40, 0x0d44, 0x0d48, 0x0d4c, 0x0d50, 0x0d54, 0x0d58, + 0x0d5c, 0x0d60, 0x0d64, 0x0d68, 0x0d6c, 0x0d70, 0x0d74, 0x0d78, + 0x0d7c, 0x0d80, 0x0d84, 0x0d88, 0x0d8c, 0x0d90, 0x0d94, 0x0d98, + 0x0d9c, 0x0da0, 0x0da4, 0x0da8, 0x0dac, 0x0db0, 0x0db4, 0x0db8, + 0x0dbc, 0x0dc0, 0x0dc4, 0x0dc8, 0x0dcc, 0x0dd0, 0x0dd4, 0x0dd8, + 0x0ddc, 0x0de0, 0x0de4, 0x0de8, 0x0dec, 0x0df0, 0x0df4, 0x0df8, + // Entry 340 - 37F + 0x0dfc, 0x0e00, 0x0e04, 0x0e08, 0x0e0c, 0x0e10, 0x0e14, 0x0e18, + 0x0e1d, 0x0e22, 0x0e27, 0x0e2c, 0x0e31, 0x0e36, 0x0e3a, 0x0e3e, + 0x0e42, 0x0e46, 0x0e4a, 0x0e4e, 0x0e52, 0x0e56, 0x0e5a, 0x0e5e, + 0x0e62, 0x0e66, 0x0e6a, 0x0e6e, 0x0e72, 0x0e76, 0x0e7a, 0x0e7e, + 0x0e82, 0x0e86, 0x0e8a, 0x0e8e, 0x0e92, 0x0e96, 0x0e9a, 0x0e9e, + 0x0ea2, 0x0ea6, 0x0eaa, 0x0eae, 0x0eb2, 0x0eb6, 0x0ebc, 0x0ec2, + 0x0ec8, 0x0ecc, 0x0ed0, 0x0ed4, 0x0ed8, 0x0edc, 0x0ee0, 0x0ee4, + 0x0ee8, 0x0eec, 0x0ef0, 0x0ef4, 0x0ef8, 0x0efc, 0x0f00, 0x0f04, + // Entry 380 - 3BF + 0x0f08, 0x0f0c, 0x0f10, 0x0f14, 0x0f18, 0x0f1c, 0x0f20, 0x0f24, + 0x0f28, 0x0f2c, 0x0f30, 0x0f34, 0x0f38, 0x0f3e, 0x0f44, 0x0f4a, + 0x0f50, 0x0f56, 0x0f5c, 0x0f62, 0x0f68, 0x0f6e, 0x0f74, 0x0f7a, + 0x0f80, 0x0f86, 0x0f8c, 0x0f92, 0x0f98, 0x0f9e, 0x0fa4, 0x0faa, + 0x0fb0, 0x0fb6, 0x0fbc, 0x0fc2, 0x0fc8, 0x0fce, 0x0fd4, 0x0fda, + 0x0fe0, 0x0fe6, 0x0fec, 0x0ff2, 0x0ff8, 0x0ffe, 0x1004, 0x100a, + 0x1010, 0x1016, 0x101c, 0x1022, 0x1028, 0x102e, 0x1034, 0x103a, + 0x1040, 0x1046, 0x104c, 0x1052, 0x1058, 0x105e, 0x1064, 0x106a, + // Entry 3C0 - 3FF + 0x1070, 0x1076, 0x107c, 0x1082, 0x1088, 0x108e, 0x1094, 0x109a, + 0x10a0, 0x10a6, 0x10ac, 0x10b2, 0x10b8, 0x10be, 0x10c4, 0x10ca, + 0x10d0, 0x10d6, 0x10dc, 0x10e2, 0x10e8, 0x10ee, 0x10f4, 0x10fa, + 0x1100, 0x1106, 0x110c, 0x1112, 0x1118, 0x111e, 0x1124, 0x112a, + 0x1130, 0x1136, 0x113c, 0x1142, 0x1148, 0x114e, 0x1154, 0x115a, + 0x1160, 0x1166, 0x116c, 0x1172, 0x1178, 0x1180, 0x1188, 0x1190, + 0x1198, 0x11a0, 0x11a8, 0x11b0, 0x11b6, 0x11d7, 0x11e6, 0x11ee, + 0x11ef, 0x11f0, 0x11f1, 0x11f2, 0x11f3, 0x11f4, 0x11f5, 0x11f6, + // Entry 400 - 43F + 0x11f7, 0x11f8, 0x11f9, 0x11fa, 0x11fb, 0x11fc, 0x11fd, 0x11fe, + 0x11ff, 0x1200, 0x1201, 0x1205, 0x1209, 0x120d, 0x1211, 0x1215, + 0x1219, 0x121b, 0x121d, 0x121f, 0x1221, 0x1223, 0x1225, 0x1227, + 0x1229, 0x122b, 0x122d, 0x122f, 0x1231, 0x1233, 0x1235, 0x1237, + 0x1239, 0x123b, 0x123d, 0x123f, 0x1241, 0x1243, 0x1245, 0x1247, + 0x1249, 0x124b, 0x124d, 0x124f, 0x1251, 0x1253, 0x1255, 0x1257, + 0x1259, 0x125b, 0x125d, 0x125f, 0x1263, 0x1267, 0x126b, 0x126f, + 0x1270, 0x1271, 0x1272, 0x1273, 0x1274, 0x1275, 0x1277, 0x1279, + // Entry 440 - 47F + 0x127b, 0x127d, 0x127f, 0x1281, 0x1283, 0x1285, 0x1287, 0x1289, + 0x128c, 0x128e, 0x1290, 0x1292, 0x1294, 0x1297, 0x1299, 0x129b, + 0x129d, 0x129f, 0x12a1, 0x12a3, 0x12a5, 0x12a7, 0x12a9, 0x12ab, + 0x12ad, 0x12af, 0x12b2, 0x12b4, 0x12b6, 0x12b8, 0x12ba, 0x12bc, + 0x12be, 0x12c0, 0x12c2, 0x12c4, 0x12c6, 0x12c9, 0x12cb, 0x12cd, + 0x12d0, 0x12d2, 0x12d4, 0x12d6, 0x12d8, 0x12da, 0x12dc, 0x12de, + 0x12e6, 0x12ee, 0x12fa, 0x1306, 0x1312, 0x131e, 0x132a, 0x1332, + 0x133a, 0x1346, 0x1352, 0x135e, 0x136a, 0x136c, 0x136e, 0x1370, + // Entry 480 - 4BF + 0x1372, 0x1374, 0x1376, 0x1378, 0x137a, 0x137c, 0x137e, 0x1380, + 0x1382, 0x1384, 0x1386, 0x1388, 0x138a, 0x138d, 0x1390, 0x1392, + 0x1394, 0x1396, 0x1398, 0x139a, 0x139c, 0x139e, 0x13a0, 0x13a2, + 0x13a4, 0x13a6, 0x13a8, 0x13aa, 0x13ac, 0x13ae, 0x13b0, 0x13b2, + 0x13b4, 0x13b6, 0x13b8, 0x13ba, 0x13bc, 0x13bf, 0x13c1, 0x13c3, + 0x13c5, 0x13c7, 0x13c9, 0x13cb, 0x13cd, 0x13cf, 0x13d1, 0x13d3, + 0x13d6, 0x13d8, 0x13da, 0x13dc, 0x13de, 0x13e0, 0x13e2, 0x13e4, + 0x13e6, 0x13e8, 0x13ea, 0x13ec, 0x13ee, 0x13f0, 0x13f2, 0x13f5, + // Entry 4C0 - 4FF + 0x13f8, 0x13fb, 0x13fe, 0x1401, 0x1404, 0x1407, 0x140a, 0x140d, + 0x1410, 0x1413, 0x1416, 0x1419, 0x141c, 0x141f, 0x1422, 0x1425, + 0x1428, 0x142b, 0x142e, 0x1431, 0x1434, 0x1437, 0x143a, 0x143d, + 0x1440, 0x1447, 0x1449, 0x144b, 0x144d, 0x1450, 0x1452, 0x1454, + 0x1456, 0x1458, 0x145a, 0x1460, 0x1466, 0x1469, 0x146c, 0x146f, + 0x1472, 0x1475, 0x1478, 0x147b, 0x147e, 0x1481, 0x1484, 0x1487, + 0x148a, 0x148d, 0x1490, 0x1493, 0x1496, 0x1499, 0x149c, 0x149f, + 0x14a2, 0x14a5, 0x14a8, 0x14ab, 0x14ae, 0x14b1, 0x14b4, 0x14b7, + // Entry 500 - 53F + 0x14ba, 0x14bd, 0x14c0, 0x14c3, 0x14c6, 0x14c9, 0x14cc, 0x14cf, + 0x14d2, 0x14d5, 0x14d8, 0x14db, 0x14de, 0x14e1, 0x14e4, 0x14e7, + 0x14ea, 0x14ed, 0x14f6, 0x14ff, 0x1508, 0x1511, 0x151a, 0x1523, + 0x152c, 0x1535, 0x153e, 0x1541, 0x1544, 0x1547, 0x154a, 0x154d, + 0x1550, 0x1553, 0x1556, 0x1559, 0x155c, 0x155f, 0x1562, 0x1565, + 0x1568, 0x156b, 0x156e, 0x1571, 0x1574, 0x1577, 0x157a, 0x157d, + 0x1580, 0x1583, 0x1586, 0x1589, 0x158c, 0x158f, 0x1592, 0x1595, + 0x1598, 0x159b, 0x159e, 0x15a1, 0x15a4, 0x15a7, 0x15aa, 0x15ad, + // Entry 540 - 57F + 0x15b0, 0x15b3, 0x15b6, 0x15b9, 0x15bc, 0x15bf, 0x15c2, 0x15c5, + 0x15c8, 0x15cb, 0x15ce, 0x15d1, 0x15d4, 0x15d7, 0x15da, 0x15dd, + 0x15e0, 0x15e3, 0x15e6, 0x15e9, 0x15ec, 0x15ef, 0x15f2, 0x15f5, + 0x15f8, 0x15fb, 0x15fe, 0x1601, 0x1604, 0x1607, 0x160a, 0x160d, + 0x1610, 0x1613, 0x1616, 0x1619, 0x161c, 0x161f, 0x1622, 0x1625, + 0x1628, 0x162b, 0x162e, 0x1631, 0x1634, 0x1637, 0x163a, 0x163d, + 0x1640, 0x1643, 0x1646, 0x1649, 0x164c, 0x164f, 0x1652, 0x1655, + 0x1658, 0x165b, 0x165e, 0x1661, 0x1664, 0x1667, 0x166a, 0x166d, + // Entry 580 - 5BF + 0x1670, 0x1673, 0x1676, 0x1679, 0x167c, 0x167f, 0x1682, 0x1685, + 0x1688, 0x168b, 0x168e, 0x1691, 0x1694, 0x1697, 0x169a, 0x169d, + 0x16a0, 0x16a3, 0x16a6, 0x16a9, 0x16ac, 0x16af, 0x16b2, 0x16b5, + 0x16b8, 0x16bb, 0x16be, 0x16c1, 0x16c4, 0x16c7, 0x16ca, 0x16cd, + 0x16d0, 0x16d3, 0x16d6, 0x16d9, 0x16dc, 0x16df, 0x16e2, 0x16e5, + 0x16e8, 0x16eb, 0x16ee, 0x16f1, 0x16f4, 0x16f7, 0x16fa, 0x16fd, + 0x1700, 0x1703, 0x1706, 0x1709, 0x170c, 0x170f, 0x1712, 0x1715, + 0x1718, 0x171b, 0x171e, 0x1721, 0x1724, 0x1727, 0x172a, 0x172d, + // Entry 5C0 - 5FF + 0x1730, 0x1733, 0x1736, 0x1739, 0x173c, 0x173f, 0x1742, 0x1745, + 0x1748, 0x174b, 0x174e, 0x1751, 0x1754, 0x1757, 0x175a, 0x175d, + 0x1760, 0x1763, 0x1766, 0x1769, 0x176c, 0x176f, 0x1772, 0x1775, + 0x1778, 0x177b, 0x177e, 0x1781, 0x1784, 0x1787, 0x178a, 0x178d, + 0x1790, 0x1793, 0x1796, 0x1799, 0x179c, 0x179f, 0x17a2, 0x17a5, + 0x17a8, 0x17ab, 0x17ae, 0x17b1, 0x17b4, 0x17b7, 0x17ba, 0x17bd, + 0x17c0, 0x17c3, 0x17c6, 0x17c9, 0x17cc, 0x17cf, 0x17d2, 0x17d5, + 0x17d8, 0x17db, 0x17de, 0x17e1, 0x17e4, 0x17e7, 0x17ea, 0x17ed, + // Entry 600 - 63F + 0x17f0, 0x17f3, 0x17f6, 0x17f9, 0x17fc, 0x17ff, 0x1802, 0x1805, + 0x1808, 0x180b, 0x180e, 0x1811, 0x1814, 0x1817, 0x181a, 0x181d, + 0x1820, 0x1823, 0x1826, 0x1829, 0x182c, 0x182f, 0x1832, 0x1835, + 0x1838, 0x183b, 0x183e, 0x1841, 0x1844, 0x1847, 0x184a, 0x184d, + 0x1850, 0x1853, 0x1856, 0x1859, 0x185c, 0x185f, 0x1862, 0x1865, + 0x1868, 0x186b, 0x186e, 0x1871, 0x1874, 0x1877, 0x187a, 0x187d, + 0x1880, 0x1883, 0x1886, 0x1889, 0x188c, 0x188f, 0x1892, 0x1895, + 0x1898, 0x189b, 0x189e, 0x18a1, 0x18a4, 0x18a7, 0x18aa, 0x18ad, + // Entry 640 - 67F + 0x18b0, 0x18b3, 0x18b6, 0x18b9, 0x18bc, 0x18bf, 0x18c2, 0x18c5, + 0x18c8, 0x18cb, 0x18ce, 0x18d1, 0x18d4, 0x18d7, 0x18da, 0x18dd, + 0x18e0, 0x18e3, 0x18e6, 0x18e9, 0x18ec, 0x18ef, 0x18f2, 0x18f5, + 0x18f8, 0x18fb, 0x18fe, 0x1901, 0x1904, 0x1907, 0x190a, 0x190d, + 0x1910, 0x1913, 0x1916, 0x1919, 0x191c, 0x191f, 0x1922, 0x1925, + 0x1928, 0x192b, 0x192e, 0x1931, 0x1934, 0x1937, 0x193a, 0x193d, + 0x1940, 0x1943, 0x1946, 0x1949, 0x194c, 0x194f, 0x1952, 0x1955, + 0x1958, 0x195b, 0x195e, 0x1961, 0x1964, 0x1967, 0x196a, 0x196d, + // Entry 680 - 6BF + 0x1970, 0x1973, 0x1976, 0x1979, 0x197c, 0x197f, 0x1982, 0x1985, + 0x1988, 0x198b, 0x198e, 0x1991, 0x1994, 0x1997, 0x199a, 0x199d, + 0x19a0, 0x19a3, 0x19a6, 0x19a9, 0x19ac, 0x19af, 0x19b2, 0x19b5, + 0x19b8, 0x19bb, 0x19be, 0x19c1, 0x19c4, 0x19c7, 0x19ca, 0x19cd, + 0x19d0, 0x19d3, 0x19d6, 0x19d9, 0x19dc, 0x19df, 0x19e2, 0x19e5, + 0x19e8, 0x19eb, 0x19ee, 0x19f1, 0x19f4, 0x19f7, 0x19fa, 0x19fd, + 0x1a00, 0x1a03, 0x1a06, 0x1a09, 0x1a0c, 0x1a0f, 0x1a12, 0x1a15, + 0x1a18, 0x1a1b, 0x1a1e, 0x1a21, 0x1a24, 0x1a27, 0x1a2a, 0x1a2d, + // Entry 6C0 - 6FF + 0x1a30, +} // Size: 3482 bytes + +var xorData string = "" + // Size: 4907 bytes + "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + + "\x02\x0f\x1f\x02\x0f\x1d\x02\x01\x13\x02\x0f\x16\x02\x0f\x0b\x02\x0f3" + + "\x02\x0f7\x02\x0f?\x02\x0f/\x02\x0f*\x02\x0c&\x02\x0c*\x02\x0c;\x02\x0c9" + + "\x02\x0c%\x02\xab\xed\x02\xab\xe2\x02\xab\xe3\x02\xa9\xe0\x02\xa9\xe1" + + "\x02\xa9\xe6\x02\xa3\xcb\x02\xa3\xc8\x02\xa3\xc9\x02\x01#\x02\x01\x08" + + "\x02\x0e>\x02\x0e'\x02\x0f\x03\x02\x03\x0d\x02\x03\x09\x02\x03\x17\x02" + + "\x03\x0e\x02\x02\x03\x02\x011\x02\x01\x00\x02\x01\x10\x02\x03<\x02\x07" + + "\x0d\x02\x02\x0c\x02\x0c0\x02\x01\x03\x02\x01\x01\x02\x01 \x02\x01\x22" + + "\x02\x01)\x02\x01\x0a\x02\x01\x0c\x02\x02\x06\x02\x02\x02\x02\x03\x10" + + "\x03\x037 \x03\x0b+\x03\x021\x00\x02\x01\x04\x02\x01\x02\x02\x019\x02" + + "\x03\x1c\x02\x02$\x03\x80p$\x02\x03:\x02\x03\x0a\x03\xc1r.\x03\xc1r,\x03" + + "\xc1r\x02\x02\x02:\x02\x02>\x02\x02,\x02\x02\x10\x02\x02\x00\x03\xc1s<" + + "\x03\xc1s*\x03\xc2L$\x03\xc2L;\x02\x09)\x02\x0a\x19\x03\x83\xab\xe3\x03" + + "\x83\xab\xf2\x03 4\xe0\x03\x81\xab\xea\x03\x81\xab\xf3\x03 4\xef\x03\x96" + + "\xe1\xcd\x03\x84\xe5\xc3\x02\x0d\x11\x03\x8b\xec\xcb\x03\x94\xec\xcf\x03" + + "\x9a\xec\xc2\x03\x8b\xec\xdb\x03\x94\xec\xdf\x03\x9a\xec\xd2\x03\x01\x0c" + + "!\x03\x01\x0c#\x03ʠ\x9d\x03ʣ\x9c\x03ʢ\x9f\x03ʥ\x9e\x03ʤ\x91\x03ʧ\x90\x03" + + "ʦ\x93\x03ʩ\x92\x03ʨ\x95\x03\xca\xf3\xb5\x03\xca\xf0\xb4\x03\xca\xf1\xb7" + + "\x03\xca\xf6\xb6\x03\xca\xf7\x89\x03\xca\xf4\x88\x03\xca\xf5\x8b\x03\xca" + + "\xfa\x8a\x03\xca\xfb\x8d\x03\xca\xf8\x8c\x03\xca\xf9\x8f\x03\xca\xfe\x8e" + + "\x03\xca\xff\x81\x03\xca\xfc\x80\x03\xca\xfd\x83\x03\xca\xe2\x82\x03\xca" + + "\xe3\x85\x03\xca\xe0\x84\x03\xca\xe1\x87\x03\xca\xe6\x86\x03\xca\xe7\x99" + + "\x03\xca\xe4\x98\x03\xca\xe5\x9b\x03\xca\xea\x9a\x03\xca\xeb\x9d\x03\xca" + + "\xe8\x9c\x03ؓ\x89\x03ߔ\x8b\x02\x010\x03\x03\x04\x1e\x03\x04\x15\x12\x03" + + "\x0b\x05,\x03\x06\x04\x00\x03\x06\x04)\x03\x06\x044\x03\x06\x04<\x03\x06" + + "\x05\x1d\x03\x06\x06\x00\x03\x06\x06\x0a\x03\x06\x06'\x03\x06\x062\x03" + + "\x0786\x03\x079/\x03\x079 \x03\x07:\x0e\x03\x07:\x1b\x03\x07:%\x03\x07;/" + + "\x03\x07;%\x03\x074\x11\x03\x076\x09\x03\x077*\x03\x070\x01\x03\x070\x0f" + + "\x03\x070.\x03\x071\x16\x03\x071\x04\x03\x0710\x03\x072\x18\x03\x072-" + + "\x03\x073\x14\x03\x073>\x03\x07'\x09\x03\x07 \x00\x03\x07\x1f\x0b\x03" + + "\x07\x18#\x03\x07\x18(\x03\x07\x186\x03\x07\x18\x03\x03\x07\x19\x16\x03" + + "\x07\x116\x03\x07\x12'\x03\x07\x13\x10\x03\x07\x0c&\x03\x07\x0c\x08\x03" + + "\x07\x0c\x13\x03\x07\x0d\x02\x03\x07\x0d\x1c\x03\x07\x0b5\x03\x07\x0b" + + "\x0a\x03\x07\x0b\x01\x03\x07\x0b\x0f\x03\x07\x05\x00\x03\x07\x05\x09\x03" + + "\x07\x05\x0b\x03\x07\x07\x01\x03\x07\x07\x08\x03\x07\x00<\x03\x07\x00+" + + "\x03\x07\x01)\x03\x07\x01\x1b\x03\x07\x01\x08\x03\x07\x03?\x03\x0445\x03" + + "\x044\x08\x03\x0454\x03\x04)/\x03\x04)5\x03\x04+\x05\x03\x04+\x14\x03" + + "\x04+ \x03\x04+<\x03\x04*&\x03\x04*\x22\x03\x04&8\x03\x04!\x01\x03\x04!" + + "\x22\x03\x04\x11+\x03\x04\x10.\x03\x04\x104\x03\x04\x13=\x03\x04\x12\x04" + + "\x03\x04\x12\x0a\x03\x04\x0d\x1d\x03\x04\x0d\x07\x03\x04\x0d \x03\x05<>" + + "\x03\x055<\x03\x055!\x03\x055#\x03\x055&\x03\x054\x1d\x03\x054\x02\x03" + + "\x054\x07\x03\x0571\x03\x053\x1a\x03\x053\x16\x03\x05.<\x03\x05.\x07\x03" + + "\x05):\x03\x05)<\x03\x05)\x0c\x03\x05)\x15\x03\x05+-\x03\x05+5\x03\x05$" + + "\x1e\x03\x05$\x14\x03\x05'\x04\x03\x05'\x14\x03\x05&\x02\x03\x05\x226" + + "\x03\x05\x22\x0c\x03\x05\x22\x1c\x03\x05\x19\x0a\x03\x05\x1b\x09\x03\x05" + + "\x1b\x0c\x03\x05\x14\x07\x03\x05\x16?\x03\x05\x16\x0c\x03\x05\x0c\x05" + + "\x03\x05\x0e\x0f\x03\x05\x01\x0e\x03\x05\x00(\x03\x05\x030\x03\x05\x03" + + "\x06\x03\x0a==\x03\x0a=1\x03\x0a=,\x03\x0a=\x0c\x03\x0a??\x03\x0a<\x08" + + "\x03\x0a9!\x03\x0a9)\x03\x0a97\x03\x0a99\x03\x0a6\x0a\x03\x0a6\x1c\x03" + + "\x0a6\x17\x03\x0a7'\x03\x0a78\x03\x0a73\x03\x0a'\x01\x03\x0a'&\x03\x0a" + + "\x1f\x0e\x03\x0a\x1f\x03\x03\x0a\x1f3\x03\x0a\x1b/\x03\x0a\x18\x19\x03" + + "\x0a\x19\x01\x03\x0a\x16\x14\x03\x0a\x0e\x22\x03\x0a\x0f\x10\x03\x0a\x0f" + + "\x02\x03\x0a\x0f \x03\x0a\x0c\x04\x03\x0a\x0b>\x03\x0a\x0b+\x03\x0a\x08/" + + "\x03\x0a\x046\x03\x0a\x05\x14\x03\x0a\x00\x04\x03\x0a\x00\x10\x03\x0a" + + "\x00\x14\x03\x0b<3\x03\x0b;*\x03\x0b9\x22\x03\x0b9)\x03\x0b97\x03\x0b+" + + "\x10\x03\x0b((\x03\x0b&5\x03\x0b$\x1c\x03\x0b$\x12\x03\x0b%\x04\x03\x0b#" + + "<\x03\x0b#0\x03\x0b#\x0d\x03\x0b#\x19\x03\x0b!:\x03\x0b!\x1f\x03\x0b!" + + "\x00\x03\x0b\x1e5\x03\x0b\x1c\x1d\x03\x0b\x1d-\x03\x0b\x1d(\x03\x0b\x18." + + "\x03\x0b\x18 \x03\x0b\x18\x16\x03\x0b\x14\x13\x03\x0b\x15$\x03\x0b\x15" + + "\x22\x03\x0b\x12\x1b\x03\x0b\x12\x10\x03\x0b\x132\x03\x0b\x13=\x03\x0b" + + "\x12\x18\x03\x0b\x0c&\x03\x0b\x061\x03\x0b\x06:\x03\x0b\x05#\x03\x0b\x05" + + "<\x03\x0b\x04\x0b\x03\x0b\x04\x04\x03\x0b\x04\x1b\x03\x0b\x042\x03\x0b" + + "\x041\x03\x0b\x03\x03\x03\x0b\x03\x1d\x03\x0b\x03/\x03\x0b\x03+\x03\x0b" + + "\x02\x1b\x03\x0b\x02\x00\x03\x0b\x01\x1e\x03\x0b\x01\x08\x03\x0b\x015" + + "\x03\x06\x0d9\x03\x06\x0d=\x03\x06\x0d?\x03\x02\x001\x03\x02\x003\x03" + + "\x02\x02\x19\x03\x02\x006\x03\x02\x02\x1b\x03\x02\x004\x03\x02\x00<\x03" + + "\x02\x02\x0a\x03\x02\x02\x0e\x03\x02\x01\x1a\x03\x02\x01\x07\x03\x02\x01" + + "\x05\x03\x02\x01\x0b\x03\x02\x01%\x03\x02\x01\x0c\x03\x02\x01\x04\x03" + + "\x02\x01\x1c\x03\x02\x00.\x03\x02\x002\x03\x02\x00>\x03\x02\x00\x12\x03" + + "\x02\x00\x16\x03\x02\x011\x03\x02\x013\x03\x02\x02 \x03\x02\x02%\x03\x02" + + "\x02$\x03\x02\x028\x03\x02\x02;\x03\x02\x024\x03\x02\x012\x03\x02\x022" + + "\x03\x02\x02/\x03\x02\x01,\x03\x02\x01\x13\x03\x02\x01\x16\x03\x02\x01" + + "\x11\x03\x02\x01\x1e\x03\x02\x01\x15\x03\x02\x01\x17\x03\x02\x01\x0f\x03" + + "\x02\x01\x08\x03\x02\x00?\x03\x02\x03\x07\x03\x02\x03\x0d\x03\x02\x03" + + "\x13\x03\x02\x03\x1d\x03\x02\x03\x1f\x03\x02\x00\x03\x03\x02\x00\x0d\x03" + + "\x02\x00\x01\x03\x02\x00\x1b\x03\x02\x00\x19\x03\x02\x00\x18\x03\x02\x00" + + "\x13\x03\x02\x00/\x03\x07>\x12\x03\x07<\x1f\x03\x07>\x1d\x03\x06\x1d\x0e" + + "\x03\x07>\x1c\x03\x07>:\x03\x07>\x13\x03\x04\x12+\x03\x07?\x03\x03\x07>" + + "\x02\x03\x06\x224\x03\x06\x1a.\x03\x07<%\x03\x06\x1c\x0b\x03\x0609\x03" + + "\x05\x1f\x01\x03\x04'\x08\x03\x93\xfd\xf5\x03\x02\x0d \x03\x02\x0d#\x03" + + "\x02\x0d!\x03\x02\x0d&\x03\x02\x0d\x22\x03\x02\x0d/\x03\x02\x0d,\x03\x02" + + "\x0d$\x03\x02\x0d'\x03\x02\x0d%\x03\x02\x0d;\x03\x02\x0d=\x03\x02\x0d?" + + "\x03\x099.\x03\x08\x0b7\x03\x08\x02\x14\x03\x08\x14\x0d\x03\x08.:\x03" + + "\x089'\x03\x0f\x0b\x18\x03\x0f\x1c1\x03\x0f\x17&\x03\x0f9\x1f\x03\x0f0" + + "\x0c\x03\x0e\x0a9\x03\x0e\x056\x03\x0e\x1c#\x03\x0f\x13\x0e\x03\x072\x00" + + "\x03\x070\x0d\x03\x072\x0b\x03\x06\x11\x18\x03\x070\x10\x03\x06\x0f(\x03" + + "\x072\x05\x03\x06\x0f,\x03\x073\x15\x03\x06\x07\x08\x03\x05\x16\x02\x03" + + "\x04\x0b \x03\x05:8\x03\x05\x16%\x03\x0a\x0d\x1f\x03\x06\x16\x10\x03\x05" + + "\x1d5\x03\x05*;\x03\x05\x16\x1b\x03\x04.-\x03\x06\x1a\x19\x03\x04\x03," + + "\x03\x0b87\x03\x04/\x0a\x03\x06\x00,\x03\x04-\x01\x03\x04\x1e-\x03\x06/(" + + "\x03\x0a\x0b5\x03\x06\x0e7\x03\x06\x07.\x03\x0597\x03\x0a*%\x03\x0760" + + "\x03\x06\x0c;\x03\x05'\x00\x03\x072.\x03\x072\x08\x03\x06=\x01\x03\x06" + + "\x05\x1b\x03\x06\x06\x12\x03\x06$=\x03\x06'\x0d\x03\x04\x11\x0f\x03\x076" + + ",\x03\x06\x07;\x03\x06.,\x03\x86\xf9\xea\x03\x8f\xff\xeb\x02\x092\x02" + + "\x095\x02\x094\x02\x09;\x02\x09>\x02\x098\x02\x09*\x02\x09/\x02\x09,\x02" + + "\x09%\x02\x09&\x02\x09#\x02\x09 \x02\x08!\x02\x08%\x02\x08$\x02\x08+\x02" + + "\x08.\x02\x08*\x02\x08&\x02\x088\x02\x08>\x02\x084\x02\x086\x02\x080\x02" + + "\x08\x10\x02\x08\x17\x02\x08\x12\x02\x08\x1d\x02\x08\x1f\x02\x08\x13\x02" + + "\x08\x15\x02\x08\x14\x02\x08\x0c\x03\x8b\xfd\xd0\x03\x81\xec\xc6\x03\x87" + + "\xe0\x8a\x03-2\xe3\x03\x80\xef\xe4\x03-2\xea\x03\x88\xe6\xeb\x03\x8e\xe6" + + "\xe8\x03\x84\xe6\xe9\x03\x97\xe6\xee\x03-2\xf9\x03-2\xf6\x03\x8e\xe3\xad" + + "\x03\x80\xe3\x92\x03\x88\xe3\x90\x03\x8e\xe3\x90\x03\x80\xe3\x97\x03\x88" + + "\xe3\x95\x03\x88\xfe\xcb\x03\x8e\xfe\xca\x03\x84\xfe\xcd\x03\x91\xef\xc9" + + "\x03-2\xc1\x03-2\xc0\x03-2\xcb\x03\x88@\x09\x03\x8e@\x08\x03\x8f\xe0\xf5" + + "\x03\x8e\xe6\xf9\x03\x8e\xe0\xfa\x03\x93\xff\xf4\x03\x84\xee\xd3\x03\x0b" + + "(\x04\x023 \x03\x0b)\x08\x021;\x02\x01*\x03\x0b#\x10\x03\x0b 0\x03\x0b!" + + "\x10\x03\x0b!0\x03\x07\x15\x08\x03\x09?5\x03\x07\x1f\x08\x03\x07\x17\x0b" + + "\x03\x09\x1f\x15\x03\x0b\x1c7\x03\x0a+#\x03\x06\x1a\x1b\x03\x06\x1a\x14" + + "\x03\x0a\x01\x18\x03\x06#\x1b\x03\x0a2\x0c\x03\x0a\x01\x04\x03\x09#;\x03" + + "\x08='\x03\x08\x1a\x0a\x03\x07\x03\x0a\x111\x03\x09\x1b\x09\x03\x073.\x03\x07" + + "\x01\x00\x03\x09/,\x03\x07#>\x03\x07\x048\x03\x0a\x1f\x22\x03\x098>\x03" + + "\x09\x11\x00\x03\x08/\x17\x03\x06'\x22\x03\x0b\x1a+\x03\x0a\x22\x19\x03" + + "\x0a/1\x03\x0974\x03\x09\x0f\x22\x03\x08,\x22\x03\x08?\x14\x03\x07$5\x03" + + "\x07<3\x03\x07=*\x03\x07\x13\x18\x03\x068\x0a\x03\x06\x09\x16\x03\x06" + + "\x13\x00\x03\x08\x067\x03\x08\x01\x03\x03\x08\x12\x1d\x03\x07+7\x03\x06(" + + ";\x03\x06\x1c?\x03\x07\x0e\x17\x03\x0a\x06\x1d\x03\x0a\x19\x07\x03\x08" + + "\x14$\x03\x07$;\x03\x08,$\x03\x08\x06\x0d\x03\x07\x16\x0a\x03\x06>>\x03" + + "\x0a\x06\x12\x03\x0a\x14)\x03\x09\x0d\x1f\x03\x09\x12\x17\x03\x09\x19" + + "\x01\x03\x08\x11 \x03\x08\x1d'\x03\x06<\x1a\x03\x0a.\x00\x03\x07'\x18" + + "\x03\x0a\x22\x08\x03\x08\x0d\x0a\x03\x08\x13)\x03\x07*)\x03\x06<,\x03" + + "\x07\x0b\x1a\x03\x09.\x14\x03\x09\x0d\x1e\x03\x07\x0e#\x03\x0b\x1d'\x03" + + "\x0a\x0a8\x03\x09%2\x03\x08+&\x03\x080\x12\x03\x0a)4\x03\x08\x06\x1f\x03" + + "\x0b\x1b\x1a\x03\x0a\x1b\x0f\x03\x0b\x1d*\x03\x09\x16$\x03\x090\x11\x03" + + "\x08\x11\x08\x03\x0a*(\x03\x0a\x042\x03\x089,\x03\x074'\x03\x07\x0f\x05" + + "\x03\x09\x0b\x0a\x03\x07\x1b\x01\x03\x09\x17:\x03\x09.\x0d\x03\x07.\x11" + + "\x03\x09+\x15\x03\x080\x13\x03\x0b\x1f\x19\x03\x0a \x11\x03\x0a\x220\x03" + + "\x09\x07;\x03\x08\x16\x1c\x03\x07,\x13\x03\x07\x0e/\x03\x06\x221\x03\x0a" + + ".\x0a\x03\x0a7\x02\x03\x0a\x032\x03\x0a\x1d.\x03\x091\x06\x03\x09\x19:" + + "\x03\x08\x02/\x03\x060+\x03\x06\x0f-\x03\x06\x1c\x1f\x03\x06\x1d\x07\x03" + + "\x0a,\x11\x03\x09=\x0d\x03\x09\x0b;\x03\x07\x1b/\x03\x0a\x1f:\x03\x09 " + + "\x1f\x03\x09.\x10\x03\x094\x0b\x03\x09\x1a1\x03\x08#\x1a\x03\x084\x1d" + + "\x03\x08\x01\x1f\x03\x08\x11\x22\x03\x07'8\x03\x07\x1a>\x03\x0757\x03" + + "\x06&9\x03\x06+\x11\x03\x0a.\x0b\x03\x0a,>\x03\x0a4#\x03\x08%\x17\x03" + + "\x07\x05\x22\x03\x07\x0c\x0b\x03\x0a\x1d+\x03\x0a\x19\x16\x03\x09+\x1f" + + "\x03\x09\x08\x0b\x03\x08\x16\x18\x03\x08+\x12\x03\x0b\x1d\x0c\x03\x0a=" + + "\x10\x03\x0a\x09\x0d\x03\x0a\x10\x11\x03\x09&0\x03\x08(\x1f\x03\x087\x07" + + "\x03\x08\x185\x03\x07'6\x03\x06.\x05\x03\x06=\x04\x03\x06;;\x03\x06\x06," + + "\x03\x0b\x18>\x03\x08\x00\x18\x03\x06 \x03\x03\x06<\x00\x03\x09%\x18\x03" + + "\x0b\x1c<\x03\x0a%!\x03\x0a\x09\x12\x03\x0a\x16\x02\x03\x090'\x03\x09" + + "\x0e=\x03\x08 \x0e\x03\x08>\x03\x03\x074>\x03\x06&?\x03\x06\x19\x09\x03" + + "\x06?(\x03\x0a-\x0e\x03\x09:3\x03\x098:\x03\x09\x12\x0b\x03\x09\x1d\x17" + + "\x03\x087\x05\x03\x082\x14\x03\x08\x06%\x03\x08\x13\x1f\x03\x06\x06\x0e" + + "\x03\x0a\x22<\x03\x09/<\x03\x06>+\x03\x0a'?\x03\x0a\x13\x0c\x03\x09\x10<" + + "\x03\x07\x1b=\x03\x0a\x19\x13\x03\x09\x22\x1d\x03\x09\x07\x0d\x03\x08)" + + "\x1c\x03\x06=\x1a\x03\x0a/4\x03\x0a7\x11\x03\x0a\x16:\x03\x09?3\x03\x09:" + + "/\x03\x09\x05\x0a\x03\x09\x14\x06\x03\x087\x22\x03\x080\x07\x03\x08\x1a" + + "\x1f\x03\x07\x04(\x03\x07\x04\x09\x03\x06 %\x03\x06<\x08\x03\x0a+\x14" + + "\x03\x09\x1d\x16\x03\x0a70\x03\x08 >\x03\x0857\x03\x070\x0a\x03\x06=\x12" + + "\x03\x06\x16%\x03\x06\x1d,\x03\x099#\x03\x09\x10>\x03\x07 \x1e\x03\x08" + + "\x0c<\x03\x08\x0b\x18\x03\x08\x15+\x03\x08,:\x03\x08%\x22\x03\x07\x0a$" + + "\x03\x0b\x1c=\x03\x07+\x08\x03\x0a/\x05\x03\x0a \x07\x03\x0a\x12'\x03" + + "\x09#\x11\x03\x08\x1b\x15\x03\x0a\x06\x01\x03\x09\x1c\x1b\x03\x0922\x03" + + "\x07\x14<\x03\x07\x09\x04\x03\x061\x04\x03\x07\x0e\x01\x03\x0a\x13\x18" + + "\x03\x0a-\x0c\x03\x0a?\x0d\x03\x0a\x09\x0a\x03\x091&\x03\x0a/\x0b\x03" + + "\x08$<\x03\x083\x1d\x03\x08\x0c$\x03\x08\x0d\x07\x03\x08\x0d?\x03\x08" + + "\x0e\x14\x03\x065\x0a\x03\x08\x1a#\x03\x08\x16#\x03\x0702\x03\x07\x03" + + "\x1a\x03\x06(\x1d\x03\x06+\x1b\x03\x06\x0b\x05\x03\x06\x0b\x17\x03\x06" + + "\x0c\x04\x03\x06\x1e\x19\x03\x06+0\x03\x062\x18\x03\x0b\x16\x1e\x03\x0a+" + + "\x16\x03\x0a-?\x03\x0a#:\x03\x0a#\x10\x03\x0a%$\x03\x0a>+\x03\x0a01\x03" + + "\x0a1\x10\x03\x0a\x099\x03\x0a\x0a\x12\x03\x0a\x19\x1f\x03\x0a\x19\x12" + + "\x03\x09*)\x03\x09-\x16\x03\x09.1\x03\x09.2\x03\x09<\x0e\x03\x09> \x03" + + "\x093\x12\x03\x09\x0b\x01\x03\x09\x1c2\x03\x09\x11\x1c\x03\x09\x15%\x03" + + "\x08,&\x03\x08!\x22\x03\x089(\x03\x08\x0b\x1a\x03\x08\x0d2\x03\x08\x0c" + + "\x04\x03\x08\x0c\x06\x03\x08\x0c\x1f\x03\x08\x0c\x0c\x03\x08\x0f\x1f\x03" + + "\x08\x0f\x1d\x03\x08\x00\x14\x03\x08\x03\x14\x03\x08\x06\x16\x03\x08\x1e" + + "#\x03\x08\x11\x11\x03\x08\x10\x18\x03\x08\x14(\x03\x07)\x1e\x03\x07.1" + + "\x03\x07 $\x03\x07 '\x03\x078\x08\x03\x07\x0d0\x03\x07\x0f7\x03\x07\x05#" + + "\x03\x07\x05\x1a\x03\x07\x1a7\x03\x07\x1d-\x03\x07\x17\x10\x03\x06)\x1f" + + "\x03\x062\x0b\x03\x066\x16\x03\x06\x09\x11\x03\x09(\x1e\x03\x07!5\x03" + + "\x0b\x11\x16\x03\x0a/\x04\x03\x0a,\x1a\x03\x0b\x173\x03\x0a,1\x03\x0a/5" + + "\x03\x0a\x221\x03\x0a\x22\x0d\x03\x0a?%\x03\x0a<,\x03\x0a?#\x03\x0a>\x19" + + "\x03\x0a\x08&\x03\x0a\x0b\x0e\x03\x0a\x0c:\x03\x0a\x0c+\x03\x0a\x03\x22" + + "\x03\x0a\x06)\x03\x0a\x11\x10\x03\x0a\x11\x1a\x03\x0a\x17-\x03\x0a\x14(" + + "\x03\x09)\x1e\x03\x09/\x09\x03\x09.\x00\x03\x09,\x07\x03\x09/*\x03\x09-9" + + "\x03\x09\x228\x03\x09%\x09\x03\x09:\x12\x03\x09;\x1d\x03\x09?\x06\x03" + + "\x093%\x03\x096\x05\x03\x096\x08\x03\x097\x02\x03\x09\x07,\x03\x09\x04," + + "\x03\x09\x1f\x16\x03\x09\x11\x03\x03\x09\x11\x12\x03\x09\x168\x03\x08*" + + "\x05\x03\x08/2\x03\x084:\x03\x08\x22+\x03\x08 0\x03\x08&\x0a\x03\x08;" + + "\x10\x03\x08>$\x03\x08>\x18\x03\x0829\x03\x082:\x03\x081,\x03\x081<\x03" + + "\x081\x1c\x03\x087#\x03\x087*\x03\x08\x09'\x03\x08\x00\x1d\x03\x08\x05-" + + "\x03\x08\x1f4\x03\x08\x1d\x04\x03\x08\x16\x0f\x03\x07*7\x03\x07'!\x03" + + "\x07%\x1b\x03\x077\x0c\x03\x07\x0c1\x03\x07\x0c.\x03\x07\x00\x06\x03\x07" + + "\x01\x02\x03\x07\x010\x03\x07\x06=\x03\x07\x01\x03\x03\x07\x01\x13\x03" + + "\x07\x06\x06\x03\x07\x05\x0a\x03\x07\x1f\x09\x03\x07\x17:\x03\x06*1\x03" + + "\x06-\x1d\x03\x06\x223\x03\x062:\x03\x060$\x03\x066\x1e\x03\x064\x12\x03" + + "\x0645\x03\x06\x0b\x00\x03\x06\x0b7\x03\x06\x07\x1f\x03\x06\x15\x12\x03" + + "\x0c\x05\x0f\x03\x0b+\x0b\x03\x0b+-\x03\x06\x16\x1b\x03\x06\x15\x17\x03" + + "\x89\xca\xea\x03\x89\xca\xe8\x03\x0c8\x10\x03\x0c8\x01\x03\x0c8\x0f\x03" + + "\x0d8%\x03\x0d8!\x03\x0c8-\x03\x0c8/\x03\x0c8+\x03\x0c87\x03\x0c85\x03" + + "\x0c9\x09\x03\x0c9\x0d\x03\x0c9\x0f\x03\x0c9\x0b\x03\xcfu\x0c\x03\xcfu" + + "\x0f\x03\xcfu\x0e\x03\xcfu\x09\x03\x0c9\x10\x03\x0d9\x0c\x03\xcf`;\x03" + + "\xcf`>\x03\xcf`9\x03\xcf`8\x03\xcf`7\x03\xcf`*\x03\xcf`-\x03\xcf`,\x03" + + "\x0d\x1b\x1a\x03\x0d\x1b&\x03\x0c=.\x03\x0c=%\x03\x0c>\x1e\x03\x0c>\x14" + + "\x03\x0c?\x06\x03\x0c?\x0b\x03\x0c?\x0c\x03\x0c?\x0d\x03\x0c?\x02\x03" + + "\x0c>\x0f\x03\x0c>\x08\x03\x0c>\x09\x03\x0c>,\x03\x0c>\x0c\x03\x0c?\x13" + + "\x03\x0c?\x16\x03\x0c?\x15\x03\x0c?\x1c\x03\x0c?\x1f\x03\x0c?\x1d\x03" + + "\x0c?\x1a\x03\x0c?\x17\x03\x0c?\x08\x03\x0c?\x09\x03\x0c?\x0e\x03\x0c?" + + "\x04\x03\x0c?\x05\x03\x0c" + + "\x03\x0c=2\x03\x0c=6\x03\x0c<\x07\x03\x0c<\x05\x03\x0e:!\x03\x0e:#\x03" + + "\x0e8\x09\x03\x0e:&\x03\x0e8\x0b\x03\x0e:$\x03\x0e:,\x03\x0e8\x1a\x03" + + "\x0e8\x1e\x03\x0e:*\x03\x0e:7\x03\x0e:5\x03\x0e:;\x03\x0e:\x15\x03\x0e:<" + + "\x03\x0e:4\x03\x0e:'\x03\x0e:-\x03\x0e:%\x03\x0e:?\x03\x0e:=\x03\x0e:)" + + "\x03\x0e:/\x03\xcfs'\x03\x0d=\x0f\x03\x0d+*\x03\x0d99\x03\x0d9;\x03\x0d9" + + "?\x03\x0d)\x0d\x03\x0d(%\x02\x01\x18\x02\x01(\x02\x03'\x02\x03)\x02\x03+" + + "\x02\x03/\x02\x03\x19\x02\x03\x1b\x02\x03\x1f\x03\x0d\x22\x18\x03\x0d" + + "\x22\x1a\x03\x0d\x22'\x03\x0d\x22/\x03\x0d\x223\x03\x0d\x22$\x02\x01\x1e" + + "\x03\x0f$!\x03\x0f87\x03\x0f4\x0e\x03\x0f5\x1d\x03\x06'\x03\x03\x0f\x08" + + "\x18\x03\x0f\x0d\x1b\x03\x0e2=\x03\x0e;\x08\x03\x0e:\x0b\x03\x0e\x06$" + + "\x03\x0e\x0d)\x03\x0e\x16\x1f\x03\x0e\x16\x1b\x03\x0d$\x0a\x03\x05,\x1d" + + "\x03\x0d. \x03\x0d.#\x03\x0c(/\x03\x09%\x02\x03\x0d90\x03\x0d\x0e4\x03" + + "\x0d\x0d\x0f\x03\x0c#\x00\x03\x0c,\x1e\x03\x0c2\x0e\x03\x0c\x01\x17\x03" + + "\x0c\x09:\x03\x0e\x173\x03\x0c\x08\x03\x03\x0c\x11\x07\x03\x0c\x10\x18" + + "\x03\x0c\x1f\x1c\x03\x0c\x19\x0e\x03\x0c\x1a\x1f\x03\x0f0>\x03\x0b->\x03" + + "\x0b<+\x03\x0b8\x13\x03\x0b\x043\x03\x0b\x14\x03\x03\x0b\x16%\x03\x0d" + + "\x22&\x03\x0b\x1a\x1a\x03\x0b\x1a\x04\x03\x0a%9\x03\x0a&2\x03\x0a&0\x03" + + "\x0a!\x1a\x03\x0a!7\x03\x0a5\x10\x03\x0a=4\x03\x0a?\x0e\x03\x0a>\x10\x03" + + "\x0a\x00 \x03\x0a\x0f:\x03\x0a\x0f9\x03\x0a\x0b\x0a\x03\x0a\x17%\x03\x0a" + + "\x1b-\x03\x09-\x1a\x03\x09,4\x03\x09.,\x03\x09)\x09\x03\x096!\x03\x091" + + "\x1f\x03\x093\x16\x03\x0c+\x1f\x03\x098 \x03\x098=\x03\x0c(\x1a\x03\x0c(" + + "\x16\x03\x09\x0a+\x03\x09\x16\x12\x03\x09\x13\x0e\x03\x09\x153\x03\x08)!" + + "\x03\x09\x1a\x01\x03\x09\x18\x01\x03\x08%#\x03\x08>\x22\x03\x08\x05%\x03" + + "\x08\x02*\x03\x08\x15;\x03\x08\x1b7\x03\x0f\x07\x1d\x03\x0f\x04\x03\x03" + + "\x070\x0c\x03\x07;\x0b\x03\x07\x08\x17\x03\x07\x12\x06\x03\x06/-\x03\x06" + + "71\x03\x065+\x03\x06>7\x03\x06\x049\x03\x05+\x1e\x03\x05,\x17\x03\x05 " + + "\x1d\x03\x05\x22\x05\x03\x050\x1d" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// idnaTrie. Total size: 31598 bytes (30.86 KiB). Checksum: d3118eda0d6b5360. +type idnaTrie struct{} + +func newIdnaTrie(i int) *idnaTrie { + return &idnaTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *idnaTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 133: + return uint16(idnaValues[n<<6+uint32(b)]) + default: + n -= 133 + return uint16(idnaSparse.lookup(n, b)) + } +} + +// idnaValues: 135 blocks, 8640 entries, 17280 bytes +// The third block is the zero block. +var idnaValues = [8640]uint16{ + // Block 0x0, offset 0x0 + 0x00: 0x0080, 0x01: 0x0080, 0x02: 0x0080, 0x03: 0x0080, 0x04: 0x0080, 0x05: 0x0080, + 0x06: 0x0080, 0x07: 0x0080, 0x08: 0x0080, 0x09: 0x0080, 0x0a: 0x0080, 0x0b: 0x0080, + 0x0c: 0x0080, 0x0d: 0x0080, 0x0e: 0x0080, 0x0f: 0x0080, 0x10: 0x0080, 0x11: 0x0080, + 0x12: 0x0080, 0x13: 0x0080, 0x14: 0x0080, 0x15: 0x0080, 0x16: 0x0080, 0x17: 0x0080, + 0x18: 0x0080, 0x19: 0x0080, 0x1a: 0x0080, 0x1b: 0x0080, 0x1c: 0x0080, 0x1d: 0x0080, + 0x1e: 0x0080, 0x1f: 0x0080, 0x20: 0x0080, 0x21: 0x0080, 0x22: 0x0080, 0x23: 0x0080, + 0x24: 0x0080, 0x25: 0x0080, 0x26: 0x0080, 0x27: 0x0080, 0x28: 0x0080, 0x29: 0x0080, + 0x2a: 0x0080, 0x2b: 0x0080, 0x2c: 0x0080, 0x2d: 0x0008, 0x2e: 0x0008, 0x2f: 0x0080, + 0x30: 0x0008, 0x31: 0x0008, 0x32: 0x0008, 0x33: 0x0008, 0x34: 0x0008, 0x35: 0x0008, + 0x36: 0x0008, 0x37: 0x0008, 0x38: 0x0008, 0x39: 0x0008, 0x3a: 0x0080, 0x3b: 0x0080, + 0x3c: 0x0080, 0x3d: 0x0080, 0x3e: 0x0080, 0x3f: 0x0080, + // Block 0x1, offset 0x40 + 0x40: 0x0080, 0x41: 0xe105, 0x42: 0xe105, 0x43: 0xe105, 0x44: 0xe105, 0x45: 0xe105, + 0x46: 0xe105, 0x47: 0xe105, 0x48: 0xe105, 0x49: 0xe105, 0x4a: 0xe105, 0x4b: 0xe105, + 0x4c: 0xe105, 0x4d: 0xe105, 0x4e: 0xe105, 0x4f: 0xe105, 0x50: 0xe105, 0x51: 0xe105, + 0x52: 0xe105, 0x53: 0xe105, 0x54: 0xe105, 0x55: 0xe105, 0x56: 0xe105, 0x57: 0xe105, + 0x58: 0xe105, 0x59: 0xe105, 0x5a: 0xe105, 0x5b: 0x0080, 0x5c: 0x0080, 0x5d: 0x0080, + 0x5e: 0x0080, 0x5f: 0x0080, 0x60: 0x0080, 0x61: 0x0008, 0x62: 0x0008, 0x63: 0x0008, + 0x64: 0x0008, 0x65: 0x0008, 0x66: 0x0008, 0x67: 0x0008, 0x68: 0x0008, 0x69: 0x0008, + 0x6a: 0x0008, 0x6b: 0x0008, 0x6c: 0x0008, 0x6d: 0x0008, 0x6e: 0x0008, 0x6f: 0x0008, + 0x70: 0x0008, 0x71: 0x0008, 0x72: 0x0008, 0x73: 0x0008, 0x74: 0x0008, 0x75: 0x0008, + 0x76: 0x0008, 0x77: 0x0008, 0x78: 0x0008, 0x79: 0x0008, 0x7a: 0x0008, 0x7b: 0x0080, + 0x7c: 0x0080, 0x7d: 0x0080, 0x7e: 0x0080, 0x7f: 0x0080, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, + 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, + 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, + 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, + 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, + 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x0012, 0xe9: 0x0018, + 0xea: 0x0019, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x0022, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0029, 0xf3: 0x0031, 0xf4: 0x003a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x0042, 0xf9: 0x0049, 0xfa: 0x0051, 0xfb: 0x0018, + 0xfc: 0x0059, 0xfd: 0x0061, 0xfe: 0x0069, 0xff: 0x0018, + // Block 0x4, offset 0x100 + 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, + 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, + 0x10c: 0xe00d, 0x10d: 0x0008, 0x10e: 0xe00d, 0x10f: 0x0008, 0x110: 0xe00d, 0x111: 0x0008, + 0x112: 0xe00d, 0x113: 0x0008, 0x114: 0xe00d, 0x115: 0x0008, 0x116: 0xe00d, 0x117: 0x0008, + 0x118: 0xe00d, 0x119: 0x0008, 0x11a: 0xe00d, 0x11b: 0x0008, 0x11c: 0xe00d, 0x11d: 0x0008, + 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, + 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, + 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, + 0x130: 0x0071, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0079, + // Block 0x5, offset 0x140 + 0x140: 0x0079, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x0081, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, + 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, + 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, + 0x15e: 0xe00d, 0x15f: 0x0008, 0x160: 0xe00d, 0x161: 0x0008, 0x162: 0xe00d, 0x163: 0x0008, + 0x164: 0xe00d, 0x165: 0x0008, 0x166: 0xe00d, 0x167: 0x0008, 0x168: 0xe00d, 0x169: 0x0008, + 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, + 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, + 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x0089, + // Block 0x6, offset 0x180 + 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, + 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, + 0x18c: 0x0008, 0x18d: 0x0008, 0x18e: 0x00c5, 0x18f: 0x00dd, 0x190: 0x00f5, 0x191: 0xe01d, + 0x192: 0x0008, 0x193: 0x010d, 0x194: 0x0125, 0x195: 0x0008, 0x196: 0x013d, 0x197: 0x013d, + 0x198: 0xe00d, 0x199: 0x0008, 0x19a: 0x0008, 0x19b: 0x0008, 0x19c: 0x010d, 0x19d: 0x0155, + 0x19e: 0x0008, 0x19f: 0x016d, 0x1a0: 0xe00d, 0x1a1: 0x0008, 0x1a2: 0xe00d, 0x1a3: 0x0008, + 0x1a4: 0xe00d, 0x1a5: 0x0008, 0x1a6: 0x0185, 0x1a7: 0xe07d, 0x1a8: 0x0008, 0x1a9: 0x019d, + 0x1aa: 0x0008, 0x1ab: 0x0008, 0x1ac: 0xe00d, 0x1ad: 0x0008, 0x1ae: 0x0185, 0x1af: 0xe0fd, + 0x1b0: 0x0008, 0x1b1: 0x01b5, 0x1b2: 0x01cd, 0x1b3: 0xe03d, 0x1b4: 0x0008, 0x1b5: 0xe01d, + 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, + 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x0091, 0x1c5: 0x0091, + 0x1c6: 0x0091, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, + 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, + 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, + 0x1de: 0xe00d, 0x1df: 0x0008, 0x1e0: 0xe00d, 0x1e1: 0x0008, 0x1e2: 0xe00d, 0x1e3: 0x0008, + 0x1e4: 0xe00d, 0x1e5: 0x0008, 0x1e6: 0xe00d, 0x1e7: 0x0008, 0x1e8: 0xe00d, 0x1e9: 0x0008, + 0x1ea: 0xe00d, 0x1eb: 0x0008, 0x1ec: 0xe00d, 0x1ed: 0x0008, 0x1ee: 0xe00d, 0x1ef: 0x0008, + 0x1f0: 0x0008, 0x1f1: 0x028d, 0x1f2: 0x02a5, 0x1f3: 0x02bd, 0x1f4: 0xe00d, 0x1f5: 0x0008, + 0x1f6: 0x02d5, 0x1f7: 0x02ed, 0x1f8: 0xe00d, 0x1f9: 0x0008, 0x1fa: 0xe00d, 0x1fb: 0x0008, + 0x1fc: 0xe00d, 0x1fd: 0x0008, 0x1fe: 0xe00d, 0x1ff: 0x0008, + // Block 0x8, offset 0x200 + 0x200: 0xe00d, 0x201: 0x0008, 0x202: 0xe00d, 0x203: 0x0008, 0x204: 0xe00d, 0x205: 0x0008, + 0x206: 0xe00d, 0x207: 0x0008, 0x208: 0xe00d, 0x209: 0x0008, 0x20a: 0xe00d, 0x20b: 0x0008, + 0x20c: 0xe00d, 0x20d: 0x0008, 0x20e: 0xe00d, 0x20f: 0x0008, 0x210: 0xe00d, 0x211: 0x0008, + 0x212: 0xe00d, 0x213: 0x0008, 0x214: 0xe00d, 0x215: 0x0008, 0x216: 0xe00d, 0x217: 0x0008, + 0x218: 0xe00d, 0x219: 0x0008, 0x21a: 0xe00d, 0x21b: 0x0008, 0x21c: 0xe00d, 0x21d: 0x0008, + 0x21e: 0xe00d, 0x21f: 0x0008, 0x220: 0x0305, 0x221: 0x0008, 0x222: 0xe00d, 0x223: 0x0008, + 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, + 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, + 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0099, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x00a1, 0x23f: 0x0008, + // Block 0x9, offset 0x240 + 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, + 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, + 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, + 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, + 0x258: 0x00d2, 0x259: 0x00da, 0x25a: 0x00e2, 0x25b: 0x00ea, 0x25c: 0x00f2, 0x25d: 0x00fa, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0101, 0x262: 0x0089, 0x263: 0x0109, + 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, + 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, + 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, + 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, + 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, + // Block 0xa, offset 0x280 + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0111, 0x285: 0x040d, + 0x286: 0x3308, 0x287: 0x3308, 0x288: 0x3308, 0x289: 0x3308, 0x28a: 0x3308, 0x28b: 0x3308, + 0x28c: 0x3308, 0x28d: 0x3308, 0x28e: 0x3308, 0x28f: 0x33c0, 0x290: 0x3308, 0x291: 0x3308, + 0x292: 0x3308, 0x293: 0x3308, 0x294: 0x3308, 0x295: 0x3308, 0x296: 0x3308, 0x297: 0x3308, + 0x298: 0x3308, 0x299: 0x3308, 0x29a: 0x3308, 0x29b: 0x3308, 0x29c: 0x3308, 0x29d: 0x3308, + 0x29e: 0x3308, 0x29f: 0x3308, 0x2a0: 0x3308, 0x2a1: 0x3308, 0x2a2: 0x3308, 0x2a3: 0x3308, + 0x2a4: 0x3308, 0x2a5: 0x3308, 0x2a6: 0x3308, 0x2a7: 0x3308, 0x2a8: 0x3308, 0x2a9: 0x3308, + 0x2aa: 0x3308, 0x2ab: 0x3308, 0x2ac: 0x3308, 0x2ad: 0x3308, 0x2ae: 0x3308, 0x2af: 0x3308, + 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x011a, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x0122, 0x2bf: 0x043d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x003a, 0x2c5: 0x012a, + 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, + 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, + 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, + 0x2d8: 0xe105, 0x2d9: 0xe105, 0x2da: 0xe105, 0x2db: 0xe105, 0x2dc: 0xe105, 0x2dd: 0xe105, + 0x2de: 0xe105, 0x2df: 0xe105, 0x2e0: 0x049d, 0x2e1: 0x049d, 0x2e2: 0x0040, 0x2e3: 0x049d, + 0x2e4: 0x049d, 0x2e5: 0x049d, 0x2e6: 0x049d, 0x2e7: 0x049d, 0x2e8: 0x049d, 0x2e9: 0x049d, + 0x2ea: 0x049d, 0x2eb: 0x049d, 0x2ec: 0x0008, 0x2ed: 0x0008, 0x2ee: 0x0008, 0x2ef: 0x0008, + 0x2f0: 0x0008, 0x2f1: 0x0008, 0x2f2: 0x0008, 0x2f3: 0x0008, 0x2f4: 0x0008, 0x2f5: 0x0008, + 0x2f6: 0x0008, 0x2f7: 0x0008, 0x2f8: 0x0008, 0x2f9: 0x0008, 0x2fa: 0x0008, 0x2fb: 0x0008, + 0x2fc: 0x0008, 0x2fd: 0x0008, 0x2fe: 0x0008, 0x2ff: 0x0008, + // Block 0xc, offset 0x300 + 0x300: 0x0008, 0x301: 0x0008, 0x302: 0xe00f, 0x303: 0x0008, 0x304: 0x0008, 0x305: 0x0008, + 0x306: 0x0008, 0x307: 0x0008, 0x308: 0x0008, 0x309: 0x0008, 0x30a: 0x0008, 0x30b: 0x0008, + 0x30c: 0x0008, 0x30d: 0x0008, 0x30e: 0x0008, 0x30f: 0xe0c5, 0x310: 0x04b5, 0x311: 0x04cd, + 0x312: 0xe0bd, 0x313: 0xe0f5, 0x314: 0xe0fd, 0x315: 0xe09d, 0x316: 0xe0b5, 0x317: 0x0008, + 0x318: 0xe00d, 0x319: 0x0008, 0x31a: 0xe00d, 0x31b: 0x0008, 0x31c: 0xe00d, 0x31d: 0x0008, + 0x31e: 0xe00d, 0x31f: 0x0008, 0x320: 0xe00d, 0x321: 0x0008, 0x322: 0xe00d, 0x323: 0x0008, + 0x324: 0xe00d, 0x325: 0x0008, 0x326: 0xe00d, 0x327: 0x0008, 0x328: 0xe00d, 0x329: 0x0008, + 0x32a: 0xe00d, 0x32b: 0x0008, 0x32c: 0xe00d, 0x32d: 0x0008, 0x32e: 0xe00d, 0x32f: 0x0008, + 0x330: 0x04e5, 0x331: 0xe185, 0x332: 0xe18d, 0x333: 0x0008, 0x334: 0x04fd, 0x335: 0x03dd, + 0x336: 0x0018, 0x337: 0xe07d, 0x338: 0x0008, 0x339: 0xe1d5, 0x33a: 0xe00d, 0x33b: 0x0008, + 0x33c: 0x0008, 0x33d: 0x0515, 0x33e: 0x052d, 0x33f: 0x052d, + // Block 0xd, offset 0x340 + 0x340: 0x0008, 0x341: 0x0008, 0x342: 0x0008, 0x343: 0x0008, 0x344: 0x0008, 0x345: 0x0008, + 0x346: 0x0008, 0x347: 0x0008, 0x348: 0x0008, 0x349: 0x0008, 0x34a: 0x0008, 0x34b: 0x0008, + 0x34c: 0x0008, 0x34d: 0x0008, 0x34e: 0x0008, 0x34f: 0x0008, 0x350: 0x0008, 0x351: 0x0008, + 0x352: 0x0008, 0x353: 0x0008, 0x354: 0x0008, 0x355: 0x0008, 0x356: 0x0008, 0x357: 0x0008, + 0x358: 0x0008, 0x359: 0x0008, 0x35a: 0x0008, 0x35b: 0x0008, 0x35c: 0x0008, 0x35d: 0x0008, + 0x35e: 0x0008, 0x35f: 0x0008, 0x360: 0xe00d, 0x361: 0x0008, 0x362: 0xe00d, 0x363: 0x0008, + 0x364: 0xe00d, 0x365: 0x0008, 0x366: 0xe00d, 0x367: 0x0008, 0x368: 0xe00d, 0x369: 0x0008, + 0x36a: 0xe00d, 0x36b: 0x0008, 0x36c: 0xe00d, 0x36d: 0x0008, 0x36e: 0xe00d, 0x36f: 0x0008, + 0x370: 0xe00d, 0x371: 0x0008, 0x372: 0xe00d, 0x373: 0x0008, 0x374: 0xe00d, 0x375: 0x0008, + 0x376: 0xe00d, 0x377: 0x0008, 0x378: 0xe00d, 0x379: 0x0008, 0x37a: 0xe00d, 0x37b: 0x0008, + 0x37c: 0xe00d, 0x37d: 0x0008, 0x37e: 0xe00d, 0x37f: 0x0008, + // Block 0xe, offset 0x380 + 0x380: 0xe00d, 0x381: 0x0008, 0x382: 0x0018, 0x383: 0x3308, 0x384: 0x3308, 0x385: 0x3308, + 0x386: 0x3308, 0x387: 0x3308, 0x388: 0x3318, 0x389: 0x3318, 0x38a: 0xe00d, 0x38b: 0x0008, + 0x38c: 0xe00d, 0x38d: 0x0008, 0x38e: 0xe00d, 0x38f: 0x0008, 0x390: 0xe00d, 0x391: 0x0008, + 0x392: 0xe00d, 0x393: 0x0008, 0x394: 0xe00d, 0x395: 0x0008, 0x396: 0xe00d, 0x397: 0x0008, + 0x398: 0xe00d, 0x399: 0x0008, 0x39a: 0xe00d, 0x39b: 0x0008, 0x39c: 0xe00d, 0x39d: 0x0008, + 0x39e: 0xe00d, 0x39f: 0x0008, 0x3a0: 0xe00d, 0x3a1: 0x0008, 0x3a2: 0xe00d, 0x3a3: 0x0008, + 0x3a4: 0xe00d, 0x3a5: 0x0008, 0x3a6: 0xe00d, 0x3a7: 0x0008, 0x3a8: 0xe00d, 0x3a9: 0x0008, + 0x3aa: 0xe00d, 0x3ab: 0x0008, 0x3ac: 0xe00d, 0x3ad: 0x0008, 0x3ae: 0xe00d, 0x3af: 0x0008, + 0x3b0: 0xe00d, 0x3b1: 0x0008, 0x3b2: 0xe00d, 0x3b3: 0x0008, 0x3b4: 0xe00d, 0x3b5: 0x0008, + 0x3b6: 0xe00d, 0x3b7: 0x0008, 0x3b8: 0xe00d, 0x3b9: 0x0008, 0x3ba: 0xe00d, 0x3bb: 0x0008, + 0x3bc: 0xe00d, 0x3bd: 0x0008, 0x3be: 0xe00d, 0x3bf: 0x0008, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0040, 0x3c1: 0xe01d, 0x3c2: 0x0008, 0x3c3: 0xe03d, 0x3c4: 0x0008, 0x3c5: 0xe01d, + 0x3c6: 0x0008, 0x3c7: 0xe07d, 0x3c8: 0x0008, 0x3c9: 0xe01d, 0x3ca: 0x0008, 0x3cb: 0xe03d, + 0x3cc: 0x0008, 0x3cd: 0xe01d, 0x3ce: 0x0008, 0x3cf: 0x0008, 0x3d0: 0xe00d, 0x3d1: 0x0008, + 0x3d2: 0xe00d, 0x3d3: 0x0008, 0x3d4: 0xe00d, 0x3d5: 0x0008, 0x3d6: 0xe00d, 0x3d7: 0x0008, + 0x3d8: 0xe00d, 0x3d9: 0x0008, 0x3da: 0xe00d, 0x3db: 0x0008, 0x3dc: 0xe00d, 0x3dd: 0x0008, + 0x3de: 0xe00d, 0x3df: 0x0008, 0x3e0: 0xe00d, 0x3e1: 0x0008, 0x3e2: 0xe00d, 0x3e3: 0x0008, + 0x3e4: 0xe00d, 0x3e5: 0x0008, 0x3e6: 0xe00d, 0x3e7: 0x0008, 0x3e8: 0xe00d, 0x3e9: 0x0008, + 0x3ea: 0xe00d, 0x3eb: 0x0008, 0x3ec: 0xe00d, 0x3ed: 0x0008, 0x3ee: 0xe00d, 0x3ef: 0x0008, + 0x3f0: 0xe00d, 0x3f1: 0x0008, 0x3f2: 0xe00d, 0x3f3: 0x0008, 0x3f4: 0xe00d, 0x3f5: 0x0008, + 0x3f6: 0xe00d, 0x3f7: 0x0008, 0x3f8: 0xe00d, 0x3f9: 0x0008, 0x3fa: 0xe00d, 0x3fb: 0x0008, + 0x3fc: 0xe00d, 0x3fd: 0x0008, 0x3fe: 0xe00d, 0x3ff: 0x0008, + // Block 0x10, offset 0x400 + 0x400: 0xe00d, 0x401: 0x0008, 0x402: 0xe00d, 0x403: 0x0008, 0x404: 0xe00d, 0x405: 0x0008, + 0x406: 0xe00d, 0x407: 0x0008, 0x408: 0xe00d, 0x409: 0x0008, 0x40a: 0xe00d, 0x40b: 0x0008, + 0x40c: 0xe00d, 0x40d: 0x0008, 0x40e: 0xe00d, 0x40f: 0x0008, 0x410: 0xe00d, 0x411: 0x0008, + 0x412: 0xe00d, 0x413: 0x0008, 0x414: 0xe00d, 0x415: 0x0008, 0x416: 0xe00d, 0x417: 0x0008, + 0x418: 0xe00d, 0x419: 0x0008, 0x41a: 0xe00d, 0x41b: 0x0008, 0x41c: 0xe00d, 0x41d: 0x0008, + 0x41e: 0xe00d, 0x41f: 0x0008, 0x420: 0xe00d, 0x421: 0x0008, 0x422: 0xe00d, 0x423: 0x0008, + 0x424: 0xe00d, 0x425: 0x0008, 0x426: 0xe00d, 0x427: 0x0008, 0x428: 0xe00d, 0x429: 0x0008, + 0x42a: 0xe00d, 0x42b: 0x0008, 0x42c: 0xe00d, 0x42d: 0x0008, 0x42e: 0xe00d, 0x42f: 0x0008, + 0x430: 0x0040, 0x431: 0x03f5, 0x432: 0x03f5, 0x433: 0x03f5, 0x434: 0x03f5, 0x435: 0x03f5, + 0x436: 0x03f5, 0x437: 0x03f5, 0x438: 0x03f5, 0x439: 0x03f5, 0x43a: 0x03f5, 0x43b: 0x03f5, + 0x43c: 0x03f5, 0x43d: 0x03f5, 0x43e: 0x03f5, 0x43f: 0x03f5, + // Block 0x11, offset 0x440 + 0x440: 0x0840, 0x441: 0x0840, 0x442: 0x0840, 0x443: 0x0840, 0x444: 0x0840, 0x445: 0x0840, + 0x446: 0x0018, 0x447: 0x0018, 0x448: 0x0818, 0x449: 0x0018, 0x44a: 0x0018, 0x44b: 0x0818, + 0x44c: 0x0018, 0x44d: 0x0818, 0x44e: 0x0018, 0x44f: 0x0018, 0x450: 0x3308, 0x451: 0x3308, + 0x452: 0x3308, 0x453: 0x3308, 0x454: 0x3308, 0x455: 0x3308, 0x456: 0x3308, 0x457: 0x3308, + 0x458: 0x3308, 0x459: 0x3308, 0x45a: 0x3308, 0x45b: 0x0818, 0x45c: 0x0b40, 0x45d: 0x0818, + 0x45e: 0x0818, 0x45f: 0x0818, 0x460: 0x0a08, 0x461: 0x0808, 0x462: 0x0c08, 0x463: 0x0c08, + 0x464: 0x0c08, 0x465: 0x0c08, 0x466: 0x0a08, 0x467: 0x0c08, 0x468: 0x0a08, 0x469: 0x0c08, + 0x46a: 0x0a08, 0x46b: 0x0a08, 0x46c: 0x0a08, 0x46d: 0x0a08, 0x46e: 0x0a08, 0x46f: 0x0c08, + 0x470: 0x0c08, 0x471: 0x0c08, 0x472: 0x0c08, 0x473: 0x0a08, 0x474: 0x0a08, 0x475: 0x0a08, + 0x476: 0x0a08, 0x477: 0x0a08, 0x478: 0x0a08, 0x479: 0x0a08, 0x47a: 0x0a08, 0x47b: 0x0a08, + 0x47c: 0x0a08, 0x47d: 0x0a08, 0x47e: 0x0a08, 0x47f: 0x0a08, + // Block 0x12, offset 0x480 + 0x480: 0x0818, 0x481: 0x0a08, 0x482: 0x0a08, 0x483: 0x0a08, 0x484: 0x0a08, 0x485: 0x0a08, + 0x486: 0x0a08, 0x487: 0x0a08, 0x488: 0x0c08, 0x489: 0x0a08, 0x48a: 0x0a08, 0x48b: 0x3308, + 0x48c: 0x3308, 0x48d: 0x3308, 0x48e: 0x3308, 0x48f: 0x3308, 0x490: 0x3308, 0x491: 0x3308, + 0x492: 0x3308, 0x493: 0x3308, 0x494: 0x3308, 0x495: 0x3308, 0x496: 0x3308, 0x497: 0x3308, + 0x498: 0x3308, 0x499: 0x3308, 0x49a: 0x3308, 0x49b: 0x3308, 0x49c: 0x3308, 0x49d: 0x3308, + 0x49e: 0x3308, 0x49f: 0x3308, 0x4a0: 0x0808, 0x4a1: 0x0808, 0x4a2: 0x0808, 0x4a3: 0x0808, + 0x4a4: 0x0808, 0x4a5: 0x0808, 0x4a6: 0x0808, 0x4a7: 0x0808, 0x4a8: 0x0808, 0x4a9: 0x0808, + 0x4aa: 0x0018, 0x4ab: 0x0818, 0x4ac: 0x0818, 0x4ad: 0x0818, 0x4ae: 0x0a08, 0x4af: 0x0a08, + 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0139, + 0x4b6: 0x0141, 0x4b7: 0x0149, 0x4b8: 0x0151, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, + 0x4bc: 0x0a08, 0x4bd: 0x0a08, 0x4be: 0x0a08, 0x4bf: 0x0a08, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0c08, 0x4c1: 0x0a08, 0x4c2: 0x0a08, 0x4c3: 0x0c08, 0x4c4: 0x0c08, 0x4c5: 0x0c08, + 0x4c6: 0x0c08, 0x4c7: 0x0c08, 0x4c8: 0x0c08, 0x4c9: 0x0c08, 0x4ca: 0x0c08, 0x4cb: 0x0c08, + 0x4cc: 0x0a08, 0x4cd: 0x0c08, 0x4ce: 0x0a08, 0x4cf: 0x0c08, 0x4d0: 0x0a08, 0x4d1: 0x0a08, + 0x4d2: 0x0c08, 0x4d3: 0x0c08, 0x4d4: 0x0818, 0x4d5: 0x0c08, 0x4d6: 0x3308, 0x4d7: 0x3308, + 0x4d8: 0x3308, 0x4d9: 0x3308, 0x4da: 0x3308, 0x4db: 0x3308, 0x4dc: 0x3308, 0x4dd: 0x0840, + 0x4de: 0x0018, 0x4df: 0x3308, 0x4e0: 0x3308, 0x4e1: 0x3308, 0x4e2: 0x3308, 0x4e3: 0x3308, + 0x4e4: 0x3308, 0x4e5: 0x0808, 0x4e6: 0x0808, 0x4e7: 0x3308, 0x4e8: 0x3308, 0x4e9: 0x0018, + 0x4ea: 0x3308, 0x4eb: 0x3308, 0x4ec: 0x3308, 0x4ed: 0x3308, 0x4ee: 0x0c08, 0x4ef: 0x0c08, + 0x4f0: 0x0008, 0x4f1: 0x0008, 0x4f2: 0x0008, 0x4f3: 0x0008, 0x4f4: 0x0008, 0x4f5: 0x0008, + 0x4f6: 0x0008, 0x4f7: 0x0008, 0x4f8: 0x0008, 0x4f9: 0x0008, 0x4fa: 0x0a08, 0x4fb: 0x0a08, + 0x4fc: 0x0a08, 0x4fd: 0x0808, 0x4fe: 0x0808, 0x4ff: 0x0a08, + // Block 0x14, offset 0x500 + 0x500: 0x0818, 0x501: 0x0818, 0x502: 0x0818, 0x503: 0x0818, 0x504: 0x0818, 0x505: 0x0818, + 0x506: 0x0818, 0x507: 0x0818, 0x508: 0x0818, 0x509: 0x0818, 0x50a: 0x0818, 0x50b: 0x0818, + 0x50c: 0x0818, 0x50d: 0x0818, 0x50e: 0x0040, 0x50f: 0x0b40, 0x510: 0x0c08, 0x511: 0x3308, + 0x512: 0x0a08, 0x513: 0x0a08, 0x514: 0x0a08, 0x515: 0x0c08, 0x516: 0x0c08, 0x517: 0x0c08, + 0x518: 0x0c08, 0x519: 0x0c08, 0x51a: 0x0a08, 0x51b: 0x0a08, 0x51c: 0x0a08, 0x51d: 0x0a08, + 0x51e: 0x0c08, 0x51f: 0x0a08, 0x520: 0x0a08, 0x521: 0x0a08, 0x522: 0x0a08, 0x523: 0x0a08, + 0x524: 0x0a08, 0x525: 0x0a08, 0x526: 0x0a08, 0x527: 0x0a08, 0x528: 0x0c08, 0x529: 0x0a08, + 0x52a: 0x0c08, 0x52b: 0x0a08, 0x52c: 0x0c08, 0x52d: 0x0a08, 0x52e: 0x0a08, 0x52f: 0x0c08, + 0x530: 0x3308, 0x531: 0x3308, 0x532: 0x3308, 0x533: 0x3308, 0x534: 0x3308, 0x535: 0x3308, + 0x536: 0x3308, 0x537: 0x3308, 0x538: 0x3308, 0x539: 0x3308, 0x53a: 0x3308, 0x53b: 0x3308, + 0x53c: 0x3308, 0x53d: 0x3308, 0x53e: 0x3308, 0x53f: 0x3308, + // Block 0x15, offset 0x540 + 0x540: 0x0c08, 0x541: 0x0a08, 0x542: 0x0a08, 0x543: 0x0a08, 0x544: 0x0a08, 0x545: 0x0a08, + 0x546: 0x0c08, 0x547: 0x0c08, 0x548: 0x0a08, 0x549: 0x0c08, 0x54a: 0x0a08, 0x54b: 0x0a08, + 0x54c: 0x0a08, 0x54d: 0x0a08, 0x54e: 0x0a08, 0x54f: 0x0a08, 0x550: 0x0a08, 0x551: 0x0a08, + 0x552: 0x0a08, 0x553: 0x0a08, 0x554: 0x0c08, 0x555: 0x0a08, 0x556: 0x0c08, 0x557: 0x0c08, + 0x558: 0x0c08, 0x559: 0x3308, 0x55a: 0x3308, 0x55b: 0x3308, 0x55c: 0x0040, 0x55d: 0x0040, + 0x55e: 0x0818, 0x55f: 0x0040, 0x560: 0x0a08, 0x561: 0x0808, 0x562: 0x0a08, 0x563: 0x0a08, + 0x564: 0x0a08, 0x565: 0x0a08, 0x566: 0x0808, 0x567: 0x0c08, 0x568: 0x0a08, 0x569: 0x0c08, + 0x56a: 0x0c08, 0x56b: 0x0040, 0x56c: 0x0040, 0x56d: 0x0040, 0x56e: 0x0040, 0x56f: 0x0040, + 0x570: 0x0c08, 0x571: 0x0c08, 0x572: 0x0c08, 0x573: 0x0c08, 0x574: 0x0c08, 0x575: 0x0c08, + 0x576: 0x0c08, 0x577: 0x0c08, 0x578: 0x0c08, 0x579: 0x0c08, 0x57a: 0x0c08, 0x57b: 0x0c08, + 0x57c: 0x0c08, 0x57d: 0x0c08, 0x57e: 0x0c08, 0x57f: 0x0c08, + // Block 0x16, offset 0x580 + 0x580: 0x0c08, 0x581: 0x0c08, 0x582: 0x0c08, 0x583: 0x0808, 0x584: 0x0808, 0x585: 0x0808, + 0x586: 0x0a08, 0x587: 0x0808, 0x588: 0x0818, 0x589: 0x0a08, 0x58a: 0x0a08, 0x58b: 0x0a08, + 0x58c: 0x0a08, 0x58d: 0x0a08, 0x58e: 0x0c08, 0x58f: 0x0040, 0x590: 0x0840, 0x591: 0x0840, + 0x592: 0x0040, 0x593: 0x0040, 0x594: 0x0040, 0x595: 0x0040, 0x596: 0x0040, 0x597: 0x0040, + 0x598: 0x3308, 0x599: 0x3308, 0x59a: 0x3308, 0x59b: 0x3308, 0x59c: 0x3308, 0x59d: 0x3308, + 0x59e: 0x3308, 0x59f: 0x3308, 0x5a0: 0x0a08, 0x5a1: 0x0a08, 0x5a2: 0x0a08, 0x5a3: 0x0a08, + 0x5a4: 0x0a08, 0x5a5: 0x0a08, 0x5a6: 0x0a08, 0x5a7: 0x0a08, 0x5a8: 0x0a08, 0x5a9: 0x0a08, + 0x5aa: 0x0c08, 0x5ab: 0x0c08, 0x5ac: 0x0c08, 0x5ad: 0x0808, 0x5ae: 0x0c08, 0x5af: 0x0a08, + 0x5b0: 0x0a08, 0x5b1: 0x0c08, 0x5b2: 0x0c08, 0x5b3: 0x0a08, 0x5b4: 0x0a08, 0x5b5: 0x0a08, + 0x5b6: 0x0a08, 0x5b7: 0x0a08, 0x5b8: 0x0a08, 0x5b9: 0x0c08, 0x5ba: 0x0a08, 0x5bb: 0x0a08, + 0x5bc: 0x0a08, 0x5bd: 0x0a08, 0x5be: 0x0a08, 0x5bf: 0x0a08, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3008, 0x5c1: 0x3308, 0x5c2: 0x3308, 0x5c3: 0x3308, 0x5c4: 0x3308, 0x5c5: 0x3308, + 0x5c6: 0x3308, 0x5c7: 0x3308, 0x5c8: 0x3308, 0x5c9: 0x3008, 0x5ca: 0x3008, 0x5cb: 0x3008, + 0x5cc: 0x3008, 0x5cd: 0x3b08, 0x5ce: 0x3008, 0x5cf: 0x3008, 0x5d0: 0x0008, 0x5d1: 0x3308, + 0x5d2: 0x3308, 0x5d3: 0x3308, 0x5d4: 0x3308, 0x5d5: 0x3308, 0x5d6: 0x3308, 0x5d7: 0x3308, + 0x5d8: 0x0159, 0x5d9: 0x0161, 0x5da: 0x0169, 0x5db: 0x0171, 0x5dc: 0x0179, 0x5dd: 0x0181, + 0x5de: 0x0189, 0x5df: 0x0191, 0x5e0: 0x0008, 0x5e1: 0x0008, 0x5e2: 0x3308, 0x5e3: 0x3308, + 0x5e4: 0x0018, 0x5e5: 0x0018, 0x5e6: 0x0008, 0x5e7: 0x0008, 0x5e8: 0x0008, 0x5e9: 0x0008, + 0x5ea: 0x0008, 0x5eb: 0x0008, 0x5ec: 0x0008, 0x5ed: 0x0008, 0x5ee: 0x0008, 0x5ef: 0x0008, + 0x5f0: 0x0018, 0x5f1: 0x0008, 0x5f2: 0x0008, 0x5f3: 0x0008, 0x5f4: 0x0008, 0x5f5: 0x0008, + 0x5f6: 0x0008, 0x5f7: 0x0008, 0x5f8: 0x0008, 0x5f9: 0x0008, 0x5fa: 0x0008, 0x5fb: 0x0008, + 0x5fc: 0x0008, 0x5fd: 0x0008, 0x5fe: 0x0008, 0x5ff: 0x0008, + // Block 0x18, offset 0x600 + 0x600: 0x0008, 0x601: 0x3308, 0x602: 0x3008, 0x603: 0x3008, 0x604: 0x0040, 0x605: 0x0008, + 0x606: 0x0008, 0x607: 0x0008, 0x608: 0x0008, 0x609: 0x0008, 0x60a: 0x0008, 0x60b: 0x0008, + 0x60c: 0x0008, 0x60d: 0x0040, 0x60e: 0x0040, 0x60f: 0x0008, 0x610: 0x0008, 0x611: 0x0040, + 0x612: 0x0040, 0x613: 0x0008, 0x614: 0x0008, 0x615: 0x0008, 0x616: 0x0008, 0x617: 0x0008, + 0x618: 0x0008, 0x619: 0x0008, 0x61a: 0x0008, 0x61b: 0x0008, 0x61c: 0x0008, 0x61d: 0x0008, + 0x61e: 0x0008, 0x61f: 0x0008, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x0008, 0x623: 0x0008, + 0x624: 0x0008, 0x625: 0x0008, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0040, + 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, + 0x630: 0x0008, 0x631: 0x0040, 0x632: 0x0008, 0x633: 0x0040, 0x634: 0x0040, 0x635: 0x0040, + 0x636: 0x0008, 0x637: 0x0008, 0x638: 0x0008, 0x639: 0x0008, 0x63a: 0x0040, 0x63b: 0x0040, + 0x63c: 0x3308, 0x63d: 0x0008, 0x63e: 0x3008, 0x63f: 0x3008, + // Block 0x19, offset 0x640 + 0x640: 0x3008, 0x641: 0x3308, 0x642: 0x3308, 0x643: 0x3308, 0x644: 0x3308, 0x645: 0x0040, + 0x646: 0x0040, 0x647: 0x3008, 0x648: 0x3008, 0x649: 0x0040, 0x64a: 0x0040, 0x64b: 0x3008, + 0x64c: 0x3008, 0x64d: 0x3b08, 0x64e: 0x0008, 0x64f: 0x0040, 0x650: 0x0040, 0x651: 0x0040, + 0x652: 0x0040, 0x653: 0x0040, 0x654: 0x0040, 0x655: 0x0040, 0x656: 0x0040, 0x657: 0x3008, + 0x658: 0x0040, 0x659: 0x0040, 0x65a: 0x0040, 0x65b: 0x0040, 0x65c: 0x0199, 0x65d: 0x01a1, + 0x65e: 0x0040, 0x65f: 0x01a9, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x3308, 0x663: 0x3308, + 0x664: 0x0040, 0x665: 0x0040, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0008, + 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, + 0x670: 0x0008, 0x671: 0x0008, 0x672: 0x0018, 0x673: 0x0018, 0x674: 0x0018, 0x675: 0x0018, + 0x676: 0x0018, 0x677: 0x0018, 0x678: 0x0018, 0x679: 0x0018, 0x67a: 0x0018, 0x67b: 0x0018, + 0x67c: 0x0008, 0x67d: 0x0018, 0x67e: 0x3308, 0x67f: 0x0040, + // Block 0x1a, offset 0x680 + 0x680: 0x0040, 0x681: 0x3308, 0x682: 0x3308, 0x683: 0x3008, 0x684: 0x0040, 0x685: 0x0008, + 0x686: 0x0008, 0x687: 0x0008, 0x688: 0x0008, 0x689: 0x0008, 0x68a: 0x0008, 0x68b: 0x0040, + 0x68c: 0x0040, 0x68d: 0x0040, 0x68e: 0x0040, 0x68f: 0x0008, 0x690: 0x0008, 0x691: 0x0040, + 0x692: 0x0040, 0x693: 0x0008, 0x694: 0x0008, 0x695: 0x0008, 0x696: 0x0008, 0x697: 0x0008, + 0x698: 0x0008, 0x699: 0x0008, 0x69a: 0x0008, 0x69b: 0x0008, 0x69c: 0x0008, 0x69d: 0x0008, + 0x69e: 0x0008, 0x69f: 0x0008, 0x6a0: 0x0008, 0x6a1: 0x0008, 0x6a2: 0x0008, 0x6a3: 0x0008, + 0x6a4: 0x0008, 0x6a5: 0x0008, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0040, + 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, + 0x6b0: 0x0008, 0x6b1: 0x0040, 0x6b2: 0x0008, 0x6b3: 0x01b1, 0x6b4: 0x0040, 0x6b5: 0x0008, + 0x6b6: 0x01b9, 0x6b7: 0x0040, 0x6b8: 0x0008, 0x6b9: 0x0008, 0x6ba: 0x0040, 0x6bb: 0x0040, + 0x6bc: 0x3308, 0x6bd: 0x0040, 0x6be: 0x3008, 0x6bf: 0x3008, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3008, 0x6c1: 0x3308, 0x6c2: 0x3308, 0x6c3: 0x0040, 0x6c4: 0x0040, 0x6c5: 0x0040, + 0x6c6: 0x0040, 0x6c7: 0x3308, 0x6c8: 0x3308, 0x6c9: 0x0040, 0x6ca: 0x0040, 0x6cb: 0x3308, + 0x6cc: 0x3308, 0x6cd: 0x3b08, 0x6ce: 0x0040, 0x6cf: 0x0040, 0x6d0: 0x0040, 0x6d1: 0x3308, + 0x6d2: 0x0040, 0x6d3: 0x0040, 0x6d4: 0x0040, 0x6d5: 0x0040, 0x6d6: 0x0040, 0x6d7: 0x0040, + 0x6d8: 0x0040, 0x6d9: 0x01c1, 0x6da: 0x01c9, 0x6db: 0x01d1, 0x6dc: 0x0008, 0x6dd: 0x0040, + 0x6de: 0x01d9, 0x6df: 0x0040, 0x6e0: 0x0040, 0x6e1: 0x0040, 0x6e2: 0x0040, 0x6e3: 0x0040, + 0x6e4: 0x0040, 0x6e5: 0x0040, 0x6e6: 0x0008, 0x6e7: 0x0008, 0x6e8: 0x0008, 0x6e9: 0x0008, + 0x6ea: 0x0008, 0x6eb: 0x0008, 0x6ec: 0x0008, 0x6ed: 0x0008, 0x6ee: 0x0008, 0x6ef: 0x0008, + 0x6f0: 0x3308, 0x6f1: 0x3308, 0x6f2: 0x0008, 0x6f3: 0x0008, 0x6f4: 0x0008, 0x6f5: 0x3308, + 0x6f6: 0x0018, 0x6f7: 0x0040, 0x6f8: 0x0040, 0x6f9: 0x0040, 0x6fa: 0x0040, 0x6fb: 0x0040, + 0x6fc: 0x0040, 0x6fd: 0x0040, 0x6fe: 0x0040, 0x6ff: 0x0040, + // Block 0x1c, offset 0x700 + 0x700: 0x0040, 0x701: 0x3308, 0x702: 0x3308, 0x703: 0x3008, 0x704: 0x0040, 0x705: 0x0008, + 0x706: 0x0008, 0x707: 0x0008, 0x708: 0x0008, 0x709: 0x0008, 0x70a: 0x0008, 0x70b: 0x0008, + 0x70c: 0x0008, 0x70d: 0x0008, 0x70e: 0x0040, 0x70f: 0x0008, 0x710: 0x0008, 0x711: 0x0008, + 0x712: 0x0040, 0x713: 0x0008, 0x714: 0x0008, 0x715: 0x0008, 0x716: 0x0008, 0x717: 0x0008, + 0x718: 0x0008, 0x719: 0x0008, 0x71a: 0x0008, 0x71b: 0x0008, 0x71c: 0x0008, 0x71d: 0x0008, + 0x71e: 0x0008, 0x71f: 0x0008, 0x720: 0x0008, 0x721: 0x0008, 0x722: 0x0008, 0x723: 0x0008, + 0x724: 0x0008, 0x725: 0x0008, 0x726: 0x0008, 0x727: 0x0008, 0x728: 0x0008, 0x729: 0x0040, + 0x72a: 0x0008, 0x72b: 0x0008, 0x72c: 0x0008, 0x72d: 0x0008, 0x72e: 0x0008, 0x72f: 0x0008, + 0x730: 0x0008, 0x731: 0x0040, 0x732: 0x0008, 0x733: 0x0008, 0x734: 0x0040, 0x735: 0x0008, + 0x736: 0x0008, 0x737: 0x0008, 0x738: 0x0008, 0x739: 0x0008, 0x73a: 0x0040, 0x73b: 0x0040, + 0x73c: 0x3308, 0x73d: 0x0008, 0x73e: 0x3008, 0x73f: 0x3008, + // Block 0x1d, offset 0x740 + 0x740: 0x3008, 0x741: 0x3308, 0x742: 0x3308, 0x743: 0x3308, 0x744: 0x3308, 0x745: 0x3308, + 0x746: 0x0040, 0x747: 0x3308, 0x748: 0x3308, 0x749: 0x3008, 0x74a: 0x0040, 0x74b: 0x3008, + 0x74c: 0x3008, 0x74d: 0x3b08, 0x74e: 0x0040, 0x74f: 0x0040, 0x750: 0x0008, 0x751: 0x0040, + 0x752: 0x0040, 0x753: 0x0040, 0x754: 0x0040, 0x755: 0x0040, 0x756: 0x0040, 0x757: 0x0040, + 0x758: 0x0040, 0x759: 0x0040, 0x75a: 0x0040, 0x75b: 0x0040, 0x75c: 0x0040, 0x75d: 0x0040, + 0x75e: 0x0040, 0x75f: 0x0040, 0x760: 0x0008, 0x761: 0x0008, 0x762: 0x3308, 0x763: 0x3308, + 0x764: 0x0040, 0x765: 0x0040, 0x766: 0x0008, 0x767: 0x0008, 0x768: 0x0008, 0x769: 0x0008, + 0x76a: 0x0008, 0x76b: 0x0008, 0x76c: 0x0008, 0x76d: 0x0008, 0x76e: 0x0008, 0x76f: 0x0008, + 0x770: 0x0018, 0x771: 0x0018, 0x772: 0x0040, 0x773: 0x0040, 0x774: 0x0040, 0x775: 0x0040, + 0x776: 0x0040, 0x777: 0x0040, 0x778: 0x0040, 0x779: 0x0008, 0x77a: 0x3308, 0x77b: 0x3308, + 0x77c: 0x3308, 0x77d: 0x3308, 0x77e: 0x3308, 0x77f: 0x3308, + // Block 0x1e, offset 0x780 + 0x780: 0x0040, 0x781: 0x3308, 0x782: 0x3008, 0x783: 0x3008, 0x784: 0x0040, 0x785: 0x0008, + 0x786: 0x0008, 0x787: 0x0008, 0x788: 0x0008, 0x789: 0x0008, 0x78a: 0x0008, 0x78b: 0x0008, + 0x78c: 0x0008, 0x78d: 0x0040, 0x78e: 0x0040, 0x78f: 0x0008, 0x790: 0x0008, 0x791: 0x0040, + 0x792: 0x0040, 0x793: 0x0008, 0x794: 0x0008, 0x795: 0x0008, 0x796: 0x0008, 0x797: 0x0008, + 0x798: 0x0008, 0x799: 0x0008, 0x79a: 0x0008, 0x79b: 0x0008, 0x79c: 0x0008, 0x79d: 0x0008, + 0x79e: 0x0008, 0x79f: 0x0008, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x0008, 0x7a3: 0x0008, + 0x7a4: 0x0008, 0x7a5: 0x0008, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0040, + 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, + 0x7b0: 0x0008, 0x7b1: 0x0040, 0x7b2: 0x0008, 0x7b3: 0x0008, 0x7b4: 0x0040, 0x7b5: 0x0008, + 0x7b6: 0x0008, 0x7b7: 0x0008, 0x7b8: 0x0008, 0x7b9: 0x0008, 0x7ba: 0x0040, 0x7bb: 0x0040, + 0x7bc: 0x3308, 0x7bd: 0x0008, 0x7be: 0x3008, 0x7bf: 0x3308, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x3008, 0x7c1: 0x3308, 0x7c2: 0x3308, 0x7c3: 0x3308, 0x7c4: 0x3308, 0x7c5: 0x0040, + 0x7c6: 0x0040, 0x7c7: 0x3008, 0x7c8: 0x3008, 0x7c9: 0x0040, 0x7ca: 0x0040, 0x7cb: 0x3008, + 0x7cc: 0x3008, 0x7cd: 0x3b08, 0x7ce: 0x0040, 0x7cf: 0x0040, 0x7d0: 0x0040, 0x7d1: 0x0040, + 0x7d2: 0x0040, 0x7d3: 0x0040, 0x7d4: 0x0040, 0x7d5: 0x3308, 0x7d6: 0x3308, 0x7d7: 0x3008, + 0x7d8: 0x0040, 0x7d9: 0x0040, 0x7da: 0x0040, 0x7db: 0x0040, 0x7dc: 0x01e1, 0x7dd: 0x01e9, + 0x7de: 0x0040, 0x7df: 0x0008, 0x7e0: 0x0008, 0x7e1: 0x0008, 0x7e2: 0x3308, 0x7e3: 0x3308, + 0x7e4: 0x0040, 0x7e5: 0x0040, 0x7e6: 0x0008, 0x7e7: 0x0008, 0x7e8: 0x0008, 0x7e9: 0x0008, + 0x7ea: 0x0008, 0x7eb: 0x0008, 0x7ec: 0x0008, 0x7ed: 0x0008, 0x7ee: 0x0008, 0x7ef: 0x0008, + 0x7f0: 0x0018, 0x7f1: 0x0008, 0x7f2: 0x0018, 0x7f3: 0x0018, 0x7f4: 0x0018, 0x7f5: 0x0018, + 0x7f6: 0x0018, 0x7f7: 0x0018, 0x7f8: 0x0040, 0x7f9: 0x0040, 0x7fa: 0x0040, 0x7fb: 0x0040, + 0x7fc: 0x0040, 0x7fd: 0x0040, 0x7fe: 0x0040, 0x7ff: 0x0040, + // Block 0x20, offset 0x800 + 0x800: 0x0040, 0x801: 0x0040, 0x802: 0x3308, 0x803: 0x0008, 0x804: 0x0040, 0x805: 0x0008, + 0x806: 0x0008, 0x807: 0x0008, 0x808: 0x0008, 0x809: 0x0008, 0x80a: 0x0008, 0x80b: 0x0040, + 0x80c: 0x0040, 0x80d: 0x0040, 0x80e: 0x0008, 0x80f: 0x0008, 0x810: 0x0008, 0x811: 0x0040, + 0x812: 0x0008, 0x813: 0x0008, 0x814: 0x0008, 0x815: 0x0008, 0x816: 0x0040, 0x817: 0x0040, + 0x818: 0x0040, 0x819: 0x0008, 0x81a: 0x0008, 0x81b: 0x0040, 0x81c: 0x0008, 0x81d: 0x0040, + 0x81e: 0x0008, 0x81f: 0x0008, 0x820: 0x0040, 0x821: 0x0040, 0x822: 0x0040, 0x823: 0x0008, + 0x824: 0x0008, 0x825: 0x0040, 0x826: 0x0040, 0x827: 0x0040, 0x828: 0x0008, 0x829: 0x0008, + 0x82a: 0x0008, 0x82b: 0x0040, 0x82c: 0x0040, 0x82d: 0x0040, 0x82e: 0x0008, 0x82f: 0x0008, + 0x830: 0x0008, 0x831: 0x0008, 0x832: 0x0008, 0x833: 0x0008, 0x834: 0x0008, 0x835: 0x0008, + 0x836: 0x0008, 0x837: 0x0008, 0x838: 0x0008, 0x839: 0x0008, 0x83a: 0x0040, 0x83b: 0x0040, + 0x83c: 0x0040, 0x83d: 0x0040, 0x83e: 0x3008, 0x83f: 0x3008, + // Block 0x21, offset 0x840 + 0x840: 0x3308, 0x841: 0x3008, 0x842: 0x3008, 0x843: 0x3008, 0x844: 0x3008, 0x845: 0x0040, + 0x846: 0x3308, 0x847: 0x3308, 0x848: 0x3308, 0x849: 0x0040, 0x84a: 0x3308, 0x84b: 0x3308, + 0x84c: 0x3308, 0x84d: 0x3b08, 0x84e: 0x0040, 0x84f: 0x0040, 0x850: 0x0040, 0x851: 0x0040, + 0x852: 0x0040, 0x853: 0x0040, 0x854: 0x0040, 0x855: 0x3308, 0x856: 0x3308, 0x857: 0x0040, + 0x858: 0x0008, 0x859: 0x0008, 0x85a: 0x0008, 0x85b: 0x0040, 0x85c: 0x0040, 0x85d: 0x0008, + 0x85e: 0x0040, 0x85f: 0x0040, 0x860: 0x0008, 0x861: 0x0008, 0x862: 0x3308, 0x863: 0x3308, + 0x864: 0x0040, 0x865: 0x0040, 0x866: 0x0008, 0x867: 0x0008, 0x868: 0x0008, 0x869: 0x0008, + 0x86a: 0x0008, 0x86b: 0x0008, 0x86c: 0x0008, 0x86d: 0x0008, 0x86e: 0x0008, 0x86f: 0x0008, + 0x870: 0x0040, 0x871: 0x0040, 0x872: 0x0040, 0x873: 0x0040, 0x874: 0x0040, 0x875: 0x0040, + 0x876: 0x0040, 0x877: 0x0018, 0x878: 0x0018, 0x879: 0x0018, 0x87a: 0x0018, 0x87b: 0x0018, + 0x87c: 0x0018, 0x87d: 0x0018, 0x87e: 0x0018, 0x87f: 0x0018, + // Block 0x22, offset 0x880 + 0x880: 0x0008, 0x881: 0x3308, 0x882: 0x3008, 0x883: 0x3008, 0x884: 0x0018, 0x885: 0x0008, + 0x886: 0x0008, 0x887: 0x0008, 0x888: 0x0008, 0x889: 0x0008, 0x88a: 0x0008, 0x88b: 0x0008, + 0x88c: 0x0008, 0x88d: 0x0040, 0x88e: 0x0008, 0x88f: 0x0008, 0x890: 0x0008, 0x891: 0x0040, + 0x892: 0x0008, 0x893: 0x0008, 0x894: 0x0008, 0x895: 0x0008, 0x896: 0x0008, 0x897: 0x0008, + 0x898: 0x0008, 0x899: 0x0008, 0x89a: 0x0008, 0x89b: 0x0008, 0x89c: 0x0008, 0x89d: 0x0008, + 0x89e: 0x0008, 0x89f: 0x0008, 0x8a0: 0x0008, 0x8a1: 0x0008, 0x8a2: 0x0008, 0x8a3: 0x0008, + 0x8a4: 0x0008, 0x8a5: 0x0008, 0x8a6: 0x0008, 0x8a7: 0x0008, 0x8a8: 0x0008, 0x8a9: 0x0040, + 0x8aa: 0x0008, 0x8ab: 0x0008, 0x8ac: 0x0008, 0x8ad: 0x0008, 0x8ae: 0x0008, 0x8af: 0x0008, + 0x8b0: 0x0008, 0x8b1: 0x0008, 0x8b2: 0x0008, 0x8b3: 0x0008, 0x8b4: 0x0040, 0x8b5: 0x0008, + 0x8b6: 0x0008, 0x8b7: 0x0008, 0x8b8: 0x0008, 0x8b9: 0x0008, 0x8ba: 0x0040, 0x8bb: 0x0040, + 0x8bc: 0x3308, 0x8bd: 0x0008, 0x8be: 0x3008, 0x8bf: 0x3308, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x3008, 0x8c1: 0x3008, 0x8c2: 0x3008, 0x8c3: 0x3008, 0x8c4: 0x3008, 0x8c5: 0x0040, + 0x8c6: 0x3308, 0x8c7: 0x3008, 0x8c8: 0x3008, 0x8c9: 0x0040, 0x8ca: 0x3008, 0x8cb: 0x3008, + 0x8cc: 0x3308, 0x8cd: 0x3b08, 0x8ce: 0x0040, 0x8cf: 0x0040, 0x8d0: 0x0040, 0x8d1: 0x0040, + 0x8d2: 0x0040, 0x8d3: 0x0040, 0x8d4: 0x0040, 0x8d5: 0x3008, 0x8d6: 0x3008, 0x8d7: 0x0040, + 0x8d8: 0x0040, 0x8d9: 0x0040, 0x8da: 0x0040, 0x8db: 0x0040, 0x8dc: 0x0040, 0x8dd: 0x0008, + 0x8de: 0x0008, 0x8df: 0x0040, 0x8e0: 0x0008, 0x8e1: 0x0008, 0x8e2: 0x3308, 0x8e3: 0x3308, + 0x8e4: 0x0040, 0x8e5: 0x0040, 0x8e6: 0x0008, 0x8e7: 0x0008, 0x8e8: 0x0008, 0x8e9: 0x0008, + 0x8ea: 0x0008, 0x8eb: 0x0008, 0x8ec: 0x0008, 0x8ed: 0x0008, 0x8ee: 0x0008, 0x8ef: 0x0008, + 0x8f0: 0x0040, 0x8f1: 0x0008, 0x8f2: 0x0008, 0x8f3: 0x3008, 0x8f4: 0x0040, 0x8f5: 0x0040, + 0x8f6: 0x0040, 0x8f7: 0x0040, 0x8f8: 0x0040, 0x8f9: 0x0040, 0x8fa: 0x0040, 0x8fb: 0x0040, + 0x8fc: 0x0040, 0x8fd: 0x0040, 0x8fe: 0x0040, 0x8ff: 0x0040, + // Block 0x24, offset 0x900 + 0x900: 0x3008, 0x901: 0x3308, 0x902: 0x3308, 0x903: 0x3308, 0x904: 0x3308, 0x905: 0x0040, + 0x906: 0x3008, 0x907: 0x3008, 0x908: 0x3008, 0x909: 0x0040, 0x90a: 0x3008, 0x90b: 0x3008, + 0x90c: 0x3008, 0x90d: 0x3b08, 0x90e: 0x0008, 0x90f: 0x0018, 0x910: 0x0040, 0x911: 0x0040, + 0x912: 0x0040, 0x913: 0x0040, 0x914: 0x0008, 0x915: 0x0008, 0x916: 0x0008, 0x917: 0x3008, + 0x918: 0x0018, 0x919: 0x0018, 0x91a: 0x0018, 0x91b: 0x0018, 0x91c: 0x0018, 0x91d: 0x0018, + 0x91e: 0x0018, 0x91f: 0x0008, 0x920: 0x0008, 0x921: 0x0008, 0x922: 0x3308, 0x923: 0x3308, + 0x924: 0x0040, 0x925: 0x0040, 0x926: 0x0008, 0x927: 0x0008, 0x928: 0x0008, 0x929: 0x0008, + 0x92a: 0x0008, 0x92b: 0x0008, 0x92c: 0x0008, 0x92d: 0x0008, 0x92e: 0x0008, 0x92f: 0x0008, + 0x930: 0x0018, 0x931: 0x0018, 0x932: 0x0018, 0x933: 0x0018, 0x934: 0x0018, 0x935: 0x0018, + 0x936: 0x0018, 0x937: 0x0018, 0x938: 0x0018, 0x939: 0x0018, 0x93a: 0x0008, 0x93b: 0x0008, + 0x93c: 0x0008, 0x93d: 0x0008, 0x93e: 0x0008, 0x93f: 0x0008, + // Block 0x25, offset 0x940 + 0x940: 0x0040, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0040, 0x944: 0x0008, 0x945: 0x0040, + 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0008, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0040, + 0x94c: 0x0008, 0x94d: 0x0008, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0008, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0008, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0008, 0x95d: 0x0008, + 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, + 0x964: 0x0040, 0x965: 0x0008, 0x966: 0x0040, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0008, + 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0008, 0x96d: 0x0008, 0x96e: 0x0008, 0x96f: 0x0008, + 0x970: 0x0008, 0x971: 0x3308, 0x972: 0x0008, 0x973: 0x01f9, 0x974: 0x3308, 0x975: 0x3308, + 0x976: 0x3308, 0x977: 0x3308, 0x978: 0x3308, 0x979: 0x3308, 0x97a: 0x3b08, 0x97b: 0x3308, + 0x97c: 0x3308, 0x97d: 0x0008, 0x97e: 0x0040, 0x97f: 0x0040, + // Block 0x26, offset 0x980 + 0x980: 0x0008, 0x981: 0x0008, 0x982: 0x0008, 0x983: 0x0211, 0x984: 0x0008, 0x985: 0x0008, + 0x986: 0x0008, 0x987: 0x0008, 0x988: 0x0040, 0x989: 0x0008, 0x98a: 0x0008, 0x98b: 0x0008, + 0x98c: 0x0008, 0x98d: 0x0219, 0x98e: 0x0008, 0x98f: 0x0008, 0x990: 0x0008, 0x991: 0x0008, + 0x992: 0x0221, 0x993: 0x0008, 0x994: 0x0008, 0x995: 0x0008, 0x996: 0x0008, 0x997: 0x0229, + 0x998: 0x0008, 0x999: 0x0008, 0x99a: 0x0008, 0x99b: 0x0008, 0x99c: 0x0231, 0x99d: 0x0008, + 0x99e: 0x0008, 0x99f: 0x0008, 0x9a0: 0x0008, 0x9a1: 0x0008, 0x9a2: 0x0008, 0x9a3: 0x0008, + 0x9a4: 0x0008, 0x9a5: 0x0008, 0x9a6: 0x0008, 0x9a7: 0x0008, 0x9a8: 0x0008, 0x9a9: 0x0239, + 0x9aa: 0x0008, 0x9ab: 0x0008, 0x9ac: 0x0008, 0x9ad: 0x0040, 0x9ae: 0x0040, 0x9af: 0x0040, + 0x9b0: 0x0040, 0x9b1: 0x3308, 0x9b2: 0x3308, 0x9b3: 0x0241, 0x9b4: 0x3308, 0x9b5: 0x0249, + 0x9b6: 0x0251, 0x9b7: 0x0259, 0x9b8: 0x0261, 0x9b9: 0x0269, 0x9ba: 0x3308, 0x9bb: 0x3308, + 0x9bc: 0x3308, 0x9bd: 0x3308, 0x9be: 0x3308, 0x9bf: 0x3008, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x3308, 0x9c1: 0x0271, 0x9c2: 0x3308, 0x9c3: 0x3308, 0x9c4: 0x3b08, 0x9c5: 0x0018, + 0x9c6: 0x3308, 0x9c7: 0x3308, 0x9c8: 0x0008, 0x9c9: 0x0008, 0x9ca: 0x0008, 0x9cb: 0x0008, + 0x9cc: 0x0008, 0x9cd: 0x3308, 0x9ce: 0x3308, 0x9cf: 0x3308, 0x9d0: 0x3308, 0x9d1: 0x3308, + 0x9d2: 0x3308, 0x9d3: 0x0279, 0x9d4: 0x3308, 0x9d5: 0x3308, 0x9d6: 0x3308, 0x9d7: 0x3308, + 0x9d8: 0x0040, 0x9d9: 0x3308, 0x9da: 0x3308, 0x9db: 0x3308, 0x9dc: 0x3308, 0x9dd: 0x0281, + 0x9de: 0x3308, 0x9df: 0x3308, 0x9e0: 0x3308, 0x9e1: 0x3308, 0x9e2: 0x0289, 0x9e3: 0x3308, + 0x9e4: 0x3308, 0x9e5: 0x3308, 0x9e6: 0x3308, 0x9e7: 0x0291, 0x9e8: 0x3308, 0x9e9: 0x3308, + 0x9ea: 0x3308, 0x9eb: 0x3308, 0x9ec: 0x0299, 0x9ed: 0x3308, 0x9ee: 0x3308, 0x9ef: 0x3308, + 0x9f0: 0x3308, 0x9f1: 0x3308, 0x9f2: 0x3308, 0x9f3: 0x3308, 0x9f4: 0x3308, 0x9f5: 0x3308, + 0x9f6: 0x3308, 0x9f7: 0x3308, 0x9f8: 0x3308, 0x9f9: 0x02a1, 0x9fa: 0x3308, 0x9fb: 0x3308, + 0x9fc: 0x3308, 0x9fd: 0x0040, 0x9fe: 0x0018, 0x9ff: 0x0018, + // Block 0x28, offset 0xa00 + 0xa00: 0x0008, 0xa01: 0x0008, 0xa02: 0x0008, 0xa03: 0x0008, 0xa04: 0x0008, 0xa05: 0x0008, + 0xa06: 0x0008, 0xa07: 0x0008, 0xa08: 0x0008, 0xa09: 0x0008, 0xa0a: 0x0008, 0xa0b: 0x0008, + 0xa0c: 0x0008, 0xa0d: 0x0008, 0xa0e: 0x0008, 0xa0f: 0x0008, 0xa10: 0x0008, 0xa11: 0x0008, + 0xa12: 0x0008, 0xa13: 0x0008, 0xa14: 0x0008, 0xa15: 0x0008, 0xa16: 0x0008, 0xa17: 0x0008, + 0xa18: 0x0008, 0xa19: 0x0008, 0xa1a: 0x0008, 0xa1b: 0x0008, 0xa1c: 0x0008, 0xa1d: 0x0008, + 0xa1e: 0x0008, 0xa1f: 0x0008, 0xa20: 0x0008, 0xa21: 0x0008, 0xa22: 0x0008, 0xa23: 0x0008, + 0xa24: 0x0008, 0xa25: 0x0008, 0xa26: 0x0008, 0xa27: 0x0008, 0xa28: 0x0008, 0xa29: 0x0008, + 0xa2a: 0x0008, 0xa2b: 0x0008, 0xa2c: 0x0019, 0xa2d: 0x02e1, 0xa2e: 0x02e9, 0xa2f: 0x0008, + 0xa30: 0x02f1, 0xa31: 0x02f9, 0xa32: 0x0301, 0xa33: 0x0309, 0xa34: 0x00a9, 0xa35: 0x0311, + 0xa36: 0x00b1, 0xa37: 0x0319, 0xa38: 0x0101, 0xa39: 0x0321, 0xa3a: 0x0329, 0xa3b: 0x0008, + 0xa3c: 0x0051, 0xa3d: 0x0331, 0xa3e: 0x0339, 0xa3f: 0x00b9, + // Block 0x29, offset 0xa40 + 0xa40: 0x0341, 0xa41: 0x0349, 0xa42: 0x00c1, 0xa43: 0x0019, 0xa44: 0x0351, 0xa45: 0x0359, + 0xa46: 0x05b5, 0xa47: 0x02e9, 0xa48: 0x02f1, 0xa49: 0x02f9, 0xa4a: 0x0361, 0xa4b: 0x0369, + 0xa4c: 0x0371, 0xa4d: 0x0309, 0xa4e: 0x0008, 0xa4f: 0x0319, 0xa50: 0x0321, 0xa51: 0x0379, + 0xa52: 0x0051, 0xa53: 0x0381, 0xa54: 0x05cd, 0xa55: 0x05cd, 0xa56: 0x0339, 0xa57: 0x0341, + 0xa58: 0x0349, 0xa59: 0x05b5, 0xa5a: 0x0389, 0xa5b: 0x0391, 0xa5c: 0x05e5, 0xa5d: 0x0399, + 0xa5e: 0x03a1, 0xa5f: 0x03a9, 0xa60: 0x03b1, 0xa61: 0x03b9, 0xa62: 0x0311, 0xa63: 0x00b9, + 0xa64: 0x0349, 0xa65: 0x0391, 0xa66: 0x0399, 0xa67: 0x03a1, 0xa68: 0x03c1, 0xa69: 0x03b1, + 0xa6a: 0x03b9, 0xa6b: 0x0008, 0xa6c: 0x0008, 0xa6d: 0x0008, 0xa6e: 0x0008, 0xa6f: 0x0008, + 0xa70: 0x0008, 0xa71: 0x0008, 0xa72: 0x0008, 0xa73: 0x0008, 0xa74: 0x0008, 0xa75: 0x0008, + 0xa76: 0x0008, 0xa77: 0x0008, 0xa78: 0x03c9, 0xa79: 0x0008, 0xa7a: 0x0008, 0xa7b: 0x0008, + 0xa7c: 0x0008, 0xa7d: 0x0008, 0xa7e: 0x0008, 0xa7f: 0x0008, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0008, 0xa81: 0x0008, 0xa82: 0x0008, 0xa83: 0x0008, 0xa84: 0x0008, 0xa85: 0x0008, + 0xa86: 0x0008, 0xa87: 0x0008, 0xa88: 0x0008, 0xa89: 0x0008, 0xa8a: 0x0008, 0xa8b: 0x0008, + 0xa8c: 0x0008, 0xa8d: 0x0008, 0xa8e: 0x0008, 0xa8f: 0x0008, 0xa90: 0x0008, 0xa91: 0x0008, + 0xa92: 0x0008, 0xa93: 0x0008, 0xa94: 0x0008, 0xa95: 0x0008, 0xa96: 0x0008, 0xa97: 0x0008, + 0xa98: 0x0008, 0xa99: 0x0008, 0xa9a: 0x0008, 0xa9b: 0x03d1, 0xa9c: 0x03d9, 0xa9d: 0x03e1, + 0xa9e: 0x03e9, 0xa9f: 0x0371, 0xaa0: 0x03f1, 0xaa1: 0x03f9, 0xaa2: 0x0401, 0xaa3: 0x0409, + 0xaa4: 0x0411, 0xaa5: 0x0419, 0xaa6: 0x0421, 0xaa7: 0x05fd, 0xaa8: 0x0429, 0xaa9: 0x0431, + 0xaaa: 0xe17d, 0xaab: 0x0439, 0xaac: 0x0441, 0xaad: 0x0449, 0xaae: 0x0451, 0xaaf: 0x0459, + 0xab0: 0x0461, 0xab1: 0x0469, 0xab2: 0x0471, 0xab3: 0x0479, 0xab4: 0x0481, 0xab5: 0x0489, + 0xab6: 0x0491, 0xab7: 0x0499, 0xab8: 0x0615, 0xab9: 0x04a1, 0xaba: 0x04a9, 0xabb: 0x04b1, + 0xabc: 0x04b9, 0xabd: 0x04c1, 0xabe: 0x04c9, 0xabf: 0x04d1, + // Block 0x2b, offset 0xac0 + 0xac0: 0xe00d, 0xac1: 0x0008, 0xac2: 0xe00d, 0xac3: 0x0008, 0xac4: 0xe00d, 0xac5: 0x0008, + 0xac6: 0xe00d, 0xac7: 0x0008, 0xac8: 0xe00d, 0xac9: 0x0008, 0xaca: 0xe00d, 0xacb: 0x0008, + 0xacc: 0xe00d, 0xacd: 0x0008, 0xace: 0xe00d, 0xacf: 0x0008, 0xad0: 0xe00d, 0xad1: 0x0008, + 0xad2: 0xe00d, 0xad3: 0x0008, 0xad4: 0xe00d, 0xad5: 0x0008, 0xad6: 0xe00d, 0xad7: 0x0008, + 0xad8: 0xe00d, 0xad9: 0x0008, 0xada: 0xe00d, 0xadb: 0x0008, 0xadc: 0xe00d, 0xadd: 0x0008, + 0xade: 0xe00d, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, + 0xae4: 0xe00d, 0xae5: 0x0008, 0xae6: 0xe00d, 0xae7: 0x0008, 0xae8: 0xe00d, 0xae9: 0x0008, + 0xaea: 0xe00d, 0xaeb: 0x0008, 0xaec: 0xe00d, 0xaed: 0x0008, 0xaee: 0xe00d, 0xaef: 0x0008, + 0xaf0: 0xe00d, 0xaf1: 0x0008, 0xaf2: 0xe00d, 0xaf3: 0x0008, 0xaf4: 0xe00d, 0xaf5: 0x0008, + 0xaf6: 0xe00d, 0xaf7: 0x0008, 0xaf8: 0xe00d, 0xaf9: 0x0008, 0xafa: 0xe00d, 0xafb: 0x0008, + 0xafc: 0xe00d, 0xafd: 0x0008, 0xafe: 0xe00d, 0xaff: 0x0008, + // Block 0x2c, offset 0xb00 + 0xb00: 0xe00d, 0xb01: 0x0008, 0xb02: 0xe00d, 0xb03: 0x0008, 0xb04: 0xe00d, 0xb05: 0x0008, + 0xb06: 0xe00d, 0xb07: 0x0008, 0xb08: 0xe00d, 0xb09: 0x0008, 0xb0a: 0xe00d, 0xb0b: 0x0008, + 0xb0c: 0xe00d, 0xb0d: 0x0008, 0xb0e: 0xe00d, 0xb0f: 0x0008, 0xb10: 0xe00d, 0xb11: 0x0008, + 0xb12: 0xe00d, 0xb13: 0x0008, 0xb14: 0xe00d, 0xb15: 0x0008, 0xb16: 0x0008, 0xb17: 0x0008, + 0xb18: 0x0008, 0xb19: 0x0008, 0xb1a: 0x062d, 0xb1b: 0x064d, 0xb1c: 0x0008, 0xb1d: 0x0008, + 0xb1e: 0x04d9, 0xb1f: 0x0008, 0xb20: 0xe00d, 0xb21: 0x0008, 0xb22: 0xe00d, 0xb23: 0x0008, + 0xb24: 0xe00d, 0xb25: 0x0008, 0xb26: 0xe00d, 0xb27: 0x0008, 0xb28: 0xe00d, 0xb29: 0x0008, + 0xb2a: 0xe00d, 0xb2b: 0x0008, 0xb2c: 0xe00d, 0xb2d: 0x0008, 0xb2e: 0xe00d, 0xb2f: 0x0008, + 0xb30: 0xe00d, 0xb31: 0x0008, 0xb32: 0xe00d, 0xb33: 0x0008, 0xb34: 0xe00d, 0xb35: 0x0008, + 0xb36: 0xe00d, 0xb37: 0x0008, 0xb38: 0xe00d, 0xb39: 0x0008, 0xb3a: 0xe00d, 0xb3b: 0x0008, + 0xb3c: 0xe00d, 0xb3d: 0x0008, 0xb3e: 0xe00d, 0xb3f: 0x0008, + // Block 0x2d, offset 0xb40 + 0xb40: 0x0008, 0xb41: 0x0008, 0xb42: 0x0008, 0xb43: 0x0008, 0xb44: 0x0008, 0xb45: 0x0008, + 0xb46: 0x0040, 0xb47: 0x0040, 0xb48: 0xe045, 0xb49: 0xe045, 0xb4a: 0xe045, 0xb4b: 0xe045, + 0xb4c: 0xe045, 0xb4d: 0xe045, 0xb4e: 0x0040, 0xb4f: 0x0040, 0xb50: 0x0008, 0xb51: 0x0008, + 0xb52: 0x0008, 0xb53: 0x0008, 0xb54: 0x0008, 0xb55: 0x0008, 0xb56: 0x0008, 0xb57: 0x0008, + 0xb58: 0x0040, 0xb59: 0xe045, 0xb5a: 0x0040, 0xb5b: 0xe045, 0xb5c: 0x0040, 0xb5d: 0xe045, + 0xb5e: 0x0040, 0xb5f: 0xe045, 0xb60: 0x0008, 0xb61: 0x0008, 0xb62: 0x0008, 0xb63: 0x0008, + 0xb64: 0x0008, 0xb65: 0x0008, 0xb66: 0x0008, 0xb67: 0x0008, 0xb68: 0xe045, 0xb69: 0xe045, + 0xb6a: 0xe045, 0xb6b: 0xe045, 0xb6c: 0xe045, 0xb6d: 0xe045, 0xb6e: 0xe045, 0xb6f: 0xe045, + 0xb70: 0x0008, 0xb71: 0x04e1, 0xb72: 0x0008, 0xb73: 0x04e9, 0xb74: 0x0008, 0xb75: 0x04f1, + 0xb76: 0x0008, 0xb77: 0x04f9, 0xb78: 0x0008, 0xb79: 0x0501, 0xb7a: 0x0008, 0xb7b: 0x0509, + 0xb7c: 0x0008, 0xb7d: 0x0511, 0xb7e: 0x0040, 0xb7f: 0x0040, + // Block 0x2e, offset 0xb80 + 0xb80: 0x0519, 0xb81: 0x0521, 0xb82: 0x0529, 0xb83: 0x0531, 0xb84: 0x0539, 0xb85: 0x0541, + 0xb86: 0x0549, 0xb87: 0x0551, 0xb88: 0x0519, 0xb89: 0x0521, 0xb8a: 0x0529, 0xb8b: 0x0531, + 0xb8c: 0x0539, 0xb8d: 0x0541, 0xb8e: 0x0549, 0xb8f: 0x0551, 0xb90: 0x0559, 0xb91: 0x0561, + 0xb92: 0x0569, 0xb93: 0x0571, 0xb94: 0x0579, 0xb95: 0x0581, 0xb96: 0x0589, 0xb97: 0x0591, + 0xb98: 0x0559, 0xb99: 0x0561, 0xb9a: 0x0569, 0xb9b: 0x0571, 0xb9c: 0x0579, 0xb9d: 0x0581, + 0xb9e: 0x0589, 0xb9f: 0x0591, 0xba0: 0x0599, 0xba1: 0x05a1, 0xba2: 0x05a9, 0xba3: 0x05b1, + 0xba4: 0x05b9, 0xba5: 0x05c1, 0xba6: 0x05c9, 0xba7: 0x05d1, 0xba8: 0x0599, 0xba9: 0x05a1, + 0xbaa: 0x05a9, 0xbab: 0x05b1, 0xbac: 0x05b9, 0xbad: 0x05c1, 0xbae: 0x05c9, 0xbaf: 0x05d1, + 0xbb0: 0x0008, 0xbb1: 0x0008, 0xbb2: 0x05d9, 0xbb3: 0x05e1, 0xbb4: 0x05e9, 0xbb5: 0x0040, + 0xbb6: 0x0008, 0xbb7: 0x05f1, 0xbb8: 0xe045, 0xbb9: 0xe045, 0xbba: 0x0665, 0xbbb: 0x04e1, + 0xbbc: 0x05e1, 0xbbd: 0x067e, 0xbbe: 0x05f9, 0xbbf: 0x069e, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x06be, 0xbc1: 0x0602, 0xbc2: 0x0609, 0xbc3: 0x0611, 0xbc4: 0x0619, 0xbc5: 0x0040, + 0xbc6: 0x0008, 0xbc7: 0x0621, 0xbc8: 0x06dd, 0xbc9: 0x04e9, 0xbca: 0x06f5, 0xbcb: 0x04f1, + 0xbcc: 0x0611, 0xbcd: 0x062a, 0xbce: 0x0632, 0xbcf: 0x063a, 0xbd0: 0x0008, 0xbd1: 0x0008, + 0xbd2: 0x0008, 0xbd3: 0x0641, 0xbd4: 0x0040, 0xbd5: 0x0040, 0xbd6: 0x0008, 0xbd7: 0x0008, + 0xbd8: 0xe045, 0xbd9: 0xe045, 0xbda: 0x070d, 0xbdb: 0x04f9, 0xbdc: 0x0040, 0xbdd: 0x064a, + 0xbde: 0x0652, 0xbdf: 0x065a, 0xbe0: 0x0008, 0xbe1: 0x0008, 0xbe2: 0x0008, 0xbe3: 0x0661, + 0xbe4: 0x0008, 0xbe5: 0x0008, 0xbe6: 0x0008, 0xbe7: 0x0008, 0xbe8: 0xe045, 0xbe9: 0xe045, + 0xbea: 0x0725, 0xbeb: 0x0509, 0xbec: 0xe04d, 0xbed: 0x066a, 0xbee: 0x012a, 0xbef: 0x0672, + 0xbf0: 0x0040, 0xbf1: 0x0040, 0xbf2: 0x0679, 0xbf3: 0x0681, 0xbf4: 0x0689, 0xbf5: 0x0040, + 0xbf6: 0x0008, 0xbf7: 0x0691, 0xbf8: 0x073d, 0xbf9: 0x0501, 0xbfa: 0x0515, 0xbfb: 0x0511, + 0xbfc: 0x0681, 0xbfd: 0x0756, 0xbfe: 0x0776, 0xbff: 0x0040, + // Block 0x30, offset 0xc00 + 0xc00: 0x000a, 0xc01: 0x000a, 0xc02: 0x000a, 0xc03: 0x000a, 0xc04: 0x000a, 0xc05: 0x000a, + 0xc06: 0x000a, 0xc07: 0x000a, 0xc08: 0x000a, 0xc09: 0x000a, 0xc0a: 0x000a, 0xc0b: 0x03c0, + 0xc0c: 0x0003, 0xc0d: 0x0003, 0xc0e: 0x0340, 0xc0f: 0x0b40, 0xc10: 0x0018, 0xc11: 0xe00d, + 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x0796, + 0xc18: 0x0018, 0xc19: 0x0018, 0xc1a: 0x0018, 0xc1b: 0x0018, 0xc1c: 0x0018, 0xc1d: 0x0018, + 0xc1e: 0x0018, 0xc1f: 0x0018, 0xc20: 0x0018, 0xc21: 0x0018, 0xc22: 0x0018, 0xc23: 0x0018, + 0xc24: 0x0040, 0xc25: 0x0040, 0xc26: 0x0040, 0xc27: 0x0018, 0xc28: 0x0040, 0xc29: 0x0040, + 0xc2a: 0x0340, 0xc2b: 0x0340, 0xc2c: 0x0340, 0xc2d: 0x0340, 0xc2e: 0x0340, 0xc2f: 0x000a, + 0xc30: 0x0018, 0xc31: 0x0018, 0xc32: 0x0018, 0xc33: 0x0699, 0xc34: 0x06a1, 0xc35: 0x0018, + 0xc36: 0x06a9, 0xc37: 0x06b1, 0xc38: 0x0018, 0xc39: 0x0018, 0xc3a: 0x0018, 0xc3b: 0x0018, + 0xc3c: 0x06ba, 0xc3d: 0x0018, 0xc3e: 0x07b6, 0xc3f: 0x0018, + // Block 0x31, offset 0xc40 + 0xc40: 0x0018, 0xc41: 0x0018, 0xc42: 0x0018, 0xc43: 0x0018, 0xc44: 0x0018, 0xc45: 0x0018, + 0xc46: 0x0018, 0xc47: 0x06c2, 0xc48: 0x06ca, 0xc49: 0x06d2, 0xc4a: 0x0018, 0xc4b: 0x0018, + 0xc4c: 0x0018, 0xc4d: 0x0018, 0xc4e: 0x0018, 0xc4f: 0x0018, 0xc50: 0x0018, 0xc51: 0x0018, + 0xc52: 0x0018, 0xc53: 0x0018, 0xc54: 0x0018, 0xc55: 0x0018, 0xc56: 0x0018, 0xc57: 0x06d9, + 0xc58: 0x0018, 0xc59: 0x0018, 0xc5a: 0x0018, 0xc5b: 0x0018, 0xc5c: 0x0018, 0xc5d: 0x0018, + 0xc5e: 0x0018, 0xc5f: 0x000a, 0xc60: 0x03c0, 0xc61: 0x0340, 0xc62: 0x0340, 0xc63: 0x0340, + 0xc64: 0x03c0, 0xc65: 0x0040, 0xc66: 0x0040, 0xc67: 0x0040, 0xc68: 0x0040, 0xc69: 0x0040, + 0xc6a: 0x0340, 0xc6b: 0x0340, 0xc6c: 0x0340, 0xc6d: 0x0340, 0xc6e: 0x0340, 0xc6f: 0x0340, + 0xc70: 0x06e1, 0xc71: 0x0311, 0xc72: 0x0040, 0xc73: 0x0040, 0xc74: 0x06e9, 0xc75: 0x06f1, + 0xc76: 0x06f9, 0xc77: 0x0701, 0xc78: 0x0709, 0xc79: 0x0711, 0xc7a: 0x071a, 0xc7b: 0x07d5, + 0xc7c: 0x0722, 0xc7d: 0x072a, 0xc7e: 0x0732, 0xc7f: 0x0329, + // Block 0x32, offset 0xc80 + 0xc80: 0x06e1, 0xc81: 0x0049, 0xc82: 0x0029, 0xc83: 0x0031, 0xc84: 0x06e9, 0xc85: 0x06f1, + 0xc86: 0x06f9, 0xc87: 0x0701, 0xc88: 0x0709, 0xc89: 0x0711, 0xc8a: 0x071a, 0xc8b: 0x07ed, + 0xc8c: 0x0722, 0xc8d: 0x072a, 0xc8e: 0x0732, 0xc8f: 0x0040, 0xc90: 0x0019, 0xc91: 0x02f9, + 0xc92: 0x0051, 0xc93: 0x0109, 0xc94: 0x0361, 0xc95: 0x00a9, 0xc96: 0x0319, 0xc97: 0x0101, + 0xc98: 0x0321, 0xc99: 0x0329, 0xc9a: 0x0339, 0xc9b: 0x0089, 0xc9c: 0x0341, 0xc9d: 0x0040, + 0xc9e: 0x0040, 0xc9f: 0x0040, 0xca0: 0x0018, 0xca1: 0x0018, 0xca2: 0x0018, 0xca3: 0x0018, + 0xca4: 0x0018, 0xca5: 0x0018, 0xca6: 0x0018, 0xca7: 0x0018, 0xca8: 0x0739, 0xca9: 0x0018, + 0xcaa: 0x0018, 0xcab: 0x0018, 0xcac: 0x0018, 0xcad: 0x0018, 0xcae: 0x0018, 0xcaf: 0x0018, + 0xcb0: 0x0018, 0xcb1: 0x0018, 0xcb2: 0x0018, 0xcb3: 0x0018, 0xcb4: 0x0018, 0xcb5: 0x0018, + 0xcb6: 0x0018, 0xcb7: 0x0018, 0xcb8: 0x0018, 0xcb9: 0x0018, 0xcba: 0x0018, 0xcbb: 0x0018, + 0xcbc: 0x0018, 0xcbd: 0x0018, 0xcbe: 0x0018, 0xcbf: 0x0018, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x0806, 0xcc1: 0x0826, 0xcc2: 0x03d9, 0xcc3: 0x0845, 0xcc4: 0x0018, 0xcc5: 0x0866, + 0xcc6: 0x0886, 0xcc7: 0x0369, 0xcc8: 0x0018, 0xcc9: 0x08a5, 0xcca: 0x0309, 0xccb: 0x00a9, + 0xccc: 0x00a9, 0xccd: 0x00a9, 0xcce: 0x00a9, 0xccf: 0x0741, 0xcd0: 0x0311, 0xcd1: 0x0311, + 0xcd2: 0x0101, 0xcd3: 0x0101, 0xcd4: 0x0018, 0xcd5: 0x0329, 0xcd6: 0x0749, 0xcd7: 0x0018, + 0xcd8: 0x0018, 0xcd9: 0x0339, 0xcda: 0x0751, 0xcdb: 0x00b9, 0xcdc: 0x00b9, 0xcdd: 0x00b9, + 0xcde: 0x0018, 0xcdf: 0x0018, 0xce0: 0x0759, 0xce1: 0x08c5, 0xce2: 0x0761, 0xce3: 0x0018, + 0xce4: 0x04b1, 0xce5: 0x0018, 0xce6: 0x0769, 0xce7: 0x0018, 0xce8: 0x04b1, 0xce9: 0x0018, + 0xcea: 0x0319, 0xceb: 0x0771, 0xcec: 0x02e9, 0xced: 0x03d9, 0xcee: 0x0018, 0xcef: 0x02f9, + 0xcf0: 0x02f9, 0xcf1: 0x03f1, 0xcf2: 0x0040, 0xcf3: 0x0321, 0xcf4: 0x0051, 0xcf5: 0x0779, + 0xcf6: 0x0781, 0xcf7: 0x0789, 0xcf8: 0x0791, 0xcf9: 0x0311, 0xcfa: 0x0018, 0xcfb: 0x08e5, + 0xcfc: 0x0799, 0xcfd: 0x03a1, 0xcfe: 0x03a1, 0xcff: 0x0799, + // Block 0x34, offset 0xd00 + 0xd00: 0x0905, 0xd01: 0x0018, 0xd02: 0x0018, 0xd03: 0x0018, 0xd04: 0x0018, 0xd05: 0x02f1, + 0xd06: 0x02f1, 0xd07: 0x02f9, 0xd08: 0x0311, 0xd09: 0x00b1, 0xd0a: 0x0018, 0xd0b: 0x0018, + 0xd0c: 0x0018, 0xd0d: 0x0018, 0xd0e: 0x0008, 0xd0f: 0x0018, 0xd10: 0x07a1, 0xd11: 0x07a9, + 0xd12: 0x07b1, 0xd13: 0x07b9, 0xd14: 0x07c1, 0xd15: 0x07c9, 0xd16: 0x07d1, 0xd17: 0x07d9, + 0xd18: 0x07e1, 0xd19: 0x07e9, 0xd1a: 0x07f1, 0xd1b: 0x07f9, 0xd1c: 0x0801, 0xd1d: 0x0809, + 0xd1e: 0x0811, 0xd1f: 0x0819, 0xd20: 0x0311, 0xd21: 0x0821, 0xd22: 0x091d, 0xd23: 0x0829, + 0xd24: 0x0391, 0xd25: 0x0831, 0xd26: 0x093d, 0xd27: 0x0839, 0xd28: 0x0841, 0xd29: 0x0109, + 0xd2a: 0x0849, 0xd2b: 0x095d, 0xd2c: 0x0101, 0xd2d: 0x03d9, 0xd2e: 0x02f1, 0xd2f: 0x0321, + 0xd30: 0x0311, 0xd31: 0x0821, 0xd32: 0x097d, 0xd33: 0x0829, 0xd34: 0x0391, 0xd35: 0x0831, + 0xd36: 0x099d, 0xd37: 0x0839, 0xd38: 0x0841, 0xd39: 0x0109, 0xd3a: 0x0849, 0xd3b: 0x09bd, + 0xd3c: 0x0101, 0xd3d: 0x03d9, 0xd3e: 0x02f1, 0xd3f: 0x0321, + // Block 0x35, offset 0xd40 + 0xd40: 0x0018, 0xd41: 0x0018, 0xd42: 0x0018, 0xd43: 0x0018, 0xd44: 0x0018, 0xd45: 0x0018, + 0xd46: 0x0018, 0xd47: 0x0018, 0xd48: 0x0018, 0xd49: 0x0018, 0xd4a: 0x0018, 0xd4b: 0x0040, + 0xd4c: 0x0040, 0xd4d: 0x0040, 0xd4e: 0x0040, 0xd4f: 0x0040, 0xd50: 0x0040, 0xd51: 0x0040, + 0xd52: 0x0040, 0xd53: 0x0040, 0xd54: 0x0040, 0xd55: 0x0040, 0xd56: 0x0040, 0xd57: 0x0040, + 0xd58: 0x0040, 0xd59: 0x0040, 0xd5a: 0x0040, 0xd5b: 0x0040, 0xd5c: 0x0040, 0xd5d: 0x0040, + 0xd5e: 0x0040, 0xd5f: 0x0040, 0xd60: 0x0049, 0xd61: 0x0029, 0xd62: 0x0031, 0xd63: 0x06e9, + 0xd64: 0x06f1, 0xd65: 0x06f9, 0xd66: 0x0701, 0xd67: 0x0709, 0xd68: 0x0711, 0xd69: 0x0879, + 0xd6a: 0x0881, 0xd6b: 0x0889, 0xd6c: 0x0891, 0xd6d: 0x0899, 0xd6e: 0x08a1, 0xd6f: 0x08a9, + 0xd70: 0x08b1, 0xd71: 0x08b9, 0xd72: 0x08c1, 0xd73: 0x08c9, 0xd74: 0x0a1e, 0xd75: 0x0a3e, + 0xd76: 0x0a5e, 0xd77: 0x0a7e, 0xd78: 0x0a9e, 0xd79: 0x0abe, 0xd7a: 0x0ade, 0xd7b: 0x0afe, + 0xd7c: 0x0b1e, 0xd7d: 0x08d2, 0xd7e: 0x08da, 0xd7f: 0x08e2, + // Block 0x36, offset 0xd80 + 0xd80: 0x08ea, 0xd81: 0x08f2, 0xd82: 0x08fa, 0xd83: 0x0902, 0xd84: 0x090a, 0xd85: 0x0912, + 0xd86: 0x091a, 0xd87: 0x0922, 0xd88: 0x0040, 0xd89: 0x0040, 0xd8a: 0x0040, 0xd8b: 0x0040, + 0xd8c: 0x0040, 0xd8d: 0x0040, 0xd8e: 0x0040, 0xd8f: 0x0040, 0xd90: 0x0040, 0xd91: 0x0040, + 0xd92: 0x0040, 0xd93: 0x0040, 0xd94: 0x0040, 0xd95: 0x0040, 0xd96: 0x0040, 0xd97: 0x0040, + 0xd98: 0x0040, 0xd99: 0x0040, 0xd9a: 0x0040, 0xd9b: 0x0040, 0xd9c: 0x0b3e, 0xd9d: 0x0b5e, + 0xd9e: 0x0b7e, 0xd9f: 0x0b9e, 0xda0: 0x0bbe, 0xda1: 0x0bde, 0xda2: 0x0bfe, 0xda3: 0x0c1e, + 0xda4: 0x0c3e, 0xda5: 0x0c5e, 0xda6: 0x0c7e, 0xda7: 0x0c9e, 0xda8: 0x0cbe, 0xda9: 0x0cde, + 0xdaa: 0x0cfe, 0xdab: 0x0d1e, 0xdac: 0x0d3e, 0xdad: 0x0d5e, 0xdae: 0x0d7e, 0xdaf: 0x0d9e, + 0xdb0: 0x0dbe, 0xdb1: 0x0dde, 0xdb2: 0x0dfe, 0xdb3: 0x0e1e, 0xdb4: 0x0e3e, 0xdb5: 0x0e5e, + 0xdb6: 0x0019, 0xdb7: 0x02e9, 0xdb8: 0x03d9, 0xdb9: 0x02f1, 0xdba: 0x02f9, 0xdbb: 0x03f1, + 0xdbc: 0x0309, 0xdbd: 0x00a9, 0xdbe: 0x0311, 0xdbf: 0x00b1, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0319, 0xdc1: 0x0101, 0xdc2: 0x0321, 0xdc3: 0x0329, 0xdc4: 0x0051, 0xdc5: 0x0339, + 0xdc6: 0x0751, 0xdc7: 0x00b9, 0xdc8: 0x0089, 0xdc9: 0x0341, 0xdca: 0x0349, 0xdcb: 0x0391, + 0xdcc: 0x00c1, 0xdcd: 0x0109, 0xdce: 0x00c9, 0xdcf: 0x04b1, 0xdd0: 0x0019, 0xdd1: 0x02e9, + 0xdd2: 0x03d9, 0xdd3: 0x02f1, 0xdd4: 0x02f9, 0xdd5: 0x03f1, 0xdd6: 0x0309, 0xdd7: 0x00a9, + 0xdd8: 0x0311, 0xdd9: 0x00b1, 0xdda: 0x0319, 0xddb: 0x0101, 0xddc: 0x0321, 0xddd: 0x0329, + 0xdde: 0x0051, 0xddf: 0x0339, 0xde0: 0x0751, 0xde1: 0x00b9, 0xde2: 0x0089, 0xde3: 0x0341, + 0xde4: 0x0349, 0xde5: 0x0391, 0xde6: 0x00c1, 0xde7: 0x0109, 0xde8: 0x00c9, 0xde9: 0x04b1, + 0xdea: 0x06e1, 0xdeb: 0x0018, 0xdec: 0x0018, 0xded: 0x0018, 0xdee: 0x0018, 0xdef: 0x0018, + 0xdf0: 0x0018, 0xdf1: 0x0018, 0xdf2: 0x0018, 0xdf3: 0x0018, 0xdf4: 0x0018, 0xdf5: 0x0018, + 0xdf6: 0x0018, 0xdf7: 0x0018, 0xdf8: 0x0018, 0xdf9: 0x0018, 0xdfa: 0x0018, 0xdfb: 0x0018, + 0xdfc: 0x0018, 0xdfd: 0x0018, 0xdfe: 0x0018, 0xdff: 0x0018, + // Block 0x38, offset 0xe00 + 0xe00: 0x0008, 0xe01: 0x0008, 0xe02: 0x0008, 0xe03: 0x0008, 0xe04: 0x0008, 0xe05: 0x0008, + 0xe06: 0x0008, 0xe07: 0x0008, 0xe08: 0x0008, 0xe09: 0x0008, 0xe0a: 0x0008, 0xe0b: 0x0008, + 0xe0c: 0x0008, 0xe0d: 0x0008, 0xe0e: 0x0008, 0xe0f: 0x0008, 0xe10: 0x0008, 0xe11: 0x0008, + 0xe12: 0x0008, 0xe13: 0x0008, 0xe14: 0x0008, 0xe15: 0x0008, 0xe16: 0x0008, 0xe17: 0x0008, + 0xe18: 0x0008, 0xe19: 0x0008, 0xe1a: 0x0008, 0xe1b: 0x0008, 0xe1c: 0x0008, 0xe1d: 0x0008, + 0xe1e: 0x0008, 0xe1f: 0x0008, 0xe20: 0xe00d, 0xe21: 0x0008, 0xe22: 0x0941, 0xe23: 0x0ed5, + 0xe24: 0x0949, 0xe25: 0x0008, 0xe26: 0x0008, 0xe27: 0xe07d, 0xe28: 0x0008, 0xe29: 0xe01d, + 0xe2a: 0x0008, 0xe2b: 0xe03d, 0xe2c: 0x0008, 0xe2d: 0x0359, 0xe2e: 0x0441, 0xe2f: 0x0351, + 0xe30: 0x03d1, 0xe31: 0x0008, 0xe32: 0xe00d, 0xe33: 0x0008, 0xe34: 0x0008, 0xe35: 0xe01d, + 0xe36: 0x0008, 0xe37: 0x0008, 0xe38: 0x0008, 0xe39: 0x0008, 0xe3a: 0x0008, 0xe3b: 0x0008, + 0xe3c: 0x00b1, 0xe3d: 0x0391, 0xe3e: 0x0951, 0xe3f: 0x0959, + // Block 0x39, offset 0xe40 + 0xe40: 0xe00d, 0xe41: 0x0008, 0xe42: 0xe00d, 0xe43: 0x0008, 0xe44: 0xe00d, 0xe45: 0x0008, + 0xe46: 0xe00d, 0xe47: 0x0008, 0xe48: 0xe00d, 0xe49: 0x0008, 0xe4a: 0xe00d, 0xe4b: 0x0008, + 0xe4c: 0xe00d, 0xe4d: 0x0008, 0xe4e: 0xe00d, 0xe4f: 0x0008, 0xe50: 0xe00d, 0xe51: 0x0008, + 0xe52: 0xe00d, 0xe53: 0x0008, 0xe54: 0xe00d, 0xe55: 0x0008, 0xe56: 0xe00d, 0xe57: 0x0008, + 0xe58: 0xe00d, 0xe59: 0x0008, 0xe5a: 0xe00d, 0xe5b: 0x0008, 0xe5c: 0xe00d, 0xe5d: 0x0008, + 0xe5e: 0xe00d, 0xe5f: 0x0008, 0xe60: 0xe00d, 0xe61: 0x0008, 0xe62: 0xe00d, 0xe63: 0x0008, + 0xe64: 0x0008, 0xe65: 0x0018, 0xe66: 0x0018, 0xe67: 0x0018, 0xe68: 0x0018, 0xe69: 0x0018, + 0xe6a: 0x0018, 0xe6b: 0xe03d, 0xe6c: 0x0008, 0xe6d: 0xe01d, 0xe6e: 0x0008, 0xe6f: 0x3308, + 0xe70: 0x3308, 0xe71: 0x3308, 0xe72: 0xe00d, 0xe73: 0x0008, 0xe74: 0x0040, 0xe75: 0x0040, + 0xe76: 0x0040, 0xe77: 0x0040, 0xe78: 0x0040, 0xe79: 0x0018, 0xe7a: 0x0018, 0xe7b: 0x0018, + 0xe7c: 0x0018, 0xe7d: 0x0018, 0xe7e: 0x0018, 0xe7f: 0x0018, + // Block 0x3a, offset 0xe80 + 0xe80: 0x2715, 0xe81: 0x2735, 0xe82: 0x2755, 0xe83: 0x2775, 0xe84: 0x2795, 0xe85: 0x27b5, + 0xe86: 0x27d5, 0xe87: 0x27f5, 0xe88: 0x2815, 0xe89: 0x2835, 0xe8a: 0x2855, 0xe8b: 0x2875, + 0xe8c: 0x2895, 0xe8d: 0x28b5, 0xe8e: 0x28d5, 0xe8f: 0x28f5, 0xe90: 0x2915, 0xe91: 0x2935, + 0xe92: 0x2955, 0xe93: 0x2975, 0xe94: 0x2995, 0xe95: 0x29b5, 0xe96: 0x0040, 0xe97: 0x0040, + 0xe98: 0x0040, 0xe99: 0x0040, 0xe9a: 0x0040, 0xe9b: 0x0040, 0xe9c: 0x0040, 0xe9d: 0x0040, + 0xe9e: 0x0040, 0xe9f: 0x0040, 0xea0: 0x0040, 0xea1: 0x0040, 0xea2: 0x0040, 0xea3: 0x0040, + 0xea4: 0x0040, 0xea5: 0x0040, 0xea6: 0x0040, 0xea7: 0x0040, 0xea8: 0x0040, 0xea9: 0x0040, + 0xeaa: 0x0040, 0xeab: 0x0040, 0xeac: 0x0040, 0xead: 0x0040, 0xeae: 0x0040, 0xeaf: 0x0040, + 0xeb0: 0x0040, 0xeb1: 0x0040, 0xeb2: 0x0040, 0xeb3: 0x0040, 0xeb4: 0x0040, 0xeb5: 0x0040, + 0xeb6: 0x0040, 0xeb7: 0x0040, 0xeb8: 0x0040, 0xeb9: 0x0040, 0xeba: 0x0040, 0xebb: 0x0040, + 0xebc: 0x0040, 0xebd: 0x0040, 0xebe: 0x0040, 0xebf: 0x0040, + // Block 0x3b, offset 0xec0 + 0xec0: 0x000a, 0xec1: 0x0018, 0xec2: 0x0961, 0xec3: 0x0018, 0xec4: 0x0018, 0xec5: 0x0008, + 0xec6: 0x0008, 0xec7: 0x0008, 0xec8: 0x0018, 0xec9: 0x0018, 0xeca: 0x0018, 0xecb: 0x0018, + 0xecc: 0x0018, 0xecd: 0x0018, 0xece: 0x0018, 0xecf: 0x0018, 0xed0: 0x0018, 0xed1: 0x0018, + 0xed2: 0x0018, 0xed3: 0x0018, 0xed4: 0x0018, 0xed5: 0x0018, 0xed6: 0x0018, 0xed7: 0x0018, + 0xed8: 0x0018, 0xed9: 0x0018, 0xeda: 0x0018, 0xedb: 0x0018, 0xedc: 0x0018, 0xedd: 0x0018, + 0xede: 0x0018, 0xedf: 0x0018, 0xee0: 0x0018, 0xee1: 0x0018, 0xee2: 0x0018, 0xee3: 0x0018, + 0xee4: 0x0018, 0xee5: 0x0018, 0xee6: 0x0018, 0xee7: 0x0018, 0xee8: 0x0018, 0xee9: 0x0018, + 0xeea: 0x3308, 0xeeb: 0x3308, 0xeec: 0x3308, 0xeed: 0x3308, 0xeee: 0x3018, 0xeef: 0x3018, + 0xef0: 0x0018, 0xef1: 0x0018, 0xef2: 0x0018, 0xef3: 0x0018, 0xef4: 0x0018, 0xef5: 0x0018, + 0xef6: 0xe125, 0xef7: 0x0018, 0xef8: 0x29d5, 0xef9: 0x29f5, 0xefa: 0x2a15, 0xefb: 0x0018, + 0xefc: 0x0008, 0xefd: 0x0018, 0xefe: 0x0018, 0xeff: 0x0018, + // Block 0x3c, offset 0xf00 + 0xf00: 0x2b55, 0xf01: 0x2b75, 0xf02: 0x2b95, 0xf03: 0x2bb5, 0xf04: 0x2bd5, 0xf05: 0x2bf5, + 0xf06: 0x2bf5, 0xf07: 0x2bf5, 0xf08: 0x2c15, 0xf09: 0x2c15, 0xf0a: 0x2c15, 0xf0b: 0x2c15, + 0xf0c: 0x2c35, 0xf0d: 0x2c35, 0xf0e: 0x2c35, 0xf0f: 0x2c55, 0xf10: 0x2c75, 0xf11: 0x2c75, + 0xf12: 0x2a95, 0xf13: 0x2a95, 0xf14: 0x2c75, 0xf15: 0x2c75, 0xf16: 0x2c95, 0xf17: 0x2c95, + 0xf18: 0x2c75, 0xf19: 0x2c75, 0xf1a: 0x2a95, 0xf1b: 0x2a95, 0xf1c: 0x2c75, 0xf1d: 0x2c75, + 0xf1e: 0x2c55, 0xf1f: 0x2c55, 0xf20: 0x2cb5, 0xf21: 0x2cb5, 0xf22: 0x2cd5, 0xf23: 0x2cd5, + 0xf24: 0x0040, 0xf25: 0x2cf5, 0xf26: 0x2d15, 0xf27: 0x2d35, 0xf28: 0x2d35, 0xf29: 0x2d55, + 0xf2a: 0x2d75, 0xf2b: 0x2d95, 0xf2c: 0x2db5, 0xf2d: 0x2dd5, 0xf2e: 0x2df5, 0xf2f: 0x2e15, + 0xf30: 0x2e35, 0xf31: 0x2e55, 0xf32: 0x2e55, 0xf33: 0x2e75, 0xf34: 0x2e95, 0xf35: 0x2e95, + 0xf36: 0x2eb5, 0xf37: 0x2ed5, 0xf38: 0x2e75, 0xf39: 0x2ef5, 0xf3a: 0x2f15, 0xf3b: 0x2ef5, + 0xf3c: 0x2e75, 0xf3d: 0x2f35, 0xf3e: 0x2f55, 0xf3f: 0x2f75, + // Block 0x3d, offset 0xf40 + 0xf40: 0x2f95, 0xf41: 0x2fb5, 0xf42: 0x2d15, 0xf43: 0x2cf5, 0xf44: 0x2fd5, 0xf45: 0x2ff5, + 0xf46: 0x3015, 0xf47: 0x3035, 0xf48: 0x3055, 0xf49: 0x3075, 0xf4a: 0x3095, 0xf4b: 0x30b5, + 0xf4c: 0x30d5, 0xf4d: 0x30f5, 0xf4e: 0x3115, 0xf4f: 0x0040, 0xf50: 0x0018, 0xf51: 0x0018, + 0xf52: 0x3135, 0xf53: 0x3155, 0xf54: 0x3175, 0xf55: 0x3195, 0xf56: 0x31b5, 0xf57: 0x31d5, + 0xf58: 0x31f5, 0xf59: 0x3215, 0xf5a: 0x3235, 0xf5b: 0x3255, 0xf5c: 0x3175, 0xf5d: 0x3275, + 0xf5e: 0x3295, 0xf5f: 0x32b5, 0xf60: 0x0008, 0xf61: 0x0008, 0xf62: 0x0008, 0xf63: 0x0008, + 0xf64: 0x0008, 0xf65: 0x0008, 0xf66: 0x0008, 0xf67: 0x0008, 0xf68: 0x0008, 0xf69: 0x0008, + 0xf6a: 0x0008, 0xf6b: 0x0008, 0xf6c: 0x0008, 0xf6d: 0x0008, 0xf6e: 0x0008, 0xf6f: 0x0008, + 0xf70: 0x0008, 0xf71: 0x0008, 0xf72: 0x0008, 0xf73: 0x0008, 0xf74: 0x0008, 0xf75: 0x0008, + 0xf76: 0x0008, 0xf77: 0x0008, 0xf78: 0x0008, 0xf79: 0x0008, 0xf7a: 0x0008, 0xf7b: 0x0008, + 0xf7c: 0x0008, 0xf7d: 0x0008, 0xf7e: 0x0008, 0xf7f: 0x0008, + // Block 0x3e, offset 0xf80 + 0xf80: 0x0b82, 0xf81: 0x0b8a, 0xf82: 0x0b92, 0xf83: 0x0b9a, 0xf84: 0x32d5, 0xf85: 0x32f5, + 0xf86: 0x3315, 0xf87: 0x3335, 0xf88: 0x0018, 0xf89: 0x0018, 0xf8a: 0x0018, 0xf8b: 0x0018, + 0xf8c: 0x0018, 0xf8d: 0x0018, 0xf8e: 0x0018, 0xf8f: 0x0018, 0xf90: 0x3355, 0xf91: 0x0ba1, + 0xf92: 0x0ba9, 0xf93: 0x0bb1, 0xf94: 0x0bb9, 0xf95: 0x0bc1, 0xf96: 0x0bc9, 0xf97: 0x0bd1, + 0xf98: 0x0bd9, 0xf99: 0x0be1, 0xf9a: 0x0be9, 0xf9b: 0x0bf1, 0xf9c: 0x0bf9, 0xf9d: 0x0c01, + 0xf9e: 0x0c09, 0xf9f: 0x0c11, 0xfa0: 0x3375, 0xfa1: 0x3395, 0xfa2: 0x33b5, 0xfa3: 0x33d5, + 0xfa4: 0x33f5, 0xfa5: 0x33f5, 0xfa6: 0x3415, 0xfa7: 0x3435, 0xfa8: 0x3455, 0xfa9: 0x3475, + 0xfaa: 0x3495, 0xfab: 0x34b5, 0xfac: 0x34d5, 0xfad: 0x34f5, 0xfae: 0x3515, 0xfaf: 0x3535, + 0xfb0: 0x3555, 0xfb1: 0x3575, 0xfb2: 0x3595, 0xfb3: 0x35b5, 0xfb4: 0x35d5, 0xfb5: 0x35f5, + 0xfb6: 0x3615, 0xfb7: 0x3635, 0xfb8: 0x3655, 0xfb9: 0x3675, 0xfba: 0x3695, 0xfbb: 0x36b5, + 0xfbc: 0x0c19, 0xfbd: 0x0c21, 0xfbe: 0x36d5, 0xfbf: 0x0018, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x36f5, 0xfc1: 0x3715, 0xfc2: 0x3735, 0xfc3: 0x3755, 0xfc4: 0x3775, 0xfc5: 0x3795, + 0xfc6: 0x37b5, 0xfc7: 0x37d5, 0xfc8: 0x37f5, 0xfc9: 0x3815, 0xfca: 0x3835, 0xfcb: 0x3855, + 0xfcc: 0x3875, 0xfcd: 0x3895, 0xfce: 0x38b5, 0xfcf: 0x38d5, 0xfd0: 0x38f5, 0xfd1: 0x3915, + 0xfd2: 0x3935, 0xfd3: 0x3955, 0xfd4: 0x3975, 0xfd5: 0x3995, 0xfd6: 0x39b5, 0xfd7: 0x39d5, + 0xfd8: 0x39f5, 0xfd9: 0x3a15, 0xfda: 0x3a35, 0xfdb: 0x3a55, 0xfdc: 0x3a75, 0xfdd: 0x3a95, + 0xfde: 0x3ab5, 0xfdf: 0x3ad5, 0xfe0: 0x3af5, 0xfe1: 0x3b15, 0xfe2: 0x3b35, 0xfe3: 0x3b55, + 0xfe4: 0x3b75, 0xfe5: 0x3b95, 0xfe6: 0x1295, 0xfe7: 0x3bb5, 0xfe8: 0x3bd5, 0xfe9: 0x3bf5, + 0xfea: 0x3c15, 0xfeb: 0x3c35, 0xfec: 0x3c55, 0xfed: 0x3c75, 0xfee: 0x23b5, 0xfef: 0x3c95, + 0xff0: 0x3cb5, 0xff1: 0x0c29, 0xff2: 0x0c31, 0xff3: 0x0c39, 0xff4: 0x0c41, 0xff5: 0x0c49, + 0xff6: 0x0c51, 0xff7: 0x0c59, 0xff8: 0x0c61, 0xff9: 0x0c69, 0xffa: 0x0c71, 0xffb: 0x0c79, + 0xffc: 0x0c81, 0xffd: 0x0c89, 0xffe: 0x0c91, 0xfff: 0x0c99, + // Block 0x40, offset 0x1000 + 0x1000: 0x0ca1, 0x1001: 0x0ca9, 0x1002: 0x0cb1, 0x1003: 0x0cb9, 0x1004: 0x0cc1, 0x1005: 0x0cc9, + 0x1006: 0x0cd1, 0x1007: 0x0cd9, 0x1008: 0x0ce1, 0x1009: 0x0ce9, 0x100a: 0x0cf1, 0x100b: 0x0cf9, + 0x100c: 0x0d01, 0x100d: 0x3cd5, 0x100e: 0x0d09, 0x100f: 0x3cf5, 0x1010: 0x3d15, 0x1011: 0x3d2d, + 0x1012: 0x3d45, 0x1013: 0x3d5d, 0x1014: 0x3d75, 0x1015: 0x3d75, 0x1016: 0x3d5d, 0x1017: 0x3d8d, + 0x1018: 0x07d5, 0x1019: 0x3da5, 0x101a: 0x3dbd, 0x101b: 0x3dd5, 0x101c: 0x3ded, 0x101d: 0x3e05, + 0x101e: 0x3e1d, 0x101f: 0x3e35, 0x1020: 0x3e4d, 0x1021: 0x3e65, 0x1022: 0x3e7d, 0x1023: 0x3e95, + 0x1024: 0x3ead, 0x1025: 0x3ead, 0x1026: 0x3ec5, 0x1027: 0x3ec5, 0x1028: 0x3edd, 0x1029: 0x3edd, + 0x102a: 0x3ef5, 0x102b: 0x3f0d, 0x102c: 0x3f25, 0x102d: 0x3f3d, 0x102e: 0x3f55, 0x102f: 0x3f55, + 0x1030: 0x3f6d, 0x1031: 0x3f6d, 0x1032: 0x3f6d, 0x1033: 0x3f85, 0x1034: 0x3f9d, 0x1035: 0x3fb5, + 0x1036: 0x3fcd, 0x1037: 0x3fb5, 0x1038: 0x3fe5, 0x1039: 0x3ffd, 0x103a: 0x3f85, 0x103b: 0x4015, + 0x103c: 0x402d, 0x103d: 0x402d, 0x103e: 0x402d, 0x103f: 0x0d11, + // Block 0x41, offset 0x1040 + 0x1040: 0x10f9, 0x1041: 0x1101, 0x1042: 0x40a5, 0x1043: 0x1109, 0x1044: 0x1111, 0x1045: 0x1119, + 0x1046: 0x1121, 0x1047: 0x1129, 0x1048: 0x40c5, 0x1049: 0x1131, 0x104a: 0x1139, 0x104b: 0x1141, + 0x104c: 0x40e5, 0x104d: 0x40e5, 0x104e: 0x1149, 0x104f: 0x1151, 0x1050: 0x1159, 0x1051: 0x4105, + 0x1052: 0x4125, 0x1053: 0x4145, 0x1054: 0x4165, 0x1055: 0x4185, 0x1056: 0x1161, 0x1057: 0x1169, + 0x1058: 0x1171, 0x1059: 0x1179, 0x105a: 0x1181, 0x105b: 0x41a5, 0x105c: 0x1189, 0x105d: 0x1191, + 0x105e: 0x1199, 0x105f: 0x41c5, 0x1060: 0x41e5, 0x1061: 0x11a1, 0x1062: 0x4205, 0x1063: 0x4225, + 0x1064: 0x4245, 0x1065: 0x11a9, 0x1066: 0x4265, 0x1067: 0x11b1, 0x1068: 0x11b9, 0x1069: 0x10f9, + 0x106a: 0x4285, 0x106b: 0x42a5, 0x106c: 0x42c5, 0x106d: 0x42e5, 0x106e: 0x11c1, 0x106f: 0x11c9, + 0x1070: 0x11d1, 0x1071: 0x11d9, 0x1072: 0x4305, 0x1073: 0x11e1, 0x1074: 0x11e9, 0x1075: 0x11f1, + 0x1076: 0x4325, 0x1077: 0x11f9, 0x1078: 0x1201, 0x1079: 0x11f9, 0x107a: 0x1209, 0x107b: 0x1211, + 0x107c: 0x4345, 0x107d: 0x1219, 0x107e: 0x1221, 0x107f: 0x1219, + // Block 0x42, offset 0x1080 + 0x1080: 0x4365, 0x1081: 0x4385, 0x1082: 0x0040, 0x1083: 0x1229, 0x1084: 0x1231, 0x1085: 0x1239, + 0x1086: 0x1241, 0x1087: 0x0040, 0x1088: 0x1249, 0x1089: 0x1251, 0x108a: 0x1259, 0x108b: 0x1261, + 0x108c: 0x1269, 0x108d: 0x1271, 0x108e: 0x1199, 0x108f: 0x1279, 0x1090: 0x1281, 0x1091: 0x1289, + 0x1092: 0x43a5, 0x1093: 0x1291, 0x1094: 0x1121, 0x1095: 0x43c5, 0x1096: 0x43e5, 0x1097: 0x1299, + 0x1098: 0x0040, 0x1099: 0x4405, 0x109a: 0x12a1, 0x109b: 0x12a9, 0x109c: 0x12b1, 0x109d: 0x12b9, + 0x109e: 0x12c1, 0x109f: 0x12c9, 0x10a0: 0x12d1, 0x10a1: 0x12d9, 0x10a2: 0x12e1, 0x10a3: 0x12e9, + 0x10a4: 0x12f1, 0x10a5: 0x12f9, 0x10a6: 0x1301, 0x10a7: 0x1309, 0x10a8: 0x1311, 0x10a9: 0x1319, + 0x10aa: 0x1321, 0x10ab: 0x1329, 0x10ac: 0x1331, 0x10ad: 0x1339, 0x10ae: 0x1341, 0x10af: 0x1349, + 0x10b0: 0x1351, 0x10b1: 0x1359, 0x10b2: 0x1361, 0x10b3: 0x1369, 0x10b4: 0x1371, 0x10b5: 0x1379, + 0x10b6: 0x1381, 0x10b7: 0x1389, 0x10b8: 0x1391, 0x10b9: 0x1399, 0x10ba: 0x13a1, 0x10bb: 0x13a9, + 0x10bc: 0x13b1, 0x10bd: 0x13b9, 0x10be: 0x13c1, 0x10bf: 0x4425, + // Block 0x43, offset 0x10c0 + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0xe00d, 0x10dd: 0x0008, + 0x10de: 0xe00d, 0x10df: 0x0008, 0x10e0: 0xe00d, 0x10e1: 0x0008, 0x10e2: 0xe00d, 0x10e3: 0x0008, + 0x10e4: 0xe00d, 0x10e5: 0x0008, 0x10e6: 0xe00d, 0x10e7: 0x0008, 0x10e8: 0xe00d, 0x10e9: 0x0008, + 0x10ea: 0xe00d, 0x10eb: 0x0008, 0x10ec: 0xe00d, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x3308, + 0x10f0: 0x3318, 0x10f1: 0x3318, 0x10f2: 0x3318, 0x10f3: 0x0018, 0x10f4: 0x3308, 0x10f5: 0x3308, + 0x10f6: 0x3308, 0x10f7: 0x3308, 0x10f8: 0x3308, 0x10f9: 0x3308, 0x10fa: 0x3308, 0x10fb: 0x3308, + 0x10fc: 0x3308, 0x10fd: 0x3308, 0x10fe: 0x0018, 0x10ff: 0x0008, + // Block 0x44, offset 0x1100 + 0x1100: 0xe00d, 0x1101: 0x0008, 0x1102: 0xe00d, 0x1103: 0x0008, 0x1104: 0xe00d, 0x1105: 0x0008, + 0x1106: 0xe00d, 0x1107: 0x0008, 0x1108: 0xe00d, 0x1109: 0x0008, 0x110a: 0xe00d, 0x110b: 0x0008, + 0x110c: 0xe00d, 0x110d: 0x0008, 0x110e: 0xe00d, 0x110f: 0x0008, 0x1110: 0xe00d, 0x1111: 0x0008, + 0x1112: 0xe00d, 0x1113: 0x0008, 0x1114: 0xe00d, 0x1115: 0x0008, 0x1116: 0xe00d, 0x1117: 0x0008, + 0x1118: 0xe00d, 0x1119: 0x0008, 0x111a: 0xe00d, 0x111b: 0x0008, 0x111c: 0x02d1, 0x111d: 0x13c9, + 0x111e: 0x3308, 0x111f: 0x3308, 0x1120: 0x0008, 0x1121: 0x0008, 0x1122: 0x0008, 0x1123: 0x0008, + 0x1124: 0x0008, 0x1125: 0x0008, 0x1126: 0x0008, 0x1127: 0x0008, 0x1128: 0x0008, 0x1129: 0x0008, + 0x112a: 0x0008, 0x112b: 0x0008, 0x112c: 0x0008, 0x112d: 0x0008, 0x112e: 0x0008, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0x0008, 0x1133: 0x0008, 0x1134: 0x0008, 0x1135: 0x0008, + 0x1136: 0x0008, 0x1137: 0x0008, 0x1138: 0x0008, 0x1139: 0x0008, 0x113a: 0x0008, 0x113b: 0x0008, + 0x113c: 0x0008, 0x113d: 0x0008, 0x113e: 0x0008, 0x113f: 0x0008, + // Block 0x45, offset 0x1140 + 0x1140: 0x0018, 0x1141: 0x0018, 0x1142: 0x0018, 0x1143: 0x0018, 0x1144: 0x0018, 0x1145: 0x0018, + 0x1146: 0x0018, 0x1147: 0x0018, 0x1148: 0x0018, 0x1149: 0x0018, 0x114a: 0x0018, 0x114b: 0x0018, + 0x114c: 0x0018, 0x114d: 0x0018, 0x114e: 0x0018, 0x114f: 0x0018, 0x1150: 0x0018, 0x1151: 0x0018, + 0x1152: 0x0018, 0x1153: 0x0018, 0x1154: 0x0018, 0x1155: 0x0018, 0x1156: 0x0018, 0x1157: 0x0008, + 0x1158: 0x0008, 0x1159: 0x0008, 0x115a: 0x0008, 0x115b: 0x0008, 0x115c: 0x0008, 0x115d: 0x0008, + 0x115e: 0x0008, 0x115f: 0x0008, 0x1160: 0x0018, 0x1161: 0x0018, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0x0008, 0x1171: 0x0008, 0x1172: 0xe00d, 0x1173: 0x0008, 0x1174: 0xe00d, 0x1175: 0x0008, + 0x1176: 0xe00d, 0x1177: 0x0008, 0x1178: 0xe00d, 0x1179: 0x0008, 0x117a: 0xe00d, 0x117b: 0x0008, + 0x117c: 0xe00d, 0x117d: 0x0008, 0x117e: 0xe00d, 0x117f: 0x0008, + // Block 0x46, offset 0x1180 + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0xe00d, 0x1189: 0x0008, 0x118a: 0xe00d, 0x118b: 0x0008, + 0x118c: 0xe00d, 0x118d: 0x0008, 0x118e: 0xe00d, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0xe00d, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, + 0x11aa: 0xe00d, 0x11ab: 0x0008, 0x11ac: 0xe00d, 0x11ad: 0x0008, 0x11ae: 0xe00d, 0x11af: 0x0008, + 0x11b0: 0xe0fd, 0x11b1: 0x0008, 0x11b2: 0x0008, 0x11b3: 0x0008, 0x11b4: 0x0008, 0x11b5: 0x0008, + 0x11b6: 0x0008, 0x11b7: 0x0008, 0x11b8: 0x0008, 0x11b9: 0xe01d, 0x11ba: 0x0008, 0x11bb: 0xe03d, + 0x11bc: 0x0008, 0x11bd: 0x4445, 0x11be: 0xe00d, 0x11bf: 0x0008, + // Block 0x47, offset 0x11c0 + 0x11c0: 0xe00d, 0x11c1: 0x0008, 0x11c2: 0xe00d, 0x11c3: 0x0008, 0x11c4: 0xe00d, 0x11c5: 0x0008, + 0x11c6: 0xe00d, 0x11c7: 0x0008, 0x11c8: 0x0008, 0x11c9: 0x0018, 0x11ca: 0x0018, 0x11cb: 0xe03d, + 0x11cc: 0x0008, 0x11cd: 0x0409, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0xe00d, 0x11d1: 0x0008, + 0x11d2: 0xe00d, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x0008, 0x11d6: 0xe00d, 0x11d7: 0x0008, + 0x11d8: 0xe00d, 0x11d9: 0x0008, 0x11da: 0xe00d, 0x11db: 0x0008, 0x11dc: 0xe00d, 0x11dd: 0x0008, + 0x11de: 0xe00d, 0x11df: 0x0008, 0x11e0: 0xe00d, 0x11e1: 0x0008, 0x11e2: 0xe00d, 0x11e3: 0x0008, + 0x11e4: 0xe00d, 0x11e5: 0x0008, 0x11e6: 0xe00d, 0x11e7: 0x0008, 0x11e8: 0xe00d, 0x11e9: 0x0008, + 0x11ea: 0x13d1, 0x11eb: 0x0371, 0x11ec: 0x0401, 0x11ed: 0x13d9, 0x11ee: 0x0421, 0x11ef: 0x0008, + 0x11f0: 0x13e1, 0x11f1: 0x13e9, 0x11f2: 0x0429, 0x11f3: 0x4465, 0x11f4: 0xe00d, 0x11f5: 0x0008, + 0x11f6: 0xe00d, 0x11f7: 0x0008, 0x11f8: 0xe00d, 0x11f9: 0x0008, 0x11fa: 0xe00d, 0x11fb: 0x0008, + 0x11fc: 0xe00d, 0x11fd: 0x0008, 0x11fe: 0xe00d, 0x11ff: 0x0008, + // Block 0x48, offset 0x1200 + 0x1200: 0xe00d, 0x1201: 0x0008, 0x1202: 0xe00d, 0x1203: 0x0008, 0x1204: 0x03f5, 0x1205: 0x0479, + 0x1206: 0x447d, 0x1207: 0xe07d, 0x1208: 0x0008, 0x1209: 0xe01d, 0x120a: 0x0008, 0x120b: 0x0040, + 0x120c: 0x0040, 0x120d: 0x0040, 0x120e: 0x0040, 0x120f: 0x0040, 0x1210: 0xe00d, 0x1211: 0x0008, + 0x1212: 0x0040, 0x1213: 0x0008, 0x1214: 0x0040, 0x1215: 0x0008, 0x1216: 0xe00d, 0x1217: 0x0008, + 0x1218: 0xe00d, 0x1219: 0x0008, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x03d9, 0x1233: 0x03f1, 0x1234: 0x0751, 0x1235: 0xe01d, + 0x1236: 0x0008, 0x1237: 0x0008, 0x1238: 0x0741, 0x1239: 0x13f1, 0x123a: 0x0008, 0x123b: 0x0008, + 0x123c: 0x0008, 0x123d: 0x0008, 0x123e: 0x0008, 0x123f: 0x0008, + // Block 0x49, offset 0x1240 + 0x1240: 0x650d, 0x1241: 0x652d, 0x1242: 0x654d, 0x1243: 0x656d, 0x1244: 0x658d, 0x1245: 0x65ad, + 0x1246: 0x65cd, 0x1247: 0x65ed, 0x1248: 0x660d, 0x1249: 0x662d, 0x124a: 0x664d, 0x124b: 0x666d, + 0x124c: 0x668d, 0x124d: 0x66ad, 0x124e: 0x0008, 0x124f: 0x0008, 0x1250: 0x66cd, 0x1251: 0x0008, + 0x1252: 0x66ed, 0x1253: 0x0008, 0x1254: 0x0008, 0x1255: 0x670d, 0x1256: 0x672d, 0x1257: 0x674d, + 0x1258: 0x676d, 0x1259: 0x678d, 0x125a: 0x67ad, 0x125b: 0x67cd, 0x125c: 0x67ed, 0x125d: 0x680d, + 0x125e: 0x682d, 0x125f: 0x0008, 0x1260: 0x684d, 0x1261: 0x0008, 0x1262: 0x686d, 0x1263: 0x0008, + 0x1264: 0x0008, 0x1265: 0x688d, 0x1266: 0x68ad, 0x1267: 0x0008, 0x1268: 0x0008, 0x1269: 0x0008, + 0x126a: 0x68cd, 0x126b: 0x68ed, 0x126c: 0x690d, 0x126d: 0x692d, 0x126e: 0x694d, 0x126f: 0x696d, + 0x1270: 0x698d, 0x1271: 0x69ad, 0x1272: 0x69cd, 0x1273: 0x69ed, 0x1274: 0x6a0d, 0x1275: 0x6a2d, + 0x1276: 0x6a4d, 0x1277: 0x6a6d, 0x1278: 0x6a8d, 0x1279: 0x6aad, 0x127a: 0x6acd, 0x127b: 0x6aed, + 0x127c: 0x6b0d, 0x127d: 0x6b2d, 0x127e: 0x6b4d, 0x127f: 0x6b6d, + // Block 0x4a, offset 0x1280 + 0x1280: 0x7acd, 0x1281: 0x7aed, 0x1282: 0x7b0d, 0x1283: 0x7b2d, 0x1284: 0x7b4d, 0x1285: 0x7b6d, + 0x1286: 0x7b8d, 0x1287: 0x7bad, 0x1288: 0x7bcd, 0x1289: 0x7bed, 0x128a: 0x7c0d, 0x128b: 0x7c2d, + 0x128c: 0x7c4d, 0x128d: 0x7c6d, 0x128e: 0x7c8d, 0x128f: 0x1409, 0x1290: 0x1411, 0x1291: 0x1419, + 0x1292: 0x7cad, 0x1293: 0x7ccd, 0x1294: 0x7ced, 0x1295: 0x1421, 0x1296: 0x1429, 0x1297: 0x1431, + 0x1298: 0x7d0d, 0x1299: 0x7d2d, 0x129a: 0x0040, 0x129b: 0x0040, 0x129c: 0x0040, 0x129d: 0x0040, + 0x129e: 0x0040, 0x129f: 0x0040, 0x12a0: 0x0040, 0x12a1: 0x0040, 0x12a2: 0x0040, 0x12a3: 0x0040, + 0x12a4: 0x0040, 0x12a5: 0x0040, 0x12a6: 0x0040, 0x12a7: 0x0040, 0x12a8: 0x0040, 0x12a9: 0x0040, + 0x12aa: 0x0040, 0x12ab: 0x0040, 0x12ac: 0x0040, 0x12ad: 0x0040, 0x12ae: 0x0040, 0x12af: 0x0040, + 0x12b0: 0x0040, 0x12b1: 0x0040, 0x12b2: 0x0040, 0x12b3: 0x0040, 0x12b4: 0x0040, 0x12b5: 0x0040, + 0x12b6: 0x0040, 0x12b7: 0x0040, 0x12b8: 0x0040, 0x12b9: 0x0040, 0x12ba: 0x0040, 0x12bb: 0x0040, + 0x12bc: 0x0040, 0x12bd: 0x0040, 0x12be: 0x0040, 0x12bf: 0x0040, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x1439, 0x12c1: 0x1441, 0x12c2: 0x1449, 0x12c3: 0x7d4d, 0x12c4: 0x7d6d, 0x12c5: 0x1451, + 0x12c6: 0x1451, 0x12c7: 0x0040, 0x12c8: 0x0040, 0x12c9: 0x0040, 0x12ca: 0x0040, 0x12cb: 0x0040, + 0x12cc: 0x0040, 0x12cd: 0x0040, 0x12ce: 0x0040, 0x12cf: 0x0040, 0x12d0: 0x0040, 0x12d1: 0x0040, + 0x12d2: 0x0040, 0x12d3: 0x1459, 0x12d4: 0x1461, 0x12d5: 0x1469, 0x12d6: 0x1471, 0x12d7: 0x1479, + 0x12d8: 0x0040, 0x12d9: 0x0040, 0x12da: 0x0040, 0x12db: 0x0040, 0x12dc: 0x0040, 0x12dd: 0x1481, + 0x12de: 0x3308, 0x12df: 0x1489, 0x12e0: 0x1491, 0x12e1: 0x0779, 0x12e2: 0x0791, 0x12e3: 0x1499, + 0x12e4: 0x14a1, 0x12e5: 0x14a9, 0x12e6: 0x14b1, 0x12e7: 0x14b9, 0x12e8: 0x14c1, 0x12e9: 0x071a, + 0x12ea: 0x14c9, 0x12eb: 0x14d1, 0x12ec: 0x14d9, 0x12ed: 0x14e1, 0x12ee: 0x14e9, 0x12ef: 0x14f1, + 0x12f0: 0x14f9, 0x12f1: 0x1501, 0x12f2: 0x1509, 0x12f3: 0x1511, 0x12f4: 0x1519, 0x12f5: 0x1521, + 0x12f6: 0x1529, 0x12f7: 0x0040, 0x12f8: 0x1531, 0x12f9: 0x1539, 0x12fa: 0x1541, 0x12fb: 0x1549, + 0x12fc: 0x1551, 0x12fd: 0x0040, 0x12fe: 0x1559, 0x12ff: 0x0040, + // Block 0x4c, offset 0x1300 + 0x1300: 0x1561, 0x1301: 0x1569, 0x1302: 0x0040, 0x1303: 0x1571, 0x1304: 0x1579, 0x1305: 0x0040, + 0x1306: 0x1581, 0x1307: 0x1589, 0x1308: 0x1591, 0x1309: 0x1599, 0x130a: 0x15a1, 0x130b: 0x15a9, + 0x130c: 0x15b1, 0x130d: 0x15b9, 0x130e: 0x15c1, 0x130f: 0x15c9, 0x1310: 0x15d1, 0x1311: 0x15d1, + 0x1312: 0x15d9, 0x1313: 0x15d9, 0x1314: 0x15d9, 0x1315: 0x15d9, 0x1316: 0x15e1, 0x1317: 0x15e1, + 0x1318: 0x15e1, 0x1319: 0x15e1, 0x131a: 0x15e9, 0x131b: 0x15e9, 0x131c: 0x15e9, 0x131d: 0x15e9, + 0x131e: 0x15f1, 0x131f: 0x15f1, 0x1320: 0x15f1, 0x1321: 0x15f1, 0x1322: 0x15f9, 0x1323: 0x15f9, + 0x1324: 0x15f9, 0x1325: 0x15f9, 0x1326: 0x1601, 0x1327: 0x1601, 0x1328: 0x1601, 0x1329: 0x1601, + 0x132a: 0x1609, 0x132b: 0x1609, 0x132c: 0x1609, 0x132d: 0x1609, 0x132e: 0x1611, 0x132f: 0x1611, + 0x1330: 0x1611, 0x1331: 0x1611, 0x1332: 0x1619, 0x1333: 0x1619, 0x1334: 0x1619, 0x1335: 0x1619, + 0x1336: 0x1621, 0x1337: 0x1621, 0x1338: 0x1621, 0x1339: 0x1621, 0x133a: 0x1629, 0x133b: 0x1629, + 0x133c: 0x1629, 0x133d: 0x1629, 0x133e: 0x1631, 0x133f: 0x1631, + // Block 0x4d, offset 0x1340 + 0x1340: 0x1631, 0x1341: 0x1631, 0x1342: 0x1639, 0x1343: 0x1639, 0x1344: 0x1641, 0x1345: 0x1641, + 0x1346: 0x1649, 0x1347: 0x1649, 0x1348: 0x1651, 0x1349: 0x1651, 0x134a: 0x1659, 0x134b: 0x1659, + 0x134c: 0x1661, 0x134d: 0x1661, 0x134e: 0x1669, 0x134f: 0x1669, 0x1350: 0x1669, 0x1351: 0x1669, + 0x1352: 0x1671, 0x1353: 0x1671, 0x1354: 0x1671, 0x1355: 0x1671, 0x1356: 0x1679, 0x1357: 0x1679, + 0x1358: 0x1679, 0x1359: 0x1679, 0x135a: 0x1681, 0x135b: 0x1681, 0x135c: 0x1681, 0x135d: 0x1681, + 0x135e: 0x1689, 0x135f: 0x1689, 0x1360: 0x1691, 0x1361: 0x1691, 0x1362: 0x1691, 0x1363: 0x1691, + 0x1364: 0x1699, 0x1365: 0x1699, 0x1366: 0x16a1, 0x1367: 0x16a1, 0x1368: 0x16a1, 0x1369: 0x16a1, + 0x136a: 0x16a9, 0x136b: 0x16a9, 0x136c: 0x16a9, 0x136d: 0x16a9, 0x136e: 0x16b1, 0x136f: 0x16b1, + 0x1370: 0x16b9, 0x1371: 0x16b9, 0x1372: 0x0818, 0x1373: 0x0818, 0x1374: 0x0818, 0x1375: 0x0818, + 0x1376: 0x0818, 0x1377: 0x0818, 0x1378: 0x0818, 0x1379: 0x0818, 0x137a: 0x0818, 0x137b: 0x0818, + 0x137c: 0x0818, 0x137d: 0x0818, 0x137e: 0x0818, 0x137f: 0x0818, + // Block 0x4e, offset 0x1380 + 0x1380: 0x0818, 0x1381: 0x0818, 0x1382: 0x0818, 0x1383: 0x0040, 0x1384: 0x0040, 0x1385: 0x0040, + 0x1386: 0x0040, 0x1387: 0x0040, 0x1388: 0x0040, 0x1389: 0x0040, 0x138a: 0x0040, 0x138b: 0x0040, + 0x138c: 0x0040, 0x138d: 0x0040, 0x138e: 0x0040, 0x138f: 0x0040, 0x1390: 0x0040, 0x1391: 0x0040, + 0x1392: 0x0040, 0x1393: 0x16c1, 0x1394: 0x16c1, 0x1395: 0x16c1, 0x1396: 0x16c1, 0x1397: 0x16c9, + 0x1398: 0x16c9, 0x1399: 0x16d1, 0x139a: 0x16d1, 0x139b: 0x16d9, 0x139c: 0x16d9, 0x139d: 0x0149, + 0x139e: 0x16e1, 0x139f: 0x16e1, 0x13a0: 0x16e9, 0x13a1: 0x16e9, 0x13a2: 0x16f1, 0x13a3: 0x16f1, + 0x13a4: 0x16f9, 0x13a5: 0x16f9, 0x13a6: 0x16f9, 0x13a7: 0x16f9, 0x13a8: 0x1701, 0x13a9: 0x1701, + 0x13aa: 0x1709, 0x13ab: 0x1709, 0x13ac: 0x1711, 0x13ad: 0x1711, 0x13ae: 0x1719, 0x13af: 0x1719, + 0x13b0: 0x1721, 0x13b1: 0x1721, 0x13b2: 0x1729, 0x13b3: 0x1729, 0x13b4: 0x1731, 0x13b5: 0x1731, + 0x13b6: 0x1739, 0x13b7: 0x1739, 0x13b8: 0x1739, 0x13b9: 0x1741, 0x13ba: 0x1741, 0x13bb: 0x1741, + 0x13bc: 0x1749, 0x13bd: 0x1749, 0x13be: 0x1749, 0x13bf: 0x1749, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x1949, 0x13c1: 0x1951, 0x13c2: 0x1959, 0x13c3: 0x1961, 0x13c4: 0x1969, 0x13c5: 0x1971, + 0x13c6: 0x1979, 0x13c7: 0x1981, 0x13c8: 0x1989, 0x13c9: 0x1991, 0x13ca: 0x1999, 0x13cb: 0x19a1, + 0x13cc: 0x19a9, 0x13cd: 0x19b1, 0x13ce: 0x19b9, 0x13cf: 0x19c1, 0x13d0: 0x19c9, 0x13d1: 0x19d1, + 0x13d2: 0x19d9, 0x13d3: 0x19e1, 0x13d4: 0x19e9, 0x13d5: 0x19f1, 0x13d6: 0x19f9, 0x13d7: 0x1a01, + 0x13d8: 0x1a09, 0x13d9: 0x1a11, 0x13da: 0x1a19, 0x13db: 0x1a21, 0x13dc: 0x1a29, 0x13dd: 0x1a31, + 0x13de: 0x1a3a, 0x13df: 0x1a42, 0x13e0: 0x1a4a, 0x13e1: 0x1a52, 0x13e2: 0x1a5a, 0x13e3: 0x1a62, + 0x13e4: 0x1a69, 0x13e5: 0x1a71, 0x13e6: 0x1761, 0x13e7: 0x1a79, 0x13e8: 0x1741, 0x13e9: 0x1769, + 0x13ea: 0x1a81, 0x13eb: 0x1a89, 0x13ec: 0x1789, 0x13ed: 0x1a91, 0x13ee: 0x1791, 0x13ef: 0x1799, + 0x13f0: 0x1a99, 0x13f1: 0x1aa1, 0x13f2: 0x17b9, 0x13f3: 0x1aa9, 0x13f4: 0x17c1, 0x13f5: 0x17c9, + 0x13f6: 0x1ab1, 0x13f7: 0x1ab9, 0x13f8: 0x17d9, 0x13f9: 0x1ac1, 0x13fa: 0x17e1, 0x13fb: 0x17e9, + 0x13fc: 0x18d1, 0x13fd: 0x18d9, 0x13fe: 0x18f1, 0x13ff: 0x18f9, + // Block 0x50, offset 0x1400 + 0x1400: 0x1901, 0x1401: 0x1921, 0x1402: 0x1929, 0x1403: 0x1931, 0x1404: 0x1939, 0x1405: 0x1959, + 0x1406: 0x1961, 0x1407: 0x1969, 0x1408: 0x1ac9, 0x1409: 0x1989, 0x140a: 0x1ad1, 0x140b: 0x1ad9, + 0x140c: 0x19b9, 0x140d: 0x1ae1, 0x140e: 0x19c1, 0x140f: 0x19c9, 0x1410: 0x1a31, 0x1411: 0x1ae9, + 0x1412: 0x1af1, 0x1413: 0x1a09, 0x1414: 0x1af9, 0x1415: 0x1a11, 0x1416: 0x1a19, 0x1417: 0x1751, + 0x1418: 0x1759, 0x1419: 0x1b01, 0x141a: 0x1761, 0x141b: 0x1b09, 0x141c: 0x1771, 0x141d: 0x1779, + 0x141e: 0x1781, 0x141f: 0x1789, 0x1420: 0x1b11, 0x1421: 0x17a1, 0x1422: 0x17a9, 0x1423: 0x17b1, + 0x1424: 0x17b9, 0x1425: 0x1b19, 0x1426: 0x17d9, 0x1427: 0x17f1, 0x1428: 0x17f9, 0x1429: 0x1801, + 0x142a: 0x1809, 0x142b: 0x1811, 0x142c: 0x1821, 0x142d: 0x1829, 0x142e: 0x1831, 0x142f: 0x1839, + 0x1430: 0x1841, 0x1431: 0x1849, 0x1432: 0x1b21, 0x1433: 0x1851, 0x1434: 0x1859, 0x1435: 0x1861, + 0x1436: 0x1869, 0x1437: 0x1871, 0x1438: 0x1879, 0x1439: 0x1889, 0x143a: 0x1891, 0x143b: 0x1899, + 0x143c: 0x18a1, 0x143d: 0x18a9, 0x143e: 0x18b1, 0x143f: 0x18b9, + // Block 0x51, offset 0x1440 + 0x1440: 0x18c1, 0x1441: 0x18c9, 0x1442: 0x18e1, 0x1443: 0x18e9, 0x1444: 0x1909, 0x1445: 0x1911, + 0x1446: 0x1919, 0x1447: 0x1921, 0x1448: 0x1929, 0x1449: 0x1941, 0x144a: 0x1949, 0x144b: 0x1951, + 0x144c: 0x1959, 0x144d: 0x1b29, 0x144e: 0x1971, 0x144f: 0x1979, 0x1450: 0x1981, 0x1451: 0x1989, + 0x1452: 0x19a1, 0x1453: 0x19a9, 0x1454: 0x19b1, 0x1455: 0x19b9, 0x1456: 0x1b31, 0x1457: 0x19d1, + 0x1458: 0x19d9, 0x1459: 0x1b39, 0x145a: 0x19f1, 0x145b: 0x19f9, 0x145c: 0x1a01, 0x145d: 0x1a09, + 0x145e: 0x1b41, 0x145f: 0x1761, 0x1460: 0x1b09, 0x1461: 0x1789, 0x1462: 0x1b11, 0x1463: 0x17b9, + 0x1464: 0x1b19, 0x1465: 0x17d9, 0x1466: 0x1b49, 0x1467: 0x1841, 0x1468: 0x1b51, 0x1469: 0x1b59, + 0x146a: 0x1b61, 0x146b: 0x1921, 0x146c: 0x1929, 0x146d: 0x1959, 0x146e: 0x19b9, 0x146f: 0x1b31, + 0x1470: 0x1a09, 0x1471: 0x1b41, 0x1472: 0x1b69, 0x1473: 0x1b71, 0x1474: 0x1b79, 0x1475: 0x1b81, + 0x1476: 0x1b89, 0x1477: 0x1b91, 0x1478: 0x1b99, 0x1479: 0x1ba1, 0x147a: 0x1ba9, 0x147b: 0x1bb1, + 0x147c: 0x1bb9, 0x147d: 0x1bc1, 0x147e: 0x1bc9, 0x147f: 0x1bd1, + // Block 0x52, offset 0x1480 + 0x1480: 0x1bd9, 0x1481: 0x1be1, 0x1482: 0x1be9, 0x1483: 0x1bf1, 0x1484: 0x1bf9, 0x1485: 0x1c01, + 0x1486: 0x1c09, 0x1487: 0x1c11, 0x1488: 0x1c19, 0x1489: 0x1c21, 0x148a: 0x1c29, 0x148b: 0x1c31, + 0x148c: 0x1b59, 0x148d: 0x1c39, 0x148e: 0x1c41, 0x148f: 0x1c49, 0x1490: 0x1c51, 0x1491: 0x1b81, + 0x1492: 0x1b89, 0x1493: 0x1b91, 0x1494: 0x1b99, 0x1495: 0x1ba1, 0x1496: 0x1ba9, 0x1497: 0x1bb1, + 0x1498: 0x1bb9, 0x1499: 0x1bc1, 0x149a: 0x1bc9, 0x149b: 0x1bd1, 0x149c: 0x1bd9, 0x149d: 0x1be1, + 0x149e: 0x1be9, 0x149f: 0x1bf1, 0x14a0: 0x1bf9, 0x14a1: 0x1c01, 0x14a2: 0x1c09, 0x14a3: 0x1c11, + 0x14a4: 0x1c19, 0x14a5: 0x1c21, 0x14a6: 0x1c29, 0x14a7: 0x1c31, 0x14a8: 0x1b59, 0x14a9: 0x1c39, + 0x14aa: 0x1c41, 0x14ab: 0x1c49, 0x14ac: 0x1c51, 0x14ad: 0x1c21, 0x14ae: 0x1c29, 0x14af: 0x1c31, + 0x14b0: 0x1b59, 0x14b1: 0x1b51, 0x14b2: 0x1b61, 0x14b3: 0x1881, 0x14b4: 0x1829, 0x14b5: 0x1831, + 0x14b6: 0x1839, 0x14b7: 0x1c21, 0x14b8: 0x1c29, 0x14b9: 0x1c31, 0x14ba: 0x1881, 0x14bb: 0x1889, + 0x14bc: 0x1c59, 0x14bd: 0x1c59, 0x14be: 0x0018, 0x14bf: 0x0018, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0018, 0x14c1: 0x0018, 0x14c2: 0x0018, 0x14c3: 0x0018, 0x14c4: 0x0018, 0x14c5: 0x0018, + 0x14c6: 0x0018, 0x14c7: 0x0018, 0x14c8: 0x0018, 0x14c9: 0x0018, 0x14ca: 0x0018, 0x14cb: 0x0018, + 0x14cc: 0x0018, 0x14cd: 0x0018, 0x14ce: 0x0018, 0x14cf: 0x0018, 0x14d0: 0x1c61, 0x14d1: 0x1c69, + 0x14d2: 0x1c69, 0x14d3: 0x1c71, 0x14d4: 0x1c79, 0x14d5: 0x1c81, 0x14d6: 0x1c89, 0x14d7: 0x1c91, + 0x14d8: 0x1c99, 0x14d9: 0x1c99, 0x14da: 0x1ca1, 0x14db: 0x1ca9, 0x14dc: 0x1cb1, 0x14dd: 0x1cb9, + 0x14de: 0x1cc1, 0x14df: 0x1cc9, 0x14e0: 0x1cc9, 0x14e1: 0x1cd1, 0x14e2: 0x1cd9, 0x14e3: 0x1cd9, + 0x14e4: 0x1ce1, 0x14e5: 0x1ce1, 0x14e6: 0x1ce9, 0x14e7: 0x1cf1, 0x14e8: 0x1cf1, 0x14e9: 0x1cf9, + 0x14ea: 0x1d01, 0x14eb: 0x1d01, 0x14ec: 0x1d09, 0x14ed: 0x1d09, 0x14ee: 0x1d11, 0x14ef: 0x1d19, + 0x14f0: 0x1d19, 0x14f1: 0x1d21, 0x14f2: 0x1d21, 0x14f3: 0x1d29, 0x14f4: 0x1d31, 0x14f5: 0x1d39, + 0x14f6: 0x1d41, 0x14f7: 0x1d41, 0x14f8: 0x1d49, 0x14f9: 0x1d51, 0x14fa: 0x1d59, 0x14fb: 0x1d61, + 0x14fc: 0x1d69, 0x14fd: 0x1d69, 0x14fe: 0x1d71, 0x14ff: 0x1d79, + // Block 0x54, offset 0x1500 + 0x1500: 0x1f29, 0x1501: 0x1f31, 0x1502: 0x1f39, 0x1503: 0x1f11, 0x1504: 0x1d39, 0x1505: 0x1ce9, + 0x1506: 0x1f41, 0x1507: 0x1f49, 0x1508: 0x0040, 0x1509: 0x0040, 0x150a: 0x0040, 0x150b: 0x0040, + 0x150c: 0x0040, 0x150d: 0x0040, 0x150e: 0x0040, 0x150f: 0x0018, 0x1510: 0x0040, 0x1511: 0x0040, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0040, 0x1515: 0x0040, 0x1516: 0x0040, 0x1517: 0x0040, + 0x1518: 0x0040, 0x1519: 0x0040, 0x151a: 0x0040, 0x151b: 0x0040, 0x151c: 0x0040, 0x151d: 0x0040, + 0x151e: 0x0040, 0x151f: 0x0040, 0x1520: 0x0040, 0x1521: 0x0040, 0x1522: 0x0040, 0x1523: 0x0040, + 0x1524: 0x0040, 0x1525: 0x0040, 0x1526: 0x0040, 0x1527: 0x0040, 0x1528: 0x0040, 0x1529: 0x0040, + 0x152a: 0x0040, 0x152b: 0x0040, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x1f51, 0x1531: 0x1f59, 0x1532: 0x1f61, 0x1533: 0x1f69, 0x1534: 0x1f71, 0x1535: 0x1f79, + 0x1536: 0x1f81, 0x1537: 0x1f89, 0x1538: 0x1f91, 0x1539: 0x1f99, 0x153a: 0x1fa2, 0x153b: 0x1faa, + 0x153c: 0x1fb1, 0x153d: 0x0018, 0x153e: 0x0018, 0x153f: 0x0018, + // Block 0x55, offset 0x1540 + 0x1540: 0x33c0, 0x1541: 0x33c0, 0x1542: 0x33c0, 0x1543: 0x33c0, 0x1544: 0x33c0, 0x1545: 0x33c0, + 0x1546: 0x33c0, 0x1547: 0x33c0, 0x1548: 0x33c0, 0x1549: 0x33c0, 0x154a: 0x33c0, 0x154b: 0x33c0, + 0x154c: 0x33c0, 0x154d: 0x33c0, 0x154e: 0x33c0, 0x154f: 0x33c0, 0x1550: 0x1fba, 0x1551: 0x7d8d, + 0x1552: 0x0040, 0x1553: 0x1fc2, 0x1554: 0x0122, 0x1555: 0x1fca, 0x1556: 0x1fd2, 0x1557: 0x7dad, + 0x1558: 0x7dcd, 0x1559: 0x0040, 0x155a: 0x0040, 0x155b: 0x0040, 0x155c: 0x0040, 0x155d: 0x0040, + 0x155e: 0x0040, 0x155f: 0x0040, 0x1560: 0x3308, 0x1561: 0x3308, 0x1562: 0x3308, 0x1563: 0x3308, + 0x1564: 0x3308, 0x1565: 0x3308, 0x1566: 0x3308, 0x1567: 0x3308, 0x1568: 0x3308, 0x1569: 0x3308, + 0x156a: 0x3308, 0x156b: 0x3308, 0x156c: 0x3308, 0x156d: 0x3308, 0x156e: 0x3308, 0x156f: 0x3308, + 0x1570: 0x0040, 0x1571: 0x7ded, 0x1572: 0x7e0d, 0x1573: 0x1fda, 0x1574: 0x1fda, 0x1575: 0x072a, + 0x1576: 0x0732, 0x1577: 0x1fe2, 0x1578: 0x1fea, 0x1579: 0x7e2d, 0x157a: 0x7e4d, 0x157b: 0x7e6d, + 0x157c: 0x7e2d, 0x157d: 0x7e8d, 0x157e: 0x7ead, 0x157f: 0x7e8d, + // Block 0x56, offset 0x1580 + 0x1580: 0x7ecd, 0x1581: 0x7eed, 0x1582: 0x7f0d, 0x1583: 0x7eed, 0x1584: 0x7f2d, 0x1585: 0x0018, + 0x1586: 0x0018, 0x1587: 0x1ff2, 0x1588: 0x1ffa, 0x1589: 0x7f4e, 0x158a: 0x7f6e, 0x158b: 0x7f8e, + 0x158c: 0x7fae, 0x158d: 0x1fda, 0x158e: 0x1fda, 0x158f: 0x1fda, 0x1590: 0x1fba, 0x1591: 0x7fcd, + 0x1592: 0x0040, 0x1593: 0x0040, 0x1594: 0x0122, 0x1595: 0x1fc2, 0x1596: 0x1fd2, 0x1597: 0x1fca, + 0x1598: 0x7fed, 0x1599: 0x072a, 0x159a: 0x0732, 0x159b: 0x1fe2, 0x159c: 0x1fea, 0x159d: 0x7ecd, + 0x159e: 0x7f2d, 0x159f: 0x2002, 0x15a0: 0x200a, 0x15a1: 0x2012, 0x15a2: 0x071a, 0x15a3: 0x2019, + 0x15a4: 0x2022, 0x15a5: 0x202a, 0x15a6: 0x0722, 0x15a7: 0x0040, 0x15a8: 0x2032, 0x15a9: 0x203a, + 0x15aa: 0x2042, 0x15ab: 0x204a, 0x15ac: 0x0040, 0x15ad: 0x0040, 0x15ae: 0x0040, 0x15af: 0x0040, + 0x15b0: 0x800e, 0x15b1: 0x2051, 0x15b2: 0x802e, 0x15b3: 0x0808, 0x15b4: 0x804e, 0x15b5: 0x0040, + 0x15b6: 0x806e, 0x15b7: 0x2059, 0x15b8: 0x808e, 0x15b9: 0x2061, 0x15ba: 0x80ae, 0x15bb: 0x2069, + 0x15bc: 0x80ce, 0x15bd: 0x2071, 0x15be: 0x80ee, 0x15bf: 0x2079, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x2081, 0x15c1: 0x2089, 0x15c2: 0x2089, 0x15c3: 0x2091, 0x15c4: 0x2091, 0x15c5: 0x2099, + 0x15c6: 0x2099, 0x15c7: 0x20a1, 0x15c8: 0x20a1, 0x15c9: 0x20a9, 0x15ca: 0x20a9, 0x15cb: 0x20a9, + 0x15cc: 0x20a9, 0x15cd: 0x20b1, 0x15ce: 0x20b1, 0x15cf: 0x20b9, 0x15d0: 0x20b9, 0x15d1: 0x20b9, + 0x15d2: 0x20b9, 0x15d3: 0x20c1, 0x15d4: 0x20c1, 0x15d5: 0x20c9, 0x15d6: 0x20c9, 0x15d7: 0x20c9, + 0x15d8: 0x20c9, 0x15d9: 0x20d1, 0x15da: 0x20d1, 0x15db: 0x20d1, 0x15dc: 0x20d1, 0x15dd: 0x20d9, + 0x15de: 0x20d9, 0x15df: 0x20d9, 0x15e0: 0x20d9, 0x15e1: 0x20e1, 0x15e2: 0x20e1, 0x15e3: 0x20e1, + 0x15e4: 0x20e1, 0x15e5: 0x20e9, 0x15e6: 0x20e9, 0x15e7: 0x20e9, 0x15e8: 0x20e9, 0x15e9: 0x20f1, + 0x15ea: 0x20f1, 0x15eb: 0x20f9, 0x15ec: 0x20f9, 0x15ed: 0x2101, 0x15ee: 0x2101, 0x15ef: 0x2109, + 0x15f0: 0x2109, 0x15f1: 0x2111, 0x15f2: 0x2111, 0x15f3: 0x2111, 0x15f4: 0x2111, 0x15f5: 0x2119, + 0x15f6: 0x2119, 0x15f7: 0x2119, 0x15f8: 0x2119, 0x15f9: 0x2121, 0x15fa: 0x2121, 0x15fb: 0x2121, + 0x15fc: 0x2121, 0x15fd: 0x2129, 0x15fe: 0x2129, 0x15ff: 0x2129, + // Block 0x58, offset 0x1600 + 0x1600: 0x2129, 0x1601: 0x2131, 0x1602: 0x2131, 0x1603: 0x2131, 0x1604: 0x2131, 0x1605: 0x2139, + 0x1606: 0x2139, 0x1607: 0x2139, 0x1608: 0x2139, 0x1609: 0x2141, 0x160a: 0x2141, 0x160b: 0x2141, + 0x160c: 0x2141, 0x160d: 0x2149, 0x160e: 0x2149, 0x160f: 0x2149, 0x1610: 0x2149, 0x1611: 0x2151, + 0x1612: 0x2151, 0x1613: 0x2151, 0x1614: 0x2151, 0x1615: 0x2159, 0x1616: 0x2159, 0x1617: 0x2159, + 0x1618: 0x2159, 0x1619: 0x2161, 0x161a: 0x2161, 0x161b: 0x2161, 0x161c: 0x2161, 0x161d: 0x2169, + 0x161e: 0x2169, 0x161f: 0x2169, 0x1620: 0x2169, 0x1621: 0x2171, 0x1622: 0x2171, 0x1623: 0x2171, + 0x1624: 0x2171, 0x1625: 0x2179, 0x1626: 0x2179, 0x1627: 0x2179, 0x1628: 0x2179, 0x1629: 0x2181, + 0x162a: 0x2181, 0x162b: 0x2181, 0x162c: 0x2181, 0x162d: 0x2189, 0x162e: 0x2189, 0x162f: 0x1701, + 0x1630: 0x1701, 0x1631: 0x2191, 0x1632: 0x2191, 0x1633: 0x2191, 0x1634: 0x2191, 0x1635: 0x2199, + 0x1636: 0x2199, 0x1637: 0x21a1, 0x1638: 0x21a1, 0x1639: 0x21a9, 0x163a: 0x21a9, 0x163b: 0x21b1, + 0x163c: 0x21b1, 0x163d: 0x0040, 0x163e: 0x0040, 0x163f: 0x03c0, + // Block 0x59, offset 0x1640 + 0x1640: 0x0040, 0x1641: 0x1fca, 0x1642: 0x21ba, 0x1643: 0x2002, 0x1644: 0x203a, 0x1645: 0x2042, + 0x1646: 0x200a, 0x1647: 0x21c2, 0x1648: 0x072a, 0x1649: 0x0732, 0x164a: 0x2012, 0x164b: 0x071a, + 0x164c: 0x1fba, 0x164d: 0x2019, 0x164e: 0x0961, 0x164f: 0x21ca, 0x1650: 0x06e1, 0x1651: 0x0049, + 0x1652: 0x0029, 0x1653: 0x0031, 0x1654: 0x06e9, 0x1655: 0x06f1, 0x1656: 0x06f9, 0x1657: 0x0701, + 0x1658: 0x0709, 0x1659: 0x0711, 0x165a: 0x1fc2, 0x165b: 0x0122, 0x165c: 0x2022, 0x165d: 0x0722, + 0x165e: 0x202a, 0x165f: 0x1fd2, 0x1660: 0x204a, 0x1661: 0x0019, 0x1662: 0x02e9, 0x1663: 0x03d9, + 0x1664: 0x02f1, 0x1665: 0x02f9, 0x1666: 0x03f1, 0x1667: 0x0309, 0x1668: 0x00a9, 0x1669: 0x0311, + 0x166a: 0x00b1, 0x166b: 0x0319, 0x166c: 0x0101, 0x166d: 0x0321, 0x166e: 0x0329, 0x166f: 0x0051, + 0x1670: 0x0339, 0x1671: 0x0751, 0x1672: 0x00b9, 0x1673: 0x0089, 0x1674: 0x0341, 0x1675: 0x0349, + 0x1676: 0x0391, 0x1677: 0x00c1, 0x1678: 0x0109, 0x1679: 0x00c9, 0x167a: 0x04b1, 0x167b: 0x1ff2, + 0x167c: 0x2032, 0x167d: 0x1ffa, 0x167e: 0x21d2, 0x167f: 0x1fda, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0672, 0x1681: 0x0019, 0x1682: 0x02e9, 0x1683: 0x03d9, 0x1684: 0x02f1, 0x1685: 0x02f9, + 0x1686: 0x03f1, 0x1687: 0x0309, 0x1688: 0x00a9, 0x1689: 0x0311, 0x168a: 0x00b1, 0x168b: 0x0319, + 0x168c: 0x0101, 0x168d: 0x0321, 0x168e: 0x0329, 0x168f: 0x0051, 0x1690: 0x0339, 0x1691: 0x0751, + 0x1692: 0x00b9, 0x1693: 0x0089, 0x1694: 0x0341, 0x1695: 0x0349, 0x1696: 0x0391, 0x1697: 0x00c1, + 0x1698: 0x0109, 0x1699: 0x00c9, 0x169a: 0x04b1, 0x169b: 0x1fe2, 0x169c: 0x21da, 0x169d: 0x1fea, + 0x169e: 0x21e2, 0x169f: 0x810d, 0x16a0: 0x812d, 0x16a1: 0x0961, 0x16a2: 0x814d, 0x16a3: 0x814d, + 0x16a4: 0x816d, 0x16a5: 0x818d, 0x16a6: 0x81ad, 0x16a7: 0x81cd, 0x16a8: 0x81ed, 0x16a9: 0x820d, + 0x16aa: 0x822d, 0x16ab: 0x824d, 0x16ac: 0x826d, 0x16ad: 0x828d, 0x16ae: 0x82ad, 0x16af: 0x82cd, + 0x16b0: 0x82ed, 0x16b1: 0x830d, 0x16b2: 0x832d, 0x16b3: 0x834d, 0x16b4: 0x836d, 0x16b5: 0x838d, + 0x16b6: 0x83ad, 0x16b7: 0x83cd, 0x16b8: 0x83ed, 0x16b9: 0x840d, 0x16ba: 0x842d, 0x16bb: 0x844d, + 0x16bc: 0x81ed, 0x16bd: 0x846d, 0x16be: 0x848d, 0x16bf: 0x824d, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x84ad, 0x16c1: 0x84cd, 0x16c2: 0x84ed, 0x16c3: 0x850d, 0x16c4: 0x852d, 0x16c5: 0x854d, + 0x16c6: 0x856d, 0x16c7: 0x858d, 0x16c8: 0x850d, 0x16c9: 0x85ad, 0x16ca: 0x850d, 0x16cb: 0x85cd, + 0x16cc: 0x85cd, 0x16cd: 0x85ed, 0x16ce: 0x85ed, 0x16cf: 0x860d, 0x16d0: 0x854d, 0x16d1: 0x862d, + 0x16d2: 0x864d, 0x16d3: 0x862d, 0x16d4: 0x866d, 0x16d5: 0x864d, 0x16d6: 0x868d, 0x16d7: 0x868d, + 0x16d8: 0x86ad, 0x16d9: 0x86ad, 0x16da: 0x86cd, 0x16db: 0x86cd, 0x16dc: 0x864d, 0x16dd: 0x814d, + 0x16de: 0x86ed, 0x16df: 0x870d, 0x16e0: 0x0040, 0x16e1: 0x872d, 0x16e2: 0x874d, 0x16e3: 0x876d, + 0x16e4: 0x878d, 0x16e5: 0x876d, 0x16e6: 0x87ad, 0x16e7: 0x87cd, 0x16e8: 0x87ed, 0x16e9: 0x87ed, + 0x16ea: 0x880d, 0x16eb: 0x880d, 0x16ec: 0x882d, 0x16ed: 0x882d, 0x16ee: 0x880d, 0x16ef: 0x880d, + 0x16f0: 0x884d, 0x16f1: 0x886d, 0x16f2: 0x888d, 0x16f3: 0x88ad, 0x16f4: 0x88cd, 0x16f5: 0x88ed, + 0x16f6: 0x88ed, 0x16f7: 0x88ed, 0x16f8: 0x890d, 0x16f9: 0x890d, 0x16fa: 0x890d, 0x16fb: 0x890d, + 0x16fc: 0x87ed, 0x16fd: 0x87ed, 0x16fe: 0x87ed, 0x16ff: 0x0040, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0040, 0x1701: 0x0040, 0x1702: 0x874d, 0x1703: 0x872d, 0x1704: 0x892d, 0x1705: 0x872d, + 0x1706: 0x874d, 0x1707: 0x872d, 0x1708: 0x0040, 0x1709: 0x0040, 0x170a: 0x894d, 0x170b: 0x874d, + 0x170c: 0x896d, 0x170d: 0x892d, 0x170e: 0x896d, 0x170f: 0x874d, 0x1710: 0x0040, 0x1711: 0x0040, + 0x1712: 0x898d, 0x1713: 0x89ad, 0x1714: 0x88ad, 0x1715: 0x896d, 0x1716: 0x892d, 0x1717: 0x896d, + 0x1718: 0x0040, 0x1719: 0x0040, 0x171a: 0x89cd, 0x171b: 0x89ed, 0x171c: 0x89cd, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x21e9, 0x1721: 0x21f1, 0x1722: 0x21f9, 0x1723: 0x8a0e, + 0x1724: 0x2201, 0x1725: 0x2209, 0x1726: 0x8a2d, 0x1727: 0x0040, 0x1728: 0x8a4d, 0x1729: 0x8a6d, + 0x172a: 0x8a8d, 0x172b: 0x8a6d, 0x172c: 0x8aad, 0x172d: 0x8acd, 0x172e: 0x8aed, 0x172f: 0x0040, + 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0340, 0x173a: 0x0340, 0x173b: 0x0340, + 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, + // Block 0x5d, offset 0x1740 + 0x1740: 0x0008, 0x1741: 0x0008, 0x1742: 0x0008, 0x1743: 0x0008, 0x1744: 0x0008, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0008, 0x174e: 0x0008, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0008, + 0x1752: 0x0008, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0040, 0x1765: 0x0040, 0x1766: 0x0040, 0x1767: 0x0040, 0x1768: 0x0040, 0x1769: 0x0040, + 0x176a: 0x0040, 0x176b: 0x0040, 0x176c: 0x0040, 0x176d: 0x0040, 0x176e: 0x0040, 0x176f: 0x0018, + 0x1770: 0x8b3d, 0x1771: 0x8b55, 0x1772: 0x8b6d, 0x1773: 0x8b55, 0x1774: 0x8b85, 0x1775: 0x8b55, + 0x1776: 0x8b6d, 0x1777: 0x8b55, 0x1778: 0x8b3d, 0x1779: 0x8b9d, 0x177a: 0x8bb5, 0x177b: 0x0040, + 0x177c: 0x8bcd, 0x177d: 0x8b9d, 0x177e: 0x8bb5, 0x177f: 0x8b9d, + // Block 0x5e, offset 0x1780 + 0x1780: 0xe13d, 0x1781: 0xe14d, 0x1782: 0xe15d, 0x1783: 0xe14d, 0x1784: 0xe17d, 0x1785: 0xe14d, + 0x1786: 0xe15d, 0x1787: 0xe14d, 0x1788: 0xe13d, 0x1789: 0xe1cd, 0x178a: 0xe1dd, 0x178b: 0x0040, + 0x178c: 0xe1fd, 0x178d: 0xe1cd, 0x178e: 0xe1dd, 0x178f: 0xe1cd, 0x1790: 0xe13d, 0x1791: 0xe14d, + 0x1792: 0xe15d, 0x1793: 0x0040, 0x1794: 0xe17d, 0x1795: 0xe14d, 0x1796: 0x0040, 0x1797: 0x0008, + 0x1798: 0x0008, 0x1799: 0x0008, 0x179a: 0x0008, 0x179b: 0x0008, 0x179c: 0x0008, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x0040, 0x17a3: 0x0008, + 0x17a4: 0x0008, 0x17a5: 0x0008, 0x17a6: 0x0008, 0x17a7: 0x0008, 0x17a8: 0x0008, 0x17a9: 0x0008, + 0x17aa: 0x0008, 0x17ab: 0x0008, 0x17ac: 0x0008, 0x17ad: 0x0008, 0x17ae: 0x0008, 0x17af: 0x0008, + 0x17b0: 0x0008, 0x17b1: 0x0008, 0x17b2: 0x0040, 0x17b3: 0x0008, 0x17b4: 0x0008, 0x17b5: 0x0008, + 0x17b6: 0x0008, 0x17b7: 0x0008, 0x17b8: 0x0008, 0x17b9: 0x0008, 0x17ba: 0x0040, 0x17bb: 0x0008, + 0x17bc: 0x0008, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x0008, 0x17c1: 0x2211, 0x17c2: 0x2219, 0x17c3: 0x02e1, 0x17c4: 0x2221, 0x17c5: 0x2229, + 0x17c6: 0x0040, 0x17c7: 0x2231, 0x17c8: 0x2239, 0x17c9: 0x2241, 0x17ca: 0x2249, 0x17cb: 0x2251, + 0x17cc: 0x2259, 0x17cd: 0x2261, 0x17ce: 0x2269, 0x17cf: 0x2271, 0x17d0: 0x2279, 0x17d1: 0x2281, + 0x17d2: 0x2289, 0x17d3: 0x2291, 0x17d4: 0x2299, 0x17d5: 0x0741, 0x17d6: 0x22a1, 0x17d7: 0x22a9, + 0x17d8: 0x22b1, 0x17d9: 0x22b9, 0x17da: 0x22c1, 0x17db: 0x13d9, 0x17dc: 0x8be5, 0x17dd: 0x22c9, + 0x17de: 0x22d1, 0x17df: 0x8c05, 0x17e0: 0x22d9, 0x17e1: 0x8c25, 0x17e2: 0x22e1, 0x17e3: 0x22e9, + 0x17e4: 0x22f1, 0x17e5: 0x0751, 0x17e6: 0x22f9, 0x17e7: 0x8c45, 0x17e8: 0x0949, 0x17e9: 0x2301, + 0x17ea: 0x2309, 0x17eb: 0x2311, 0x17ec: 0x2319, 0x17ed: 0x2321, 0x17ee: 0x2329, 0x17ef: 0x2331, + 0x17f0: 0x2339, 0x17f1: 0x0040, 0x17f2: 0x2341, 0x17f3: 0x2349, 0x17f4: 0x2351, 0x17f5: 0x2359, + 0x17f6: 0x2361, 0x17f7: 0x2369, 0x17f8: 0x2371, 0x17f9: 0x8c65, 0x17fa: 0x8c85, 0x17fb: 0x0040, + 0x17fc: 0x0040, 0x17fd: 0x0040, 0x17fe: 0x0040, 0x17ff: 0x0040, + // Block 0x60, offset 0x1800 + 0x1800: 0x0a08, 0x1801: 0x0a08, 0x1802: 0x0a08, 0x1803: 0x0a08, 0x1804: 0x0a08, 0x1805: 0x0c08, + 0x1806: 0x0808, 0x1807: 0x0c08, 0x1808: 0x0818, 0x1809: 0x0c08, 0x180a: 0x0c08, 0x180b: 0x0808, + 0x180c: 0x0808, 0x180d: 0x0908, 0x180e: 0x0c08, 0x180f: 0x0c08, 0x1810: 0x0c08, 0x1811: 0x0c08, + 0x1812: 0x0c08, 0x1813: 0x0a08, 0x1814: 0x0a08, 0x1815: 0x0a08, 0x1816: 0x0a08, 0x1817: 0x0908, + 0x1818: 0x0a08, 0x1819: 0x0a08, 0x181a: 0x0a08, 0x181b: 0x0a08, 0x181c: 0x0a08, 0x181d: 0x0c08, + 0x181e: 0x0a08, 0x181f: 0x0a08, 0x1820: 0x0a08, 0x1821: 0x0c08, 0x1822: 0x0808, 0x1823: 0x0808, + 0x1824: 0x0c08, 0x1825: 0x3308, 0x1826: 0x3308, 0x1827: 0x0040, 0x1828: 0x0040, 0x1829: 0x0040, + 0x182a: 0x0040, 0x182b: 0x0a18, 0x182c: 0x0a18, 0x182d: 0x0a18, 0x182e: 0x0a18, 0x182f: 0x0c18, + 0x1830: 0x0818, 0x1831: 0x0818, 0x1832: 0x0818, 0x1833: 0x0818, 0x1834: 0x0818, 0x1835: 0x0818, + 0x1836: 0x0818, 0x1837: 0x0040, 0x1838: 0x0040, 0x1839: 0x0040, 0x183a: 0x0040, 0x183b: 0x0040, + 0x183c: 0x0040, 0x183d: 0x0040, 0x183e: 0x0040, 0x183f: 0x0040, + // Block 0x61, offset 0x1840 + 0x1840: 0x0a08, 0x1841: 0x0c08, 0x1842: 0x0a08, 0x1843: 0x0c08, 0x1844: 0x0c08, 0x1845: 0x0c08, + 0x1846: 0x0a08, 0x1847: 0x0a08, 0x1848: 0x0a08, 0x1849: 0x0c08, 0x184a: 0x0a08, 0x184b: 0x0a08, + 0x184c: 0x0c08, 0x184d: 0x0a08, 0x184e: 0x0c08, 0x184f: 0x0c08, 0x1850: 0x0a08, 0x1851: 0x0c08, + 0x1852: 0x0040, 0x1853: 0x0040, 0x1854: 0x0040, 0x1855: 0x0040, 0x1856: 0x0040, 0x1857: 0x0040, + 0x1858: 0x0040, 0x1859: 0x0818, 0x185a: 0x0818, 0x185b: 0x0818, 0x185c: 0x0818, 0x185d: 0x0040, + 0x185e: 0x0040, 0x185f: 0x0040, 0x1860: 0x0040, 0x1861: 0x0040, 0x1862: 0x0040, 0x1863: 0x0040, + 0x1864: 0x0040, 0x1865: 0x0040, 0x1866: 0x0040, 0x1867: 0x0040, 0x1868: 0x0040, 0x1869: 0x0c18, + 0x186a: 0x0c18, 0x186b: 0x0c18, 0x186c: 0x0c18, 0x186d: 0x0a18, 0x186e: 0x0a18, 0x186f: 0x0818, + 0x1870: 0x0040, 0x1871: 0x0040, 0x1872: 0x0040, 0x1873: 0x0040, 0x1874: 0x0040, 0x1875: 0x0040, + 0x1876: 0x0040, 0x1877: 0x0040, 0x1878: 0x0040, 0x1879: 0x0040, 0x187a: 0x0040, 0x187b: 0x0040, + 0x187c: 0x0040, 0x187d: 0x0040, 0x187e: 0x0040, 0x187f: 0x0040, + // Block 0x62, offset 0x1880 + 0x1880: 0x3308, 0x1881: 0x3308, 0x1882: 0x3008, 0x1883: 0x3008, 0x1884: 0x0040, 0x1885: 0x0008, + 0x1886: 0x0008, 0x1887: 0x0008, 0x1888: 0x0008, 0x1889: 0x0008, 0x188a: 0x0008, 0x188b: 0x0008, + 0x188c: 0x0008, 0x188d: 0x0040, 0x188e: 0x0040, 0x188f: 0x0008, 0x1890: 0x0008, 0x1891: 0x0040, + 0x1892: 0x0040, 0x1893: 0x0008, 0x1894: 0x0008, 0x1895: 0x0008, 0x1896: 0x0008, 0x1897: 0x0008, + 0x1898: 0x0008, 0x1899: 0x0008, 0x189a: 0x0008, 0x189b: 0x0008, 0x189c: 0x0008, 0x189d: 0x0008, + 0x189e: 0x0008, 0x189f: 0x0008, 0x18a0: 0x0008, 0x18a1: 0x0008, 0x18a2: 0x0008, 0x18a3: 0x0008, + 0x18a4: 0x0008, 0x18a5: 0x0008, 0x18a6: 0x0008, 0x18a7: 0x0008, 0x18a8: 0x0008, 0x18a9: 0x0040, + 0x18aa: 0x0008, 0x18ab: 0x0008, 0x18ac: 0x0008, 0x18ad: 0x0008, 0x18ae: 0x0008, 0x18af: 0x0008, + 0x18b0: 0x0008, 0x18b1: 0x0040, 0x18b2: 0x0008, 0x18b3: 0x0008, 0x18b4: 0x0040, 0x18b5: 0x0008, + 0x18b6: 0x0008, 0x18b7: 0x0008, 0x18b8: 0x0008, 0x18b9: 0x0008, 0x18ba: 0x0040, 0x18bb: 0x3308, + 0x18bc: 0x3308, 0x18bd: 0x0008, 0x18be: 0x3008, 0x18bf: 0x3008, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x3308, 0x18c1: 0x3008, 0x18c2: 0x3008, 0x18c3: 0x3008, 0x18c4: 0x3008, 0x18c5: 0x0040, + 0x18c6: 0x0040, 0x18c7: 0x3008, 0x18c8: 0x3008, 0x18c9: 0x0040, 0x18ca: 0x0040, 0x18cb: 0x3008, + 0x18cc: 0x3008, 0x18cd: 0x3808, 0x18ce: 0x0040, 0x18cf: 0x0040, 0x18d0: 0x0008, 0x18d1: 0x0040, + 0x18d2: 0x0040, 0x18d3: 0x0040, 0x18d4: 0x0040, 0x18d5: 0x0040, 0x18d6: 0x0040, 0x18d7: 0x3008, + 0x18d8: 0x0040, 0x18d9: 0x0040, 0x18da: 0x0040, 0x18db: 0x0040, 0x18dc: 0x0040, 0x18dd: 0x0008, + 0x18de: 0x0008, 0x18df: 0x0008, 0x18e0: 0x0008, 0x18e1: 0x0008, 0x18e2: 0x3008, 0x18e3: 0x3008, + 0x18e4: 0x0040, 0x18e5: 0x0040, 0x18e6: 0x3308, 0x18e7: 0x3308, 0x18e8: 0x3308, 0x18e9: 0x3308, + 0x18ea: 0x3308, 0x18eb: 0x3308, 0x18ec: 0x3308, 0x18ed: 0x0040, 0x18ee: 0x0040, 0x18ef: 0x0040, + 0x18f0: 0x3308, 0x18f1: 0x3308, 0x18f2: 0x3308, 0x18f3: 0x3308, 0x18f4: 0x3308, 0x18f5: 0x0040, + 0x18f6: 0x0040, 0x18f7: 0x0040, 0x18f8: 0x0040, 0x18f9: 0x0040, 0x18fa: 0x0040, 0x18fb: 0x0040, + 0x18fc: 0x0040, 0x18fd: 0x0040, 0x18fe: 0x0040, 0x18ff: 0x0040, + // Block 0x64, offset 0x1900 + 0x1900: 0x0008, 0x1901: 0x0008, 0x1902: 0x0008, 0x1903: 0x0008, 0x1904: 0x0008, 0x1905: 0x0008, + 0x1906: 0x0008, 0x1907: 0x0040, 0x1908: 0x0040, 0x1909: 0x0008, 0x190a: 0x0040, 0x190b: 0x0040, + 0x190c: 0x0008, 0x190d: 0x0008, 0x190e: 0x0008, 0x190f: 0x0008, 0x1910: 0x0008, 0x1911: 0x0008, + 0x1912: 0x0008, 0x1913: 0x0008, 0x1914: 0x0040, 0x1915: 0x0008, 0x1916: 0x0008, 0x1917: 0x0040, + 0x1918: 0x0008, 0x1919: 0x0008, 0x191a: 0x0008, 0x191b: 0x0008, 0x191c: 0x0008, 0x191d: 0x0008, + 0x191e: 0x0008, 0x191f: 0x0008, 0x1920: 0x0008, 0x1921: 0x0008, 0x1922: 0x0008, 0x1923: 0x0008, + 0x1924: 0x0008, 0x1925: 0x0008, 0x1926: 0x0008, 0x1927: 0x0008, 0x1928: 0x0008, 0x1929: 0x0008, + 0x192a: 0x0008, 0x192b: 0x0008, 0x192c: 0x0008, 0x192d: 0x0008, 0x192e: 0x0008, 0x192f: 0x0008, + 0x1930: 0x3008, 0x1931: 0x3008, 0x1932: 0x3008, 0x1933: 0x3008, 0x1934: 0x3008, 0x1935: 0x3008, + 0x1936: 0x0040, 0x1937: 0x3008, 0x1938: 0x3008, 0x1939: 0x0040, 0x193a: 0x0040, 0x193b: 0x3308, + 0x193c: 0x3308, 0x193d: 0x3808, 0x193e: 0x3b08, 0x193f: 0x0008, + // Block 0x65, offset 0x1940 + 0x1940: 0x0019, 0x1941: 0x02e9, 0x1942: 0x03d9, 0x1943: 0x02f1, 0x1944: 0x02f9, 0x1945: 0x03f1, + 0x1946: 0x0309, 0x1947: 0x00a9, 0x1948: 0x0311, 0x1949: 0x00b1, 0x194a: 0x0319, 0x194b: 0x0101, + 0x194c: 0x0321, 0x194d: 0x0329, 0x194e: 0x0051, 0x194f: 0x0339, 0x1950: 0x0751, 0x1951: 0x00b9, + 0x1952: 0x0089, 0x1953: 0x0341, 0x1954: 0x0349, 0x1955: 0x0391, 0x1956: 0x00c1, 0x1957: 0x0109, + 0x1958: 0x00c9, 0x1959: 0x04b1, 0x195a: 0x0019, 0x195b: 0x02e9, 0x195c: 0x03d9, 0x195d: 0x02f1, + 0x195e: 0x02f9, 0x195f: 0x03f1, 0x1960: 0x0309, 0x1961: 0x00a9, 0x1962: 0x0311, 0x1963: 0x00b1, + 0x1964: 0x0319, 0x1965: 0x0101, 0x1966: 0x0321, 0x1967: 0x0329, 0x1968: 0x0051, 0x1969: 0x0339, + 0x196a: 0x0751, 0x196b: 0x00b9, 0x196c: 0x0089, 0x196d: 0x0341, 0x196e: 0x0349, 0x196f: 0x0391, + 0x1970: 0x00c1, 0x1971: 0x0109, 0x1972: 0x00c9, 0x1973: 0x04b1, 0x1974: 0x0019, 0x1975: 0x02e9, + 0x1976: 0x03d9, 0x1977: 0x02f1, 0x1978: 0x02f9, 0x1979: 0x03f1, 0x197a: 0x0309, 0x197b: 0x00a9, + 0x197c: 0x0311, 0x197d: 0x00b1, 0x197e: 0x0319, 0x197f: 0x0101, + // Block 0x66, offset 0x1980 + 0x1980: 0x0321, 0x1981: 0x0329, 0x1982: 0x0051, 0x1983: 0x0339, 0x1984: 0x0751, 0x1985: 0x00b9, + 0x1986: 0x0089, 0x1987: 0x0341, 0x1988: 0x0349, 0x1989: 0x0391, 0x198a: 0x00c1, 0x198b: 0x0109, + 0x198c: 0x00c9, 0x198d: 0x04b1, 0x198e: 0x0019, 0x198f: 0x02e9, 0x1990: 0x03d9, 0x1991: 0x02f1, + 0x1992: 0x02f9, 0x1993: 0x03f1, 0x1994: 0x0309, 0x1995: 0x0040, 0x1996: 0x0311, 0x1997: 0x00b1, + 0x1998: 0x0319, 0x1999: 0x0101, 0x199a: 0x0321, 0x199b: 0x0329, 0x199c: 0x0051, 0x199d: 0x0339, + 0x199e: 0x0751, 0x199f: 0x00b9, 0x19a0: 0x0089, 0x19a1: 0x0341, 0x19a2: 0x0349, 0x19a3: 0x0391, + 0x19a4: 0x00c1, 0x19a5: 0x0109, 0x19a6: 0x00c9, 0x19a7: 0x04b1, 0x19a8: 0x0019, 0x19a9: 0x02e9, + 0x19aa: 0x03d9, 0x19ab: 0x02f1, 0x19ac: 0x02f9, 0x19ad: 0x03f1, 0x19ae: 0x0309, 0x19af: 0x00a9, + 0x19b0: 0x0311, 0x19b1: 0x00b1, 0x19b2: 0x0319, 0x19b3: 0x0101, 0x19b4: 0x0321, 0x19b5: 0x0329, + 0x19b6: 0x0051, 0x19b7: 0x0339, 0x19b8: 0x0751, 0x19b9: 0x00b9, 0x19ba: 0x0089, 0x19bb: 0x0341, + 0x19bc: 0x0349, 0x19bd: 0x0391, 0x19be: 0x00c1, 0x19bf: 0x0109, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x00c9, 0x19c1: 0x04b1, 0x19c2: 0x0019, 0x19c3: 0x02e9, 0x19c4: 0x03d9, 0x19c5: 0x02f1, + 0x19c6: 0x02f9, 0x19c7: 0x03f1, 0x19c8: 0x0309, 0x19c9: 0x00a9, 0x19ca: 0x0311, 0x19cb: 0x00b1, + 0x19cc: 0x0319, 0x19cd: 0x0101, 0x19ce: 0x0321, 0x19cf: 0x0329, 0x19d0: 0x0051, 0x19d1: 0x0339, + 0x19d2: 0x0751, 0x19d3: 0x00b9, 0x19d4: 0x0089, 0x19d5: 0x0341, 0x19d6: 0x0349, 0x19d7: 0x0391, + 0x19d8: 0x00c1, 0x19d9: 0x0109, 0x19da: 0x00c9, 0x19db: 0x04b1, 0x19dc: 0x0019, 0x19dd: 0x0040, + 0x19de: 0x03d9, 0x19df: 0x02f1, 0x19e0: 0x0040, 0x19e1: 0x0040, 0x19e2: 0x0309, 0x19e3: 0x0040, + 0x19e4: 0x0040, 0x19e5: 0x00b1, 0x19e6: 0x0319, 0x19e7: 0x0040, 0x19e8: 0x0040, 0x19e9: 0x0329, + 0x19ea: 0x0051, 0x19eb: 0x0339, 0x19ec: 0x0751, 0x19ed: 0x0040, 0x19ee: 0x0089, 0x19ef: 0x0341, + 0x19f0: 0x0349, 0x19f1: 0x0391, 0x19f2: 0x00c1, 0x19f3: 0x0109, 0x19f4: 0x00c9, 0x19f5: 0x04b1, + 0x19f6: 0x0019, 0x19f7: 0x02e9, 0x19f8: 0x03d9, 0x19f9: 0x02f1, 0x19fa: 0x0040, 0x19fb: 0x03f1, + 0x19fc: 0x0040, 0x19fd: 0x00a9, 0x19fe: 0x0311, 0x19ff: 0x00b1, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x0319, 0x1a01: 0x0101, 0x1a02: 0x0321, 0x1a03: 0x0329, 0x1a04: 0x0040, 0x1a05: 0x0339, + 0x1a06: 0x0751, 0x1a07: 0x00b9, 0x1a08: 0x0089, 0x1a09: 0x0341, 0x1a0a: 0x0349, 0x1a0b: 0x0391, + 0x1a0c: 0x00c1, 0x1a0d: 0x0109, 0x1a0e: 0x00c9, 0x1a0f: 0x04b1, 0x1a10: 0x0019, 0x1a11: 0x02e9, + 0x1a12: 0x03d9, 0x1a13: 0x02f1, 0x1a14: 0x02f9, 0x1a15: 0x03f1, 0x1a16: 0x0309, 0x1a17: 0x00a9, + 0x1a18: 0x0311, 0x1a19: 0x00b1, 0x1a1a: 0x0319, 0x1a1b: 0x0101, 0x1a1c: 0x0321, 0x1a1d: 0x0329, + 0x1a1e: 0x0051, 0x1a1f: 0x0339, 0x1a20: 0x0751, 0x1a21: 0x00b9, 0x1a22: 0x0089, 0x1a23: 0x0341, + 0x1a24: 0x0349, 0x1a25: 0x0391, 0x1a26: 0x00c1, 0x1a27: 0x0109, 0x1a28: 0x00c9, 0x1a29: 0x04b1, + 0x1a2a: 0x0019, 0x1a2b: 0x02e9, 0x1a2c: 0x03d9, 0x1a2d: 0x02f1, 0x1a2e: 0x02f9, 0x1a2f: 0x03f1, + 0x1a30: 0x0309, 0x1a31: 0x00a9, 0x1a32: 0x0311, 0x1a33: 0x00b1, 0x1a34: 0x0319, 0x1a35: 0x0101, + 0x1a36: 0x0321, 0x1a37: 0x0329, 0x1a38: 0x0051, 0x1a39: 0x0339, 0x1a3a: 0x0751, 0x1a3b: 0x00b9, + 0x1a3c: 0x0089, 0x1a3d: 0x0341, 0x1a3e: 0x0349, 0x1a3f: 0x0391, + // Block 0x69, offset 0x1a40 + 0x1a40: 0x00c1, 0x1a41: 0x0109, 0x1a42: 0x00c9, 0x1a43: 0x04b1, 0x1a44: 0x0019, 0x1a45: 0x02e9, + 0x1a46: 0x0040, 0x1a47: 0x02f1, 0x1a48: 0x02f9, 0x1a49: 0x03f1, 0x1a4a: 0x0309, 0x1a4b: 0x0040, + 0x1a4c: 0x0040, 0x1a4d: 0x00b1, 0x1a4e: 0x0319, 0x1a4f: 0x0101, 0x1a50: 0x0321, 0x1a51: 0x0329, + 0x1a52: 0x0051, 0x1a53: 0x0339, 0x1a54: 0x0751, 0x1a55: 0x0040, 0x1a56: 0x0089, 0x1a57: 0x0341, + 0x1a58: 0x0349, 0x1a59: 0x0391, 0x1a5a: 0x00c1, 0x1a5b: 0x0109, 0x1a5c: 0x00c9, 0x1a5d: 0x0040, + 0x1a5e: 0x0019, 0x1a5f: 0x02e9, 0x1a60: 0x03d9, 0x1a61: 0x02f1, 0x1a62: 0x02f9, 0x1a63: 0x03f1, + 0x1a64: 0x0309, 0x1a65: 0x00a9, 0x1a66: 0x0311, 0x1a67: 0x00b1, 0x1a68: 0x0319, 0x1a69: 0x0101, + 0x1a6a: 0x0321, 0x1a6b: 0x0329, 0x1a6c: 0x0051, 0x1a6d: 0x0339, 0x1a6e: 0x0751, 0x1a6f: 0x00b9, + 0x1a70: 0x0089, 0x1a71: 0x0341, 0x1a72: 0x0349, 0x1a73: 0x0391, 0x1a74: 0x00c1, 0x1a75: 0x0109, + 0x1a76: 0x00c9, 0x1a77: 0x04b1, 0x1a78: 0x0019, 0x1a79: 0x02e9, 0x1a7a: 0x0040, 0x1a7b: 0x02f1, + 0x1a7c: 0x02f9, 0x1a7d: 0x03f1, 0x1a7e: 0x0309, 0x1a7f: 0x0040, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x0311, 0x1a81: 0x00b1, 0x1a82: 0x0319, 0x1a83: 0x0101, 0x1a84: 0x0321, 0x1a85: 0x0040, + 0x1a86: 0x0051, 0x1a87: 0x0040, 0x1a88: 0x0040, 0x1a89: 0x0040, 0x1a8a: 0x0089, 0x1a8b: 0x0341, + 0x1a8c: 0x0349, 0x1a8d: 0x0391, 0x1a8e: 0x00c1, 0x1a8f: 0x0109, 0x1a90: 0x00c9, 0x1a91: 0x0040, + 0x1a92: 0x0019, 0x1a93: 0x02e9, 0x1a94: 0x03d9, 0x1a95: 0x02f1, 0x1a96: 0x02f9, 0x1a97: 0x03f1, + 0x1a98: 0x0309, 0x1a99: 0x00a9, 0x1a9a: 0x0311, 0x1a9b: 0x00b1, 0x1a9c: 0x0319, 0x1a9d: 0x0101, + 0x1a9e: 0x0321, 0x1a9f: 0x0329, 0x1aa0: 0x0051, 0x1aa1: 0x0339, 0x1aa2: 0x0751, 0x1aa3: 0x00b9, + 0x1aa4: 0x0089, 0x1aa5: 0x0341, 0x1aa6: 0x0349, 0x1aa7: 0x0391, 0x1aa8: 0x00c1, 0x1aa9: 0x0109, + 0x1aaa: 0x00c9, 0x1aab: 0x04b1, 0x1aac: 0x0019, 0x1aad: 0x02e9, 0x1aae: 0x03d9, 0x1aaf: 0x02f1, + 0x1ab0: 0x02f9, 0x1ab1: 0x03f1, 0x1ab2: 0x0309, 0x1ab3: 0x00a9, 0x1ab4: 0x0311, 0x1ab5: 0x00b1, + 0x1ab6: 0x0319, 0x1ab7: 0x0101, 0x1ab8: 0x0321, 0x1ab9: 0x0329, 0x1aba: 0x0051, 0x1abb: 0x0339, + 0x1abc: 0x0751, 0x1abd: 0x00b9, 0x1abe: 0x0089, 0x1abf: 0x0341, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x0349, 0x1ac1: 0x0391, 0x1ac2: 0x00c1, 0x1ac3: 0x0109, 0x1ac4: 0x00c9, 0x1ac5: 0x04b1, + 0x1ac6: 0x0019, 0x1ac7: 0x02e9, 0x1ac8: 0x03d9, 0x1ac9: 0x02f1, 0x1aca: 0x02f9, 0x1acb: 0x03f1, + 0x1acc: 0x0309, 0x1acd: 0x00a9, 0x1ace: 0x0311, 0x1acf: 0x00b1, 0x1ad0: 0x0319, 0x1ad1: 0x0101, + 0x1ad2: 0x0321, 0x1ad3: 0x0329, 0x1ad4: 0x0051, 0x1ad5: 0x0339, 0x1ad6: 0x0751, 0x1ad7: 0x00b9, + 0x1ad8: 0x0089, 0x1ad9: 0x0341, 0x1ada: 0x0349, 0x1adb: 0x0391, 0x1adc: 0x00c1, 0x1add: 0x0109, + 0x1ade: 0x00c9, 0x1adf: 0x04b1, 0x1ae0: 0x0019, 0x1ae1: 0x02e9, 0x1ae2: 0x03d9, 0x1ae3: 0x02f1, + 0x1ae4: 0x02f9, 0x1ae5: 0x03f1, 0x1ae6: 0x0309, 0x1ae7: 0x00a9, 0x1ae8: 0x0311, 0x1ae9: 0x00b1, + 0x1aea: 0x0319, 0x1aeb: 0x0101, 0x1aec: 0x0321, 0x1aed: 0x0329, 0x1aee: 0x0051, 0x1aef: 0x0339, + 0x1af0: 0x0751, 0x1af1: 0x00b9, 0x1af2: 0x0089, 0x1af3: 0x0341, 0x1af4: 0x0349, 0x1af5: 0x0391, + 0x1af6: 0x00c1, 0x1af7: 0x0109, 0x1af8: 0x00c9, 0x1af9: 0x04b1, 0x1afa: 0x0019, 0x1afb: 0x02e9, + 0x1afc: 0x03d9, 0x1afd: 0x02f1, 0x1afe: 0x02f9, 0x1aff: 0x03f1, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x0309, 0x1b01: 0x00a9, 0x1b02: 0x0311, 0x1b03: 0x00b1, 0x1b04: 0x0319, 0x1b05: 0x0101, + 0x1b06: 0x0321, 0x1b07: 0x0329, 0x1b08: 0x0051, 0x1b09: 0x0339, 0x1b0a: 0x0751, 0x1b0b: 0x00b9, + 0x1b0c: 0x0089, 0x1b0d: 0x0341, 0x1b0e: 0x0349, 0x1b0f: 0x0391, 0x1b10: 0x00c1, 0x1b11: 0x0109, + 0x1b12: 0x00c9, 0x1b13: 0x04b1, 0x1b14: 0x0019, 0x1b15: 0x02e9, 0x1b16: 0x03d9, 0x1b17: 0x02f1, + 0x1b18: 0x02f9, 0x1b19: 0x03f1, 0x1b1a: 0x0309, 0x1b1b: 0x00a9, 0x1b1c: 0x0311, 0x1b1d: 0x00b1, + 0x1b1e: 0x0319, 0x1b1f: 0x0101, 0x1b20: 0x0321, 0x1b21: 0x0329, 0x1b22: 0x0051, 0x1b23: 0x0339, + 0x1b24: 0x0751, 0x1b25: 0x00b9, 0x1b26: 0x0089, 0x1b27: 0x0341, 0x1b28: 0x0349, 0x1b29: 0x0391, + 0x1b2a: 0x00c1, 0x1b2b: 0x0109, 0x1b2c: 0x00c9, 0x1b2d: 0x04b1, 0x1b2e: 0x0019, 0x1b2f: 0x02e9, + 0x1b30: 0x03d9, 0x1b31: 0x02f1, 0x1b32: 0x02f9, 0x1b33: 0x03f1, 0x1b34: 0x0309, 0x1b35: 0x00a9, + 0x1b36: 0x0311, 0x1b37: 0x00b1, 0x1b38: 0x0319, 0x1b39: 0x0101, 0x1b3a: 0x0321, 0x1b3b: 0x0329, + 0x1b3c: 0x0051, 0x1b3d: 0x0339, 0x1b3e: 0x0751, 0x1b3f: 0x00b9, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x0089, 0x1b41: 0x0341, 0x1b42: 0x0349, 0x1b43: 0x0391, 0x1b44: 0x00c1, 0x1b45: 0x0109, + 0x1b46: 0x00c9, 0x1b47: 0x04b1, 0x1b48: 0x0019, 0x1b49: 0x02e9, 0x1b4a: 0x03d9, 0x1b4b: 0x02f1, + 0x1b4c: 0x02f9, 0x1b4d: 0x03f1, 0x1b4e: 0x0309, 0x1b4f: 0x00a9, 0x1b50: 0x0311, 0x1b51: 0x00b1, + 0x1b52: 0x0319, 0x1b53: 0x0101, 0x1b54: 0x0321, 0x1b55: 0x0329, 0x1b56: 0x0051, 0x1b57: 0x0339, + 0x1b58: 0x0751, 0x1b59: 0x00b9, 0x1b5a: 0x0089, 0x1b5b: 0x0341, 0x1b5c: 0x0349, 0x1b5d: 0x0391, + 0x1b5e: 0x00c1, 0x1b5f: 0x0109, 0x1b60: 0x00c9, 0x1b61: 0x04b1, 0x1b62: 0x0019, 0x1b63: 0x02e9, + 0x1b64: 0x03d9, 0x1b65: 0x02f1, 0x1b66: 0x02f9, 0x1b67: 0x03f1, 0x1b68: 0x0309, 0x1b69: 0x00a9, + 0x1b6a: 0x0311, 0x1b6b: 0x00b1, 0x1b6c: 0x0319, 0x1b6d: 0x0101, 0x1b6e: 0x0321, 0x1b6f: 0x0329, + 0x1b70: 0x0051, 0x1b71: 0x0339, 0x1b72: 0x0751, 0x1b73: 0x00b9, 0x1b74: 0x0089, 0x1b75: 0x0341, + 0x1b76: 0x0349, 0x1b77: 0x0391, 0x1b78: 0x00c1, 0x1b79: 0x0109, 0x1b7a: 0x00c9, 0x1b7b: 0x04b1, + 0x1b7c: 0x0019, 0x1b7d: 0x02e9, 0x1b7e: 0x03d9, 0x1b7f: 0x02f1, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x02f9, 0x1b81: 0x03f1, 0x1b82: 0x0309, 0x1b83: 0x00a9, 0x1b84: 0x0311, 0x1b85: 0x00b1, + 0x1b86: 0x0319, 0x1b87: 0x0101, 0x1b88: 0x0321, 0x1b89: 0x0329, 0x1b8a: 0x0051, 0x1b8b: 0x0339, + 0x1b8c: 0x0751, 0x1b8d: 0x00b9, 0x1b8e: 0x0089, 0x1b8f: 0x0341, 0x1b90: 0x0349, 0x1b91: 0x0391, + 0x1b92: 0x00c1, 0x1b93: 0x0109, 0x1b94: 0x00c9, 0x1b95: 0x04b1, 0x1b96: 0x0019, 0x1b97: 0x02e9, + 0x1b98: 0x03d9, 0x1b99: 0x02f1, 0x1b9a: 0x02f9, 0x1b9b: 0x03f1, 0x1b9c: 0x0309, 0x1b9d: 0x00a9, + 0x1b9e: 0x0311, 0x1b9f: 0x00b1, 0x1ba0: 0x0319, 0x1ba1: 0x0101, 0x1ba2: 0x0321, 0x1ba3: 0x0329, + 0x1ba4: 0x0051, 0x1ba5: 0x0339, 0x1ba6: 0x0751, 0x1ba7: 0x00b9, 0x1ba8: 0x0089, 0x1ba9: 0x0341, + 0x1baa: 0x0349, 0x1bab: 0x0391, 0x1bac: 0x00c1, 0x1bad: 0x0109, 0x1bae: 0x00c9, 0x1baf: 0x04b1, + 0x1bb0: 0x0019, 0x1bb1: 0x02e9, 0x1bb2: 0x03d9, 0x1bb3: 0x02f1, 0x1bb4: 0x02f9, 0x1bb5: 0x03f1, + 0x1bb6: 0x0309, 0x1bb7: 0x00a9, 0x1bb8: 0x0311, 0x1bb9: 0x00b1, 0x1bba: 0x0319, 0x1bbb: 0x0101, + 0x1bbc: 0x0321, 0x1bbd: 0x0329, 0x1bbe: 0x0051, 0x1bbf: 0x0339, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0751, 0x1bc1: 0x00b9, 0x1bc2: 0x0089, 0x1bc3: 0x0341, 0x1bc4: 0x0349, 0x1bc5: 0x0391, + 0x1bc6: 0x00c1, 0x1bc7: 0x0109, 0x1bc8: 0x00c9, 0x1bc9: 0x04b1, 0x1bca: 0x0019, 0x1bcb: 0x02e9, + 0x1bcc: 0x03d9, 0x1bcd: 0x02f1, 0x1bce: 0x02f9, 0x1bcf: 0x03f1, 0x1bd0: 0x0309, 0x1bd1: 0x00a9, + 0x1bd2: 0x0311, 0x1bd3: 0x00b1, 0x1bd4: 0x0319, 0x1bd5: 0x0101, 0x1bd6: 0x0321, 0x1bd7: 0x0329, + 0x1bd8: 0x0051, 0x1bd9: 0x0339, 0x1bda: 0x0751, 0x1bdb: 0x00b9, 0x1bdc: 0x0089, 0x1bdd: 0x0341, + 0x1bde: 0x0349, 0x1bdf: 0x0391, 0x1be0: 0x00c1, 0x1be1: 0x0109, 0x1be2: 0x00c9, 0x1be3: 0x04b1, + 0x1be4: 0x23e1, 0x1be5: 0x23e9, 0x1be6: 0x0040, 0x1be7: 0x0040, 0x1be8: 0x23f1, 0x1be9: 0x0399, + 0x1bea: 0x03a1, 0x1beb: 0x03a9, 0x1bec: 0x23f9, 0x1bed: 0x2401, 0x1bee: 0x2409, 0x1bef: 0x04d1, + 0x1bf0: 0x05f9, 0x1bf1: 0x2411, 0x1bf2: 0x2419, 0x1bf3: 0x2421, 0x1bf4: 0x2429, 0x1bf5: 0x2431, + 0x1bf6: 0x2439, 0x1bf7: 0x0799, 0x1bf8: 0x03c1, 0x1bf9: 0x04d1, 0x1bfa: 0x2441, 0x1bfb: 0x2449, + 0x1bfc: 0x2451, 0x1bfd: 0x03b1, 0x1bfe: 0x03b9, 0x1bff: 0x2459, + // Block 0x70, offset 0x1c00 + 0x1c00: 0x0769, 0x1c01: 0x2461, 0x1c02: 0x23f1, 0x1c03: 0x0399, 0x1c04: 0x03a1, 0x1c05: 0x03a9, + 0x1c06: 0x23f9, 0x1c07: 0x2401, 0x1c08: 0x2409, 0x1c09: 0x04d1, 0x1c0a: 0x05f9, 0x1c0b: 0x2411, + 0x1c0c: 0x2419, 0x1c0d: 0x2421, 0x1c0e: 0x2429, 0x1c0f: 0x2431, 0x1c10: 0x2439, 0x1c11: 0x0799, + 0x1c12: 0x03c1, 0x1c13: 0x2441, 0x1c14: 0x2441, 0x1c15: 0x2449, 0x1c16: 0x2451, 0x1c17: 0x03b1, + 0x1c18: 0x03b9, 0x1c19: 0x2459, 0x1c1a: 0x0769, 0x1c1b: 0x2469, 0x1c1c: 0x23f9, 0x1c1d: 0x04d1, + 0x1c1e: 0x2411, 0x1c1f: 0x03b1, 0x1c20: 0x03c1, 0x1c21: 0x0799, 0x1c22: 0x23f1, 0x1c23: 0x0399, + 0x1c24: 0x03a1, 0x1c25: 0x03a9, 0x1c26: 0x23f9, 0x1c27: 0x2401, 0x1c28: 0x2409, 0x1c29: 0x04d1, + 0x1c2a: 0x05f9, 0x1c2b: 0x2411, 0x1c2c: 0x2419, 0x1c2d: 0x2421, 0x1c2e: 0x2429, 0x1c2f: 0x2431, + 0x1c30: 0x2439, 0x1c31: 0x0799, 0x1c32: 0x03c1, 0x1c33: 0x04d1, 0x1c34: 0x2441, 0x1c35: 0x2449, + 0x1c36: 0x2451, 0x1c37: 0x03b1, 0x1c38: 0x03b9, 0x1c39: 0x2459, 0x1c3a: 0x0769, 0x1c3b: 0x2461, + 0x1c3c: 0x23f1, 0x1c3d: 0x0399, 0x1c3e: 0x03a1, 0x1c3f: 0x03a9, + // Block 0x71, offset 0x1c40 + 0x1c40: 0x23f9, 0x1c41: 0x2401, 0x1c42: 0x2409, 0x1c43: 0x04d1, 0x1c44: 0x05f9, 0x1c45: 0x2411, + 0x1c46: 0x2419, 0x1c47: 0x2421, 0x1c48: 0x2429, 0x1c49: 0x2431, 0x1c4a: 0x2439, 0x1c4b: 0x0799, + 0x1c4c: 0x03c1, 0x1c4d: 0x2441, 0x1c4e: 0x2441, 0x1c4f: 0x2449, 0x1c50: 0x2451, 0x1c51: 0x03b1, + 0x1c52: 0x03b9, 0x1c53: 0x2459, 0x1c54: 0x0769, 0x1c55: 0x2469, 0x1c56: 0x23f9, 0x1c57: 0x04d1, + 0x1c58: 0x2411, 0x1c59: 0x03b1, 0x1c5a: 0x03c1, 0x1c5b: 0x0799, 0x1c5c: 0x23f1, 0x1c5d: 0x0399, + 0x1c5e: 0x03a1, 0x1c5f: 0x03a9, 0x1c60: 0x23f9, 0x1c61: 0x2401, 0x1c62: 0x2409, 0x1c63: 0x04d1, + 0x1c64: 0x05f9, 0x1c65: 0x2411, 0x1c66: 0x2419, 0x1c67: 0x2421, 0x1c68: 0x2429, 0x1c69: 0x2431, + 0x1c6a: 0x2439, 0x1c6b: 0x0799, 0x1c6c: 0x03c1, 0x1c6d: 0x04d1, 0x1c6e: 0x2441, 0x1c6f: 0x2449, + 0x1c70: 0x2451, 0x1c71: 0x03b1, 0x1c72: 0x03b9, 0x1c73: 0x2459, 0x1c74: 0x0769, 0x1c75: 0x2461, + 0x1c76: 0x23f1, 0x1c77: 0x0399, 0x1c78: 0x03a1, 0x1c79: 0x03a9, 0x1c7a: 0x23f9, 0x1c7b: 0x2401, + 0x1c7c: 0x2409, 0x1c7d: 0x04d1, 0x1c7e: 0x05f9, 0x1c7f: 0x2411, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x2419, 0x1c81: 0x2421, 0x1c82: 0x2429, 0x1c83: 0x2431, 0x1c84: 0x2439, 0x1c85: 0x0799, + 0x1c86: 0x03c1, 0x1c87: 0x2441, 0x1c88: 0x2441, 0x1c89: 0x2449, 0x1c8a: 0x2451, 0x1c8b: 0x03b1, + 0x1c8c: 0x03b9, 0x1c8d: 0x2459, 0x1c8e: 0x0769, 0x1c8f: 0x2469, 0x1c90: 0x23f9, 0x1c91: 0x04d1, + 0x1c92: 0x2411, 0x1c93: 0x03b1, 0x1c94: 0x03c1, 0x1c95: 0x0799, 0x1c96: 0x23f1, 0x1c97: 0x0399, + 0x1c98: 0x03a1, 0x1c99: 0x03a9, 0x1c9a: 0x23f9, 0x1c9b: 0x2401, 0x1c9c: 0x2409, 0x1c9d: 0x04d1, + 0x1c9e: 0x05f9, 0x1c9f: 0x2411, 0x1ca0: 0x2419, 0x1ca1: 0x2421, 0x1ca2: 0x2429, 0x1ca3: 0x2431, + 0x1ca4: 0x2439, 0x1ca5: 0x0799, 0x1ca6: 0x03c1, 0x1ca7: 0x04d1, 0x1ca8: 0x2441, 0x1ca9: 0x2449, + 0x1caa: 0x2451, 0x1cab: 0x03b1, 0x1cac: 0x03b9, 0x1cad: 0x2459, 0x1cae: 0x0769, 0x1caf: 0x2461, + 0x1cb0: 0x23f1, 0x1cb1: 0x0399, 0x1cb2: 0x03a1, 0x1cb3: 0x03a9, 0x1cb4: 0x23f9, 0x1cb5: 0x2401, + 0x1cb6: 0x2409, 0x1cb7: 0x04d1, 0x1cb8: 0x05f9, 0x1cb9: 0x2411, 0x1cba: 0x2419, 0x1cbb: 0x2421, + 0x1cbc: 0x2429, 0x1cbd: 0x2431, 0x1cbe: 0x2439, 0x1cbf: 0x0799, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x03c1, 0x1cc1: 0x2441, 0x1cc2: 0x2441, 0x1cc3: 0x2449, 0x1cc4: 0x2451, 0x1cc5: 0x03b1, + 0x1cc6: 0x03b9, 0x1cc7: 0x2459, 0x1cc8: 0x0769, 0x1cc9: 0x2469, 0x1cca: 0x23f9, 0x1ccb: 0x04d1, + 0x1ccc: 0x2411, 0x1ccd: 0x03b1, 0x1cce: 0x03c1, 0x1ccf: 0x0799, 0x1cd0: 0x23f1, 0x1cd1: 0x0399, + 0x1cd2: 0x03a1, 0x1cd3: 0x03a9, 0x1cd4: 0x23f9, 0x1cd5: 0x2401, 0x1cd6: 0x2409, 0x1cd7: 0x04d1, + 0x1cd8: 0x05f9, 0x1cd9: 0x2411, 0x1cda: 0x2419, 0x1cdb: 0x2421, 0x1cdc: 0x2429, 0x1cdd: 0x2431, + 0x1cde: 0x2439, 0x1cdf: 0x0799, 0x1ce0: 0x03c1, 0x1ce1: 0x04d1, 0x1ce2: 0x2441, 0x1ce3: 0x2449, + 0x1ce4: 0x2451, 0x1ce5: 0x03b1, 0x1ce6: 0x03b9, 0x1ce7: 0x2459, 0x1ce8: 0x0769, 0x1ce9: 0x2461, + 0x1cea: 0x23f1, 0x1ceb: 0x0399, 0x1cec: 0x03a1, 0x1ced: 0x03a9, 0x1cee: 0x23f9, 0x1cef: 0x2401, + 0x1cf0: 0x2409, 0x1cf1: 0x04d1, 0x1cf2: 0x05f9, 0x1cf3: 0x2411, 0x1cf4: 0x2419, 0x1cf5: 0x2421, + 0x1cf6: 0x2429, 0x1cf7: 0x2431, 0x1cf8: 0x2439, 0x1cf9: 0x0799, 0x1cfa: 0x03c1, 0x1cfb: 0x2441, + 0x1cfc: 0x2441, 0x1cfd: 0x2449, 0x1cfe: 0x2451, 0x1cff: 0x03b1, + // Block 0x74, offset 0x1d00 + 0x1d00: 0x03b9, 0x1d01: 0x2459, 0x1d02: 0x0769, 0x1d03: 0x2469, 0x1d04: 0x23f9, 0x1d05: 0x04d1, + 0x1d06: 0x2411, 0x1d07: 0x03b1, 0x1d08: 0x03c1, 0x1d09: 0x0799, 0x1d0a: 0x2471, 0x1d0b: 0x2471, + 0x1d0c: 0x0040, 0x1d0d: 0x0040, 0x1d0e: 0x06e1, 0x1d0f: 0x0049, 0x1d10: 0x0029, 0x1d11: 0x0031, + 0x1d12: 0x06e9, 0x1d13: 0x06f1, 0x1d14: 0x06f9, 0x1d15: 0x0701, 0x1d16: 0x0709, 0x1d17: 0x0711, + 0x1d18: 0x06e1, 0x1d19: 0x0049, 0x1d1a: 0x0029, 0x1d1b: 0x0031, 0x1d1c: 0x06e9, 0x1d1d: 0x06f1, + 0x1d1e: 0x06f9, 0x1d1f: 0x0701, 0x1d20: 0x0709, 0x1d21: 0x0711, 0x1d22: 0x06e1, 0x1d23: 0x0049, + 0x1d24: 0x0029, 0x1d25: 0x0031, 0x1d26: 0x06e9, 0x1d27: 0x06f1, 0x1d28: 0x06f9, 0x1d29: 0x0701, + 0x1d2a: 0x0709, 0x1d2b: 0x0711, 0x1d2c: 0x06e1, 0x1d2d: 0x0049, 0x1d2e: 0x0029, 0x1d2f: 0x0031, + 0x1d30: 0x06e9, 0x1d31: 0x06f1, 0x1d32: 0x06f9, 0x1d33: 0x0701, 0x1d34: 0x0709, 0x1d35: 0x0711, + 0x1d36: 0x06e1, 0x1d37: 0x0049, 0x1d38: 0x0029, 0x1d39: 0x0031, 0x1d3a: 0x06e9, 0x1d3b: 0x06f1, + 0x1d3c: 0x06f9, 0x1d3d: 0x0701, 0x1d3e: 0x0709, 0x1d3f: 0x0711, + // Block 0x75, offset 0x1d40 + 0x1d40: 0x3308, 0x1d41: 0x3308, 0x1d42: 0x3308, 0x1d43: 0x3308, 0x1d44: 0x3308, 0x1d45: 0x3308, + 0x1d46: 0x3308, 0x1d47: 0x0040, 0x1d48: 0x3308, 0x1d49: 0x3308, 0x1d4a: 0x3308, 0x1d4b: 0x3308, + 0x1d4c: 0x3308, 0x1d4d: 0x3308, 0x1d4e: 0x3308, 0x1d4f: 0x3308, 0x1d50: 0x3308, 0x1d51: 0x3308, + 0x1d52: 0x3308, 0x1d53: 0x3308, 0x1d54: 0x3308, 0x1d55: 0x3308, 0x1d56: 0x3308, 0x1d57: 0x3308, + 0x1d58: 0x3308, 0x1d59: 0x0040, 0x1d5a: 0x0040, 0x1d5b: 0x3308, 0x1d5c: 0x3308, 0x1d5d: 0x3308, + 0x1d5e: 0x3308, 0x1d5f: 0x3308, 0x1d60: 0x3308, 0x1d61: 0x3308, 0x1d62: 0x0040, 0x1d63: 0x3308, + 0x1d64: 0x3308, 0x1d65: 0x0040, 0x1d66: 0x3308, 0x1d67: 0x3308, 0x1d68: 0x3308, 0x1d69: 0x3308, + 0x1d6a: 0x3308, 0x1d6b: 0x0040, 0x1d6c: 0x0040, 0x1d6d: 0x0040, 0x1d6e: 0x0040, 0x1d6f: 0x0040, + 0x1d70: 0x2479, 0x1d71: 0x2481, 0x1d72: 0x02a9, 0x1d73: 0x2489, 0x1d74: 0x02b1, 0x1d75: 0x2491, + 0x1d76: 0x2499, 0x1d77: 0x24a1, 0x1d78: 0x24a9, 0x1d79: 0x24b1, 0x1d7a: 0x24b9, 0x1d7b: 0x24c1, + 0x1d7c: 0x02b9, 0x1d7d: 0x24c9, 0x1d7e: 0x24d1, 0x1d7f: 0x02c1, + // Block 0x76, offset 0x1d80 + 0x1d80: 0x02c9, 0x1d81: 0x24d9, 0x1d82: 0x24e1, 0x1d83: 0x24e9, 0x1d84: 0x24f1, 0x1d85: 0x24f9, + 0x1d86: 0x2501, 0x1d87: 0x2509, 0x1d88: 0x2511, 0x1d89: 0x2519, 0x1d8a: 0x2521, 0x1d8b: 0x2529, + 0x1d8c: 0x2531, 0x1d8d: 0x2539, 0x1d8e: 0x2541, 0x1d8f: 0x2549, 0x1d90: 0x2551, 0x1d91: 0x2479, + 0x1d92: 0x2481, 0x1d93: 0x02a9, 0x1d94: 0x2489, 0x1d95: 0x02b1, 0x1d96: 0x2491, 0x1d97: 0x2499, + 0x1d98: 0x24a1, 0x1d99: 0x24a9, 0x1d9a: 0x24b1, 0x1d9b: 0x24b9, 0x1d9c: 0x02b9, 0x1d9d: 0x24c9, + 0x1d9e: 0x02c1, 0x1d9f: 0x24d9, 0x1da0: 0x24e1, 0x1da1: 0x24e9, 0x1da2: 0x24f1, 0x1da3: 0x24f9, + 0x1da4: 0x2501, 0x1da5: 0x02d1, 0x1da6: 0x2509, 0x1da7: 0x2559, 0x1da8: 0x2531, 0x1da9: 0x2561, + 0x1daa: 0x2569, 0x1dab: 0x2571, 0x1dac: 0x2579, 0x1dad: 0x2581, 0x1dae: 0x0040, 0x1daf: 0x0040, + 0x1db0: 0x0040, 0x1db1: 0x0040, 0x1db2: 0x0040, 0x1db3: 0x0040, 0x1db4: 0x0040, 0x1db5: 0x0040, + 0x1db6: 0x0040, 0x1db7: 0x0040, 0x1db8: 0x0040, 0x1db9: 0x0040, 0x1dba: 0x0040, 0x1dbb: 0x0040, + 0x1dbc: 0x0040, 0x1dbd: 0x0040, 0x1dbe: 0x0040, 0x1dbf: 0x0040, + // Block 0x77, offset 0x1dc0 + 0x1dc0: 0xe115, 0x1dc1: 0xe115, 0x1dc2: 0xe135, 0x1dc3: 0xe135, 0x1dc4: 0xe115, 0x1dc5: 0xe115, + 0x1dc6: 0xe175, 0x1dc7: 0xe175, 0x1dc8: 0xe115, 0x1dc9: 0xe115, 0x1dca: 0xe135, 0x1dcb: 0xe135, + 0x1dcc: 0xe115, 0x1dcd: 0xe115, 0x1dce: 0xe1f5, 0x1dcf: 0xe1f5, 0x1dd0: 0xe115, 0x1dd1: 0xe115, + 0x1dd2: 0xe135, 0x1dd3: 0xe135, 0x1dd4: 0xe115, 0x1dd5: 0xe115, 0x1dd6: 0xe175, 0x1dd7: 0xe175, + 0x1dd8: 0xe115, 0x1dd9: 0xe115, 0x1dda: 0xe135, 0x1ddb: 0xe135, 0x1ddc: 0xe115, 0x1ddd: 0xe115, + 0x1dde: 0x8ca5, 0x1ddf: 0x8ca5, 0x1de0: 0x04b5, 0x1de1: 0x04b5, 0x1de2: 0x0a08, 0x1de3: 0x0a08, + 0x1de4: 0x0a08, 0x1de5: 0x0a08, 0x1de6: 0x0a08, 0x1de7: 0x0a08, 0x1de8: 0x0a08, 0x1de9: 0x0a08, + 0x1dea: 0x0a08, 0x1deb: 0x0a08, 0x1dec: 0x0a08, 0x1ded: 0x0a08, 0x1dee: 0x0a08, 0x1def: 0x0a08, + 0x1df0: 0x0a08, 0x1df1: 0x0a08, 0x1df2: 0x0a08, 0x1df3: 0x0a08, 0x1df4: 0x0a08, 0x1df5: 0x0a08, + 0x1df6: 0x0a08, 0x1df7: 0x0a08, 0x1df8: 0x0a08, 0x1df9: 0x0a08, 0x1dfa: 0x0a08, 0x1dfb: 0x0a08, + 0x1dfc: 0x0a08, 0x1dfd: 0x0a08, 0x1dfe: 0x0a08, 0x1dff: 0x0a08, + // Block 0x78, offset 0x1e00 + 0x1e00: 0x20b1, 0x1e01: 0x20b9, 0x1e02: 0x20d9, 0x1e03: 0x20f1, 0x1e04: 0x0040, 0x1e05: 0x2189, + 0x1e06: 0x2109, 0x1e07: 0x20e1, 0x1e08: 0x2131, 0x1e09: 0x2191, 0x1e0a: 0x2161, 0x1e0b: 0x2169, + 0x1e0c: 0x2171, 0x1e0d: 0x2179, 0x1e0e: 0x2111, 0x1e0f: 0x2141, 0x1e10: 0x2151, 0x1e11: 0x2121, + 0x1e12: 0x2159, 0x1e13: 0x2101, 0x1e14: 0x2119, 0x1e15: 0x20c9, 0x1e16: 0x20d1, 0x1e17: 0x20e9, + 0x1e18: 0x20f9, 0x1e19: 0x2129, 0x1e1a: 0x2139, 0x1e1b: 0x2149, 0x1e1c: 0x2589, 0x1e1d: 0x1689, + 0x1e1e: 0x2591, 0x1e1f: 0x2599, 0x1e20: 0x0040, 0x1e21: 0x20b9, 0x1e22: 0x20d9, 0x1e23: 0x0040, + 0x1e24: 0x2181, 0x1e25: 0x0040, 0x1e26: 0x0040, 0x1e27: 0x20e1, 0x1e28: 0x0040, 0x1e29: 0x2191, + 0x1e2a: 0x2161, 0x1e2b: 0x2169, 0x1e2c: 0x2171, 0x1e2d: 0x2179, 0x1e2e: 0x2111, 0x1e2f: 0x2141, + 0x1e30: 0x2151, 0x1e31: 0x2121, 0x1e32: 0x2159, 0x1e33: 0x0040, 0x1e34: 0x2119, 0x1e35: 0x20c9, + 0x1e36: 0x20d1, 0x1e37: 0x20e9, 0x1e38: 0x0040, 0x1e39: 0x2129, 0x1e3a: 0x0040, 0x1e3b: 0x2149, + 0x1e3c: 0x0040, 0x1e3d: 0x0040, 0x1e3e: 0x0040, 0x1e3f: 0x0040, + // Block 0x79, offset 0x1e40 + 0x1e40: 0x0040, 0x1e41: 0x0040, 0x1e42: 0x20d9, 0x1e43: 0x0040, 0x1e44: 0x0040, 0x1e45: 0x0040, + 0x1e46: 0x0040, 0x1e47: 0x20e1, 0x1e48: 0x0040, 0x1e49: 0x2191, 0x1e4a: 0x0040, 0x1e4b: 0x2169, + 0x1e4c: 0x0040, 0x1e4d: 0x2179, 0x1e4e: 0x2111, 0x1e4f: 0x2141, 0x1e50: 0x0040, 0x1e51: 0x2121, + 0x1e52: 0x2159, 0x1e53: 0x0040, 0x1e54: 0x2119, 0x1e55: 0x0040, 0x1e56: 0x0040, 0x1e57: 0x20e9, + 0x1e58: 0x0040, 0x1e59: 0x2129, 0x1e5a: 0x0040, 0x1e5b: 0x2149, 0x1e5c: 0x0040, 0x1e5d: 0x1689, + 0x1e5e: 0x0040, 0x1e5f: 0x2599, 0x1e60: 0x0040, 0x1e61: 0x20b9, 0x1e62: 0x20d9, 0x1e63: 0x0040, + 0x1e64: 0x2181, 0x1e65: 0x0040, 0x1e66: 0x0040, 0x1e67: 0x20e1, 0x1e68: 0x2131, 0x1e69: 0x2191, + 0x1e6a: 0x2161, 0x1e6b: 0x0040, 0x1e6c: 0x2171, 0x1e6d: 0x2179, 0x1e6e: 0x2111, 0x1e6f: 0x2141, + 0x1e70: 0x2151, 0x1e71: 0x2121, 0x1e72: 0x2159, 0x1e73: 0x0040, 0x1e74: 0x2119, 0x1e75: 0x20c9, + 0x1e76: 0x20d1, 0x1e77: 0x20e9, 0x1e78: 0x0040, 0x1e79: 0x2129, 0x1e7a: 0x2139, 0x1e7b: 0x2149, + 0x1e7c: 0x2589, 0x1e7d: 0x0040, 0x1e7e: 0x2591, 0x1e7f: 0x0040, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x20b1, 0x1e81: 0x20b9, 0x1e82: 0x20d9, 0x1e83: 0x20f1, 0x1e84: 0x2181, 0x1e85: 0x2189, + 0x1e86: 0x2109, 0x1e87: 0x20e1, 0x1e88: 0x2131, 0x1e89: 0x2191, 0x1e8a: 0x0040, 0x1e8b: 0x2169, + 0x1e8c: 0x2171, 0x1e8d: 0x2179, 0x1e8e: 0x2111, 0x1e8f: 0x2141, 0x1e90: 0x2151, 0x1e91: 0x2121, + 0x1e92: 0x2159, 0x1e93: 0x2101, 0x1e94: 0x2119, 0x1e95: 0x20c9, 0x1e96: 0x20d1, 0x1e97: 0x20e9, + 0x1e98: 0x20f9, 0x1e99: 0x2129, 0x1e9a: 0x2139, 0x1e9b: 0x2149, 0x1e9c: 0x0040, 0x1e9d: 0x0040, + 0x1e9e: 0x0040, 0x1e9f: 0x0040, 0x1ea0: 0x0040, 0x1ea1: 0x20b9, 0x1ea2: 0x20d9, 0x1ea3: 0x20f1, + 0x1ea4: 0x0040, 0x1ea5: 0x2189, 0x1ea6: 0x2109, 0x1ea7: 0x20e1, 0x1ea8: 0x2131, 0x1ea9: 0x2191, + 0x1eaa: 0x0040, 0x1eab: 0x2169, 0x1eac: 0x2171, 0x1ead: 0x2179, 0x1eae: 0x2111, 0x1eaf: 0x2141, + 0x1eb0: 0x2151, 0x1eb1: 0x2121, 0x1eb2: 0x2159, 0x1eb3: 0x2101, 0x1eb4: 0x2119, 0x1eb5: 0x20c9, + 0x1eb6: 0x20d1, 0x1eb7: 0x20e9, 0x1eb8: 0x20f9, 0x1eb9: 0x2129, 0x1eba: 0x2139, 0x1ebb: 0x2149, + 0x1ebc: 0x0040, 0x1ebd: 0x0040, 0x1ebe: 0x0040, 0x1ebf: 0x0040, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0x0040, 0x1ec1: 0x25a2, 0x1ec2: 0x25aa, 0x1ec3: 0x25b2, 0x1ec4: 0x25ba, 0x1ec5: 0x25c2, + 0x1ec6: 0x25ca, 0x1ec7: 0x25d2, 0x1ec8: 0x25da, 0x1ec9: 0x25e2, 0x1eca: 0x25ea, 0x1ecb: 0x0018, + 0x1ecc: 0x0018, 0x1ecd: 0x0018, 0x1ece: 0x0018, 0x1ecf: 0x0018, 0x1ed0: 0x25f2, 0x1ed1: 0x25fa, + 0x1ed2: 0x2602, 0x1ed3: 0x260a, 0x1ed4: 0x2612, 0x1ed5: 0x261a, 0x1ed6: 0x2622, 0x1ed7: 0x262a, + 0x1ed8: 0x2632, 0x1ed9: 0x263a, 0x1eda: 0x2642, 0x1edb: 0x264a, 0x1edc: 0x2652, 0x1edd: 0x265a, + 0x1ede: 0x2662, 0x1edf: 0x266a, 0x1ee0: 0x2672, 0x1ee1: 0x267a, 0x1ee2: 0x2682, 0x1ee3: 0x268a, + 0x1ee4: 0x2692, 0x1ee5: 0x269a, 0x1ee6: 0x26a2, 0x1ee7: 0x26aa, 0x1ee8: 0x26b2, 0x1ee9: 0x26ba, + 0x1eea: 0x26c1, 0x1eeb: 0x03d9, 0x1eec: 0x00b9, 0x1eed: 0x1239, 0x1eee: 0x26c9, 0x1eef: 0x0018, + 0x1ef0: 0x0019, 0x1ef1: 0x02e9, 0x1ef2: 0x03d9, 0x1ef3: 0x02f1, 0x1ef4: 0x02f9, 0x1ef5: 0x03f1, + 0x1ef6: 0x0309, 0x1ef7: 0x00a9, 0x1ef8: 0x0311, 0x1ef9: 0x00b1, 0x1efa: 0x0319, 0x1efb: 0x0101, + 0x1efc: 0x0321, 0x1efd: 0x0329, 0x1efe: 0x0051, 0x1eff: 0x0339, + // Block 0x7c, offset 0x1f00 + 0x1f00: 0x0751, 0x1f01: 0x00b9, 0x1f02: 0x0089, 0x1f03: 0x0341, 0x1f04: 0x0349, 0x1f05: 0x0391, + 0x1f06: 0x00c1, 0x1f07: 0x0109, 0x1f08: 0x00c9, 0x1f09: 0x04b1, 0x1f0a: 0x26d1, 0x1f0b: 0x11f9, + 0x1f0c: 0x26d9, 0x1f0d: 0x04d9, 0x1f0e: 0x26e1, 0x1f0f: 0x26e9, 0x1f10: 0x0018, 0x1f11: 0x0018, + 0x1f12: 0x0018, 0x1f13: 0x0018, 0x1f14: 0x0018, 0x1f15: 0x0018, 0x1f16: 0x0018, 0x1f17: 0x0018, + 0x1f18: 0x0018, 0x1f19: 0x0018, 0x1f1a: 0x0018, 0x1f1b: 0x0018, 0x1f1c: 0x0018, 0x1f1d: 0x0018, + 0x1f1e: 0x0018, 0x1f1f: 0x0018, 0x1f20: 0x0018, 0x1f21: 0x0018, 0x1f22: 0x0018, 0x1f23: 0x0018, + 0x1f24: 0x0018, 0x1f25: 0x0018, 0x1f26: 0x0018, 0x1f27: 0x0018, 0x1f28: 0x0018, 0x1f29: 0x0018, + 0x1f2a: 0x26f1, 0x1f2b: 0x26f9, 0x1f2c: 0x2701, 0x1f2d: 0x0018, 0x1f2e: 0x0018, 0x1f2f: 0x0018, + 0x1f30: 0x0018, 0x1f31: 0x0018, 0x1f32: 0x0018, 0x1f33: 0x0018, 0x1f34: 0x0018, 0x1f35: 0x0018, + 0x1f36: 0x0018, 0x1f37: 0x0018, 0x1f38: 0x0018, 0x1f39: 0x0018, 0x1f3a: 0x0018, 0x1f3b: 0x0018, + 0x1f3c: 0x0018, 0x1f3d: 0x0018, 0x1f3e: 0x0018, 0x1f3f: 0x0018, + // Block 0x7d, offset 0x1f40 + 0x1f40: 0x2711, 0x1f41: 0x2719, 0x1f42: 0x2721, 0x1f43: 0x0040, 0x1f44: 0x0040, 0x1f45: 0x0040, + 0x1f46: 0x0040, 0x1f47: 0x0040, 0x1f48: 0x0040, 0x1f49: 0x0040, 0x1f4a: 0x0040, 0x1f4b: 0x0040, + 0x1f4c: 0x0040, 0x1f4d: 0x0040, 0x1f4e: 0x0040, 0x1f4f: 0x0040, 0x1f50: 0x2729, 0x1f51: 0x2731, + 0x1f52: 0x2739, 0x1f53: 0x2741, 0x1f54: 0x2749, 0x1f55: 0x2751, 0x1f56: 0x2759, 0x1f57: 0x2761, + 0x1f58: 0x2769, 0x1f59: 0x2771, 0x1f5a: 0x2779, 0x1f5b: 0x2781, 0x1f5c: 0x2789, 0x1f5d: 0x2791, + 0x1f5e: 0x2799, 0x1f5f: 0x27a1, 0x1f60: 0x27a9, 0x1f61: 0x27b1, 0x1f62: 0x27b9, 0x1f63: 0x27c1, + 0x1f64: 0x27c9, 0x1f65: 0x27d1, 0x1f66: 0x27d9, 0x1f67: 0x27e1, 0x1f68: 0x27e9, 0x1f69: 0x27f1, + 0x1f6a: 0x27f9, 0x1f6b: 0x2801, 0x1f6c: 0x2809, 0x1f6d: 0x2811, 0x1f6e: 0x2819, 0x1f6f: 0x2821, + 0x1f70: 0x2829, 0x1f71: 0x2831, 0x1f72: 0x2839, 0x1f73: 0x2841, 0x1f74: 0x2849, 0x1f75: 0x2851, + 0x1f76: 0x2859, 0x1f77: 0x2861, 0x1f78: 0x2869, 0x1f79: 0x2871, 0x1f7a: 0x2879, 0x1f7b: 0x2881, + 0x1f7c: 0x0040, 0x1f7d: 0x0040, 0x1f7e: 0x0040, 0x1f7f: 0x0040, + // Block 0x7e, offset 0x1f80 + 0x1f80: 0x28e1, 0x1f81: 0x28e9, 0x1f82: 0x28f1, 0x1f83: 0x8cbd, 0x1f84: 0x28f9, 0x1f85: 0x2901, + 0x1f86: 0x2909, 0x1f87: 0x2911, 0x1f88: 0x2919, 0x1f89: 0x2921, 0x1f8a: 0x2929, 0x1f8b: 0x2931, + 0x1f8c: 0x2939, 0x1f8d: 0x8cdd, 0x1f8e: 0x2941, 0x1f8f: 0x2949, 0x1f90: 0x2951, 0x1f91: 0x2959, + 0x1f92: 0x8cfd, 0x1f93: 0x2961, 0x1f94: 0x2969, 0x1f95: 0x2799, 0x1f96: 0x8d1d, 0x1f97: 0x2971, + 0x1f98: 0x2979, 0x1f99: 0x2981, 0x1f9a: 0x2989, 0x1f9b: 0x2991, 0x1f9c: 0x8d3d, 0x1f9d: 0x2999, + 0x1f9e: 0x29a1, 0x1f9f: 0x29a9, 0x1fa0: 0x29b1, 0x1fa1: 0x29b9, 0x1fa2: 0x2871, 0x1fa3: 0x29c1, + 0x1fa4: 0x29c9, 0x1fa5: 0x29d1, 0x1fa6: 0x29d9, 0x1fa7: 0x29e1, 0x1fa8: 0x29e9, 0x1fa9: 0x29f1, + 0x1faa: 0x29f9, 0x1fab: 0x2a01, 0x1fac: 0x2a09, 0x1fad: 0x2a11, 0x1fae: 0x2a19, 0x1faf: 0x2a21, + 0x1fb0: 0x2a29, 0x1fb1: 0x2a31, 0x1fb2: 0x2a31, 0x1fb3: 0x2a31, 0x1fb4: 0x8d5d, 0x1fb5: 0x2a39, + 0x1fb6: 0x2a41, 0x1fb7: 0x2a49, 0x1fb8: 0x8d7d, 0x1fb9: 0x2a51, 0x1fba: 0x2a59, 0x1fbb: 0x2a61, + 0x1fbc: 0x2a69, 0x1fbd: 0x2a71, 0x1fbe: 0x2a79, 0x1fbf: 0x2a81, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x2a89, 0x1fc1: 0x2a91, 0x1fc2: 0x2a99, 0x1fc3: 0x2aa1, 0x1fc4: 0x2aa9, 0x1fc5: 0x2ab1, + 0x1fc6: 0x2ab1, 0x1fc7: 0x2ab9, 0x1fc8: 0x2ac1, 0x1fc9: 0x2ac9, 0x1fca: 0x2ad1, 0x1fcb: 0x2ad9, + 0x1fcc: 0x2ae1, 0x1fcd: 0x2ae9, 0x1fce: 0x2af1, 0x1fcf: 0x2af9, 0x1fd0: 0x2b01, 0x1fd1: 0x2b09, + 0x1fd2: 0x2b11, 0x1fd3: 0x2b19, 0x1fd4: 0x2b21, 0x1fd5: 0x2b29, 0x1fd6: 0x2b31, 0x1fd7: 0x2b39, + 0x1fd8: 0x2b41, 0x1fd9: 0x8d9d, 0x1fda: 0x2b49, 0x1fdb: 0x2b51, 0x1fdc: 0x2b59, 0x1fdd: 0x2751, + 0x1fde: 0x2b61, 0x1fdf: 0x2b69, 0x1fe0: 0x8dbd, 0x1fe1: 0x8ddd, 0x1fe2: 0x2b71, 0x1fe3: 0x2b79, + 0x1fe4: 0x2b81, 0x1fe5: 0x2b89, 0x1fe6: 0x2b91, 0x1fe7: 0x2b99, 0x1fe8: 0x2040, 0x1fe9: 0x2ba1, + 0x1fea: 0x2ba9, 0x1feb: 0x2ba9, 0x1fec: 0x8dfd, 0x1fed: 0x2bb1, 0x1fee: 0x2bb9, 0x1fef: 0x2bc1, + 0x1ff0: 0x2bc9, 0x1ff1: 0x8e1d, 0x1ff2: 0x2bd1, 0x1ff3: 0x2bd9, 0x1ff4: 0x2040, 0x1ff5: 0x2be1, + 0x1ff6: 0x2be9, 0x1ff7: 0x2bf1, 0x1ff8: 0x2bf9, 0x1ff9: 0x2c01, 0x1ffa: 0x2c09, 0x1ffb: 0x8e3d, + 0x1ffc: 0x2c11, 0x1ffd: 0x8e5d, 0x1ffe: 0x2c19, 0x1fff: 0x2c21, + // Block 0x80, offset 0x2000 + 0x2000: 0x2c29, 0x2001: 0x2c31, 0x2002: 0x2c39, 0x2003: 0x2c41, 0x2004: 0x2c49, 0x2005: 0x2c51, + 0x2006: 0x2c59, 0x2007: 0x2c61, 0x2008: 0x2c69, 0x2009: 0x8e7d, 0x200a: 0x2c71, 0x200b: 0x2c79, + 0x200c: 0x2c81, 0x200d: 0x2c89, 0x200e: 0x2c91, 0x200f: 0x8e9d, 0x2010: 0x2c99, 0x2011: 0x8ebd, + 0x2012: 0x8edd, 0x2013: 0x2ca1, 0x2014: 0x2ca9, 0x2015: 0x2ca9, 0x2016: 0x2cb1, 0x2017: 0x8efd, + 0x2018: 0x8f1d, 0x2019: 0x2cb9, 0x201a: 0x2cc1, 0x201b: 0x2cc9, 0x201c: 0x2cd1, 0x201d: 0x2cd9, + 0x201e: 0x2ce1, 0x201f: 0x2ce9, 0x2020: 0x2cf1, 0x2021: 0x2cf9, 0x2022: 0x2d01, 0x2023: 0x2d09, + 0x2024: 0x8f3d, 0x2025: 0x2d11, 0x2026: 0x2d19, 0x2027: 0x2d21, 0x2028: 0x2d29, 0x2029: 0x2d21, + 0x202a: 0x2d31, 0x202b: 0x2d39, 0x202c: 0x2d41, 0x202d: 0x2d49, 0x202e: 0x2d51, 0x202f: 0x2d59, + 0x2030: 0x2d61, 0x2031: 0x2d69, 0x2032: 0x2d71, 0x2033: 0x2d79, 0x2034: 0x2d81, 0x2035: 0x2d89, + 0x2036: 0x2d91, 0x2037: 0x2d99, 0x2038: 0x8f5d, 0x2039: 0x2da1, 0x203a: 0x2da9, 0x203b: 0x2db1, + 0x203c: 0x2db9, 0x203d: 0x2dc1, 0x203e: 0x8f7d, 0x203f: 0x2dc9, + // Block 0x81, offset 0x2040 + 0x2040: 0x2dd1, 0x2041: 0x2dd9, 0x2042: 0x2de1, 0x2043: 0x2de9, 0x2044: 0x2df1, 0x2045: 0x2df9, + 0x2046: 0x2e01, 0x2047: 0x2e09, 0x2048: 0x2e11, 0x2049: 0x2e19, 0x204a: 0x8f9d, 0x204b: 0x2e21, + 0x204c: 0x2e29, 0x204d: 0x2e31, 0x204e: 0x2e39, 0x204f: 0x2e41, 0x2050: 0x2e49, 0x2051: 0x2e51, + 0x2052: 0x2e59, 0x2053: 0x2e61, 0x2054: 0x2e69, 0x2055: 0x2e71, 0x2056: 0x2e79, 0x2057: 0x2e81, + 0x2058: 0x2e89, 0x2059: 0x2e91, 0x205a: 0x2e99, 0x205b: 0x2ea1, 0x205c: 0x2ea9, 0x205d: 0x8fbd, + 0x205e: 0x2eb1, 0x205f: 0x2eb9, 0x2060: 0x2ec1, 0x2061: 0x2ec9, 0x2062: 0x2ed1, 0x2063: 0x8fdd, + 0x2064: 0x2ed9, 0x2065: 0x2ee1, 0x2066: 0x2ee9, 0x2067: 0x2ef1, 0x2068: 0x2ef9, 0x2069: 0x2f01, + 0x206a: 0x2f09, 0x206b: 0x2f11, 0x206c: 0x7f0d, 0x206d: 0x2f19, 0x206e: 0x2f21, 0x206f: 0x2f29, + 0x2070: 0x8ffd, 0x2071: 0x2f31, 0x2072: 0x2f39, 0x2073: 0x2f41, 0x2074: 0x2f49, 0x2075: 0x2f51, + 0x2076: 0x2f59, 0x2077: 0x901d, 0x2078: 0x903d, 0x2079: 0x905d, 0x207a: 0x2f61, 0x207b: 0x907d, + 0x207c: 0x2f69, 0x207d: 0x2f71, 0x207e: 0x2f79, 0x207f: 0x2f81, + // Block 0x82, offset 0x2080 + 0x2080: 0x2f89, 0x2081: 0x2f91, 0x2082: 0x2f99, 0x2083: 0x2fa1, 0x2084: 0x2fa9, 0x2085: 0x2fb1, + 0x2086: 0x909d, 0x2087: 0x2fb9, 0x2088: 0x2fc1, 0x2089: 0x2fc9, 0x208a: 0x2fd1, 0x208b: 0x2fd9, + 0x208c: 0x2fe1, 0x208d: 0x90bd, 0x208e: 0x2fe9, 0x208f: 0x2ff1, 0x2090: 0x90dd, 0x2091: 0x90fd, + 0x2092: 0x2ff9, 0x2093: 0x3001, 0x2094: 0x3009, 0x2095: 0x3011, 0x2096: 0x3019, 0x2097: 0x3021, + 0x2098: 0x3029, 0x2099: 0x3031, 0x209a: 0x3039, 0x209b: 0x911d, 0x209c: 0x3041, 0x209d: 0x913d, + 0x209e: 0x3049, 0x209f: 0x2040, 0x20a0: 0x3051, 0x20a1: 0x3059, 0x20a2: 0x3061, 0x20a3: 0x915d, + 0x20a4: 0x3069, 0x20a5: 0x3071, 0x20a6: 0x917d, 0x20a7: 0x919d, 0x20a8: 0x3079, 0x20a9: 0x3081, + 0x20aa: 0x3089, 0x20ab: 0x3091, 0x20ac: 0x3099, 0x20ad: 0x3099, 0x20ae: 0x30a1, 0x20af: 0x30a9, + 0x20b0: 0x30b1, 0x20b1: 0x30b9, 0x20b2: 0x30c1, 0x20b3: 0x30c9, 0x20b4: 0x30d1, 0x20b5: 0x91bd, + 0x20b6: 0x30d9, 0x20b7: 0x91dd, 0x20b8: 0x30e1, 0x20b9: 0x91fd, 0x20ba: 0x30e9, 0x20bb: 0x921d, + 0x20bc: 0x923d, 0x20bd: 0x925d, 0x20be: 0x30f1, 0x20bf: 0x30f9, + // Block 0x83, offset 0x20c0 + 0x20c0: 0x3101, 0x20c1: 0x927d, 0x20c2: 0x929d, 0x20c3: 0x92bd, 0x20c4: 0x92dd, 0x20c5: 0x3109, + 0x20c6: 0x3111, 0x20c7: 0x3111, 0x20c8: 0x3119, 0x20c9: 0x3121, 0x20ca: 0x3129, 0x20cb: 0x3131, + 0x20cc: 0x3139, 0x20cd: 0x92fd, 0x20ce: 0x3141, 0x20cf: 0x3149, 0x20d0: 0x3151, 0x20d1: 0x3159, + 0x20d2: 0x931d, 0x20d3: 0x3161, 0x20d4: 0x933d, 0x20d5: 0x935d, 0x20d6: 0x3169, 0x20d7: 0x3171, + 0x20d8: 0x3179, 0x20d9: 0x3181, 0x20da: 0x3189, 0x20db: 0x3191, 0x20dc: 0x937d, 0x20dd: 0x939d, + 0x20de: 0x93bd, 0x20df: 0x2040, 0x20e0: 0x3199, 0x20e1: 0x93dd, 0x20e2: 0x31a1, 0x20e3: 0x31a9, + 0x20e4: 0x31b1, 0x20e5: 0x93fd, 0x20e6: 0x31b9, 0x20e7: 0x31c1, 0x20e8: 0x31c9, 0x20e9: 0x31d1, + 0x20ea: 0x31d9, 0x20eb: 0x941d, 0x20ec: 0x31e1, 0x20ed: 0x31e9, 0x20ee: 0x31f1, 0x20ef: 0x31f9, + 0x20f0: 0x3201, 0x20f1: 0x3209, 0x20f2: 0x943d, 0x20f3: 0x945d, 0x20f4: 0x3211, 0x20f5: 0x947d, + 0x20f6: 0x3219, 0x20f7: 0x949d, 0x20f8: 0x3221, 0x20f9: 0x3229, 0x20fa: 0x3231, 0x20fb: 0x94bd, + 0x20fc: 0x94dd, 0x20fd: 0x3239, 0x20fe: 0x94fd, 0x20ff: 0x3241, + // Block 0x84, offset 0x2100 + 0x2100: 0x951d, 0x2101: 0x3249, 0x2102: 0x3251, 0x2103: 0x3259, 0x2104: 0x3261, 0x2105: 0x3269, + 0x2106: 0x3271, 0x2107: 0x953d, 0x2108: 0x955d, 0x2109: 0x957d, 0x210a: 0x959d, 0x210b: 0x2ca1, + 0x210c: 0x3279, 0x210d: 0x3281, 0x210e: 0x3289, 0x210f: 0x3291, 0x2110: 0x3299, 0x2111: 0x32a1, + 0x2112: 0x32a9, 0x2113: 0x32b1, 0x2114: 0x32b9, 0x2115: 0x32c1, 0x2116: 0x32c9, 0x2117: 0x95bd, + 0x2118: 0x32d1, 0x2119: 0x32d9, 0x211a: 0x32e1, 0x211b: 0x32e9, 0x211c: 0x32f1, 0x211d: 0x32f9, + 0x211e: 0x3301, 0x211f: 0x3309, 0x2120: 0x3311, 0x2121: 0x3319, 0x2122: 0x3321, 0x2123: 0x3329, + 0x2124: 0x95dd, 0x2125: 0x95fd, 0x2126: 0x961d, 0x2127: 0x3331, 0x2128: 0x3339, 0x2129: 0x3341, + 0x212a: 0x3349, 0x212b: 0x963d, 0x212c: 0x3351, 0x212d: 0x965d, 0x212e: 0x3359, 0x212f: 0x3361, + 0x2130: 0x967d, 0x2131: 0x969d, 0x2132: 0x3369, 0x2133: 0x3371, 0x2134: 0x3379, 0x2135: 0x3381, + 0x2136: 0x3389, 0x2137: 0x3391, 0x2138: 0x3399, 0x2139: 0x33a1, 0x213a: 0x33a9, 0x213b: 0x33b1, + 0x213c: 0x33b9, 0x213d: 0x33c1, 0x213e: 0x33c9, 0x213f: 0x2040, + // Block 0x85, offset 0x2140 + 0x2140: 0x33d1, 0x2141: 0x33d9, 0x2142: 0x33e1, 0x2143: 0x33e9, 0x2144: 0x33f1, 0x2145: 0x96bd, + 0x2146: 0x33f9, 0x2147: 0x3401, 0x2148: 0x3409, 0x2149: 0x3411, 0x214a: 0x3419, 0x214b: 0x96dd, + 0x214c: 0x96fd, 0x214d: 0x3421, 0x214e: 0x3429, 0x214f: 0x3431, 0x2150: 0x3439, 0x2151: 0x3441, + 0x2152: 0x3449, 0x2153: 0x971d, 0x2154: 0x3451, 0x2155: 0x3459, 0x2156: 0x3461, 0x2157: 0x3469, + 0x2158: 0x973d, 0x2159: 0x975d, 0x215a: 0x3471, 0x215b: 0x3479, 0x215c: 0x3481, 0x215d: 0x977d, + 0x215e: 0x3489, 0x215f: 0x3491, 0x2160: 0x684d, 0x2161: 0x979d, 0x2162: 0x3499, 0x2163: 0x34a1, + 0x2164: 0x34a9, 0x2165: 0x97bd, 0x2166: 0x34b1, 0x2167: 0x34b9, 0x2168: 0x34c1, 0x2169: 0x34c9, + 0x216a: 0x34d1, 0x216b: 0x34d9, 0x216c: 0x34e1, 0x216d: 0x97dd, 0x216e: 0x34e9, 0x216f: 0x34f1, + 0x2170: 0x34f9, 0x2171: 0x97fd, 0x2172: 0x3501, 0x2173: 0x3509, 0x2174: 0x3511, 0x2175: 0x3519, + 0x2176: 0x7b6d, 0x2177: 0x981d, 0x2178: 0x3521, 0x2179: 0x3529, 0x217a: 0x3531, 0x217b: 0x983d, + 0x217c: 0x3539, 0x217d: 0x985d, 0x217e: 0x3541, 0x217f: 0x3541, + // Block 0x86, offset 0x2180 + 0x2180: 0x3549, 0x2181: 0x987d, 0x2182: 0x3551, 0x2183: 0x3559, 0x2184: 0x3561, 0x2185: 0x3569, + 0x2186: 0x3571, 0x2187: 0x3579, 0x2188: 0x3581, 0x2189: 0x989d, 0x218a: 0x3589, 0x218b: 0x3591, + 0x218c: 0x3599, 0x218d: 0x35a1, 0x218e: 0x35a9, 0x218f: 0x35b1, 0x2190: 0x98bd, 0x2191: 0x35b9, + 0x2192: 0x98dd, 0x2193: 0x98fd, 0x2194: 0x991d, 0x2195: 0x35c1, 0x2196: 0x35c9, 0x2197: 0x35d1, + 0x2198: 0x35d9, 0x2199: 0x35e1, 0x219a: 0x35e9, 0x219b: 0x35f1, 0x219c: 0x35f9, 0x219d: 0x993d, + 0x219e: 0x0040, 0x219f: 0x0040, 0x21a0: 0x0040, 0x21a1: 0x0040, 0x21a2: 0x0040, 0x21a3: 0x0040, + 0x21a4: 0x0040, 0x21a5: 0x0040, 0x21a6: 0x0040, 0x21a7: 0x0040, 0x21a8: 0x0040, 0x21a9: 0x0040, + 0x21aa: 0x0040, 0x21ab: 0x0040, 0x21ac: 0x0040, 0x21ad: 0x0040, 0x21ae: 0x0040, 0x21af: 0x0040, + 0x21b0: 0x0040, 0x21b1: 0x0040, 0x21b2: 0x0040, 0x21b3: 0x0040, 0x21b4: 0x0040, 0x21b5: 0x0040, + 0x21b6: 0x0040, 0x21b7: 0x0040, 0x21b8: 0x0040, 0x21b9: 0x0040, 0x21ba: 0x0040, 0x21bb: 0x0040, + 0x21bc: 0x0040, 0x21bd: 0x0040, 0x21be: 0x0040, 0x21bf: 0x0040, +} + +// idnaIndex: 39 blocks, 2496 entries, 4992 bytes +// Block 0 is the zero block. +var idnaIndex = [2496]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x85, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x04, 0xc7: 0x05, + 0xc8: 0x06, 0xc9: 0x86, 0xca: 0x87, 0xcb: 0x07, 0xcc: 0x88, 0xcd: 0x08, 0xce: 0x09, 0xcf: 0x0a, + 0xd0: 0x89, 0xd1: 0x0b, 0xd2: 0x0c, 0xd3: 0x0d, 0xd4: 0x0e, 0xd5: 0x8a, 0xd6: 0x8b, 0xd7: 0x8c, + 0xd8: 0x0f, 0xd9: 0x10, 0xda: 0x8d, 0xdb: 0x11, 0xdc: 0x12, 0xdd: 0x8e, 0xde: 0x8f, 0xdf: 0x90, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, + 0xe8: 0x07, 0xe9: 0x07, 0xea: 0x08, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x09, 0xee: 0x0a, 0xef: 0x0b, + 0xf0: 0x20, 0xf1: 0x21, 0xf2: 0x21, 0xf3: 0x23, 0xf4: 0x24, + // Block 0x4, offset 0x100 + 0x120: 0x91, 0x121: 0x13, 0x122: 0x14, 0x123: 0x92, 0x124: 0x93, 0x125: 0x15, 0x126: 0x16, 0x127: 0x17, + 0x128: 0x18, 0x129: 0x19, 0x12a: 0x1a, 0x12b: 0x1b, 0x12c: 0x1c, 0x12d: 0x1d, 0x12e: 0x1e, 0x12f: 0x94, + 0x130: 0x95, 0x131: 0x1f, 0x132: 0x20, 0x133: 0x21, 0x134: 0x96, 0x135: 0x22, 0x136: 0x97, 0x137: 0x98, + 0x138: 0x99, 0x139: 0x9a, 0x13a: 0x23, 0x13b: 0x9b, 0x13c: 0x9c, 0x13d: 0x24, 0x13e: 0x25, 0x13f: 0x9d, + // Block 0x5, offset 0x140 + 0x140: 0x9e, 0x141: 0x9f, 0x142: 0xa0, 0x143: 0xa1, 0x144: 0xa2, 0x145: 0xa3, 0x146: 0xa4, 0x147: 0xa5, + 0x148: 0xa6, 0x149: 0xa7, 0x14a: 0xa8, 0x14b: 0xa9, 0x14c: 0xaa, 0x14d: 0xab, 0x14e: 0xac, 0x14f: 0xad, + 0x150: 0xae, 0x151: 0xa6, 0x152: 0xa6, 0x153: 0xa6, 0x154: 0xa6, 0x155: 0xa6, 0x156: 0xa6, 0x157: 0xa6, + 0x158: 0xa6, 0x159: 0xaf, 0x15a: 0xb0, 0x15b: 0xb1, 0x15c: 0xb2, 0x15d: 0xb3, 0x15e: 0xb4, 0x15f: 0xb5, + 0x160: 0xb6, 0x161: 0xb7, 0x162: 0xb8, 0x163: 0xb9, 0x164: 0xba, 0x165: 0xbb, 0x166: 0xbc, 0x167: 0xbd, + 0x168: 0xbe, 0x169: 0xbf, 0x16a: 0xc0, 0x16b: 0xc1, 0x16c: 0xc2, 0x16d: 0xc3, 0x16e: 0xc4, 0x16f: 0xc5, + 0x170: 0xc6, 0x171: 0xc7, 0x172: 0xc8, 0x173: 0xc9, 0x174: 0x26, 0x175: 0x27, 0x176: 0x28, 0x177: 0x88, + 0x178: 0x29, 0x179: 0x29, 0x17a: 0x2a, 0x17b: 0x29, 0x17c: 0xca, 0x17d: 0x2b, 0x17e: 0x2c, 0x17f: 0x2d, + // Block 0x6, offset 0x180 + 0x180: 0x2e, 0x181: 0x2f, 0x182: 0x30, 0x183: 0xcb, 0x184: 0x31, 0x185: 0x32, 0x186: 0xcc, 0x187: 0xa2, + 0x188: 0xcd, 0x189: 0xce, 0x18a: 0xa2, 0x18b: 0xa2, 0x18c: 0xcf, 0x18d: 0xa2, 0x18e: 0xa2, 0x18f: 0xa2, + 0x190: 0xd0, 0x191: 0x33, 0x192: 0x34, 0x193: 0x35, 0x194: 0xa2, 0x195: 0xa2, 0x196: 0xa2, 0x197: 0xa2, + 0x198: 0xa2, 0x199: 0xa2, 0x19a: 0xa2, 0x19b: 0xa2, 0x19c: 0xa2, 0x19d: 0xa2, 0x19e: 0xa2, 0x19f: 0xa2, + 0x1a0: 0xa2, 0x1a1: 0xa2, 0x1a2: 0xa2, 0x1a3: 0xa2, 0x1a4: 0xa2, 0x1a5: 0xa2, 0x1a6: 0xa2, 0x1a7: 0xa2, + 0x1a8: 0xd1, 0x1a9: 0xd2, 0x1aa: 0xa2, 0x1ab: 0xd3, 0x1ac: 0xa2, 0x1ad: 0xd4, 0x1ae: 0xd5, 0x1af: 0xa2, + 0x1b0: 0xd6, 0x1b1: 0x36, 0x1b2: 0x29, 0x1b3: 0x37, 0x1b4: 0xd7, 0x1b5: 0xd8, 0x1b6: 0xd9, 0x1b7: 0xda, + 0x1b8: 0xdb, 0x1b9: 0xdc, 0x1ba: 0xdd, 0x1bb: 0xde, 0x1bc: 0xdf, 0x1bd: 0xe0, 0x1be: 0xe1, 0x1bf: 0x38, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x39, 0x1c1: 0xe2, 0x1c2: 0xe3, 0x1c3: 0xe4, 0x1c4: 0xe5, 0x1c5: 0x3a, 0x1c6: 0x3b, 0x1c7: 0xe6, + 0x1c8: 0xe7, 0x1c9: 0x3c, 0x1ca: 0x3d, 0x1cb: 0x3e, 0x1cc: 0xe8, 0x1cd: 0xe9, 0x1ce: 0x3f, 0x1cf: 0x40, + 0x1d0: 0xa6, 0x1d1: 0xa6, 0x1d2: 0xa6, 0x1d3: 0xa6, 0x1d4: 0xa6, 0x1d5: 0xa6, 0x1d6: 0xa6, 0x1d7: 0xa6, + 0x1d8: 0xa6, 0x1d9: 0xa6, 0x1da: 0xa6, 0x1db: 0xa6, 0x1dc: 0xa6, 0x1dd: 0xa6, 0x1de: 0xa6, 0x1df: 0xa6, + 0x1e0: 0xa6, 0x1e1: 0xa6, 0x1e2: 0xa6, 0x1e3: 0xa6, 0x1e4: 0xa6, 0x1e5: 0xa6, 0x1e6: 0xa6, 0x1e7: 0xa6, + 0x1e8: 0xa6, 0x1e9: 0xa6, 0x1ea: 0xa6, 0x1eb: 0xa6, 0x1ec: 0xa6, 0x1ed: 0xa6, 0x1ee: 0xa6, 0x1ef: 0xa6, + 0x1f0: 0xa6, 0x1f1: 0xa6, 0x1f2: 0xa6, 0x1f3: 0xa6, 0x1f4: 0xa6, 0x1f5: 0xa6, 0x1f6: 0xa6, 0x1f7: 0xa6, + 0x1f8: 0xa6, 0x1f9: 0xa6, 0x1fa: 0xa6, 0x1fb: 0xa6, 0x1fc: 0xa6, 0x1fd: 0xa6, 0x1fe: 0xa6, 0x1ff: 0xa6, + // Block 0x8, offset 0x200 + 0x200: 0xa6, 0x201: 0xa6, 0x202: 0xa6, 0x203: 0xa6, 0x204: 0xa6, 0x205: 0xa6, 0x206: 0xa6, 0x207: 0xa6, + 0x208: 0xa6, 0x209: 0xa6, 0x20a: 0xa6, 0x20b: 0xa6, 0x20c: 0xa6, 0x20d: 0xa6, 0x20e: 0xa6, 0x20f: 0xa6, + 0x210: 0xa6, 0x211: 0xa6, 0x212: 0xa6, 0x213: 0xa6, 0x214: 0xa6, 0x215: 0xa6, 0x216: 0xa6, 0x217: 0xa6, + 0x218: 0xa6, 0x219: 0xa6, 0x21a: 0xa6, 0x21b: 0xa6, 0x21c: 0xa6, 0x21d: 0xa6, 0x21e: 0xa6, 0x21f: 0xa6, + 0x220: 0xa6, 0x221: 0xa6, 0x222: 0xa6, 0x223: 0xa6, 0x224: 0xa6, 0x225: 0xa6, 0x226: 0xa6, 0x227: 0xa6, + 0x228: 0xa6, 0x229: 0xa6, 0x22a: 0xa6, 0x22b: 0xa6, 0x22c: 0xa6, 0x22d: 0xa6, 0x22e: 0xa6, 0x22f: 0xa6, + 0x230: 0xa6, 0x231: 0xa6, 0x232: 0xa6, 0x233: 0xa6, 0x234: 0xa6, 0x235: 0xa6, 0x236: 0xa6, 0x237: 0xa2, + 0x238: 0xa6, 0x239: 0xa6, 0x23a: 0xa6, 0x23b: 0xa6, 0x23c: 0xa6, 0x23d: 0xa6, 0x23e: 0xa6, 0x23f: 0xa6, + // Block 0x9, offset 0x240 + 0x240: 0xa6, 0x241: 0xa6, 0x242: 0xa6, 0x243: 0xa6, 0x244: 0xa6, 0x245: 0xa6, 0x246: 0xa6, 0x247: 0xa6, + 0x248: 0xa6, 0x249: 0xa6, 0x24a: 0xa6, 0x24b: 0xa6, 0x24c: 0xa6, 0x24d: 0xa6, 0x24e: 0xa6, 0x24f: 0xa6, + 0x250: 0xa6, 0x251: 0xa6, 0x252: 0xa6, 0x253: 0xa6, 0x254: 0xa6, 0x255: 0xa6, 0x256: 0xa6, 0x257: 0xa6, + 0x258: 0xa6, 0x259: 0xa6, 0x25a: 0xa6, 0x25b: 0xa6, 0x25c: 0xa6, 0x25d: 0xa6, 0x25e: 0xa6, 0x25f: 0xa6, + 0x260: 0xa6, 0x261: 0xa6, 0x262: 0xa6, 0x263: 0xa6, 0x264: 0xa6, 0x265: 0xa6, 0x266: 0xa6, 0x267: 0xa6, + 0x268: 0xa6, 0x269: 0xa6, 0x26a: 0xa6, 0x26b: 0xa6, 0x26c: 0xa6, 0x26d: 0xa6, 0x26e: 0xa6, 0x26f: 0xa6, + 0x270: 0xa6, 0x271: 0xa6, 0x272: 0xa6, 0x273: 0xa6, 0x274: 0xa6, 0x275: 0xa6, 0x276: 0xa6, 0x277: 0xa6, + 0x278: 0xa6, 0x279: 0xa6, 0x27a: 0xa6, 0x27b: 0xa6, 0x27c: 0xa6, 0x27d: 0xa6, 0x27e: 0xa6, 0x27f: 0xa6, + // Block 0xa, offset 0x280 + 0x280: 0xa6, 0x281: 0xa6, 0x282: 0xa6, 0x283: 0xa6, 0x284: 0xa6, 0x285: 0xa6, 0x286: 0xa6, 0x287: 0xa6, + 0x288: 0xa6, 0x289: 0xa6, 0x28a: 0xa6, 0x28b: 0xa6, 0x28c: 0xa6, 0x28d: 0xa6, 0x28e: 0xa6, 0x28f: 0xa6, + 0x290: 0xa6, 0x291: 0xa6, 0x292: 0xea, 0x293: 0xeb, 0x294: 0xa6, 0x295: 0xa6, 0x296: 0xa6, 0x297: 0xa6, + 0x298: 0xec, 0x299: 0x41, 0x29a: 0x42, 0x29b: 0xed, 0x29c: 0x43, 0x29d: 0x44, 0x29e: 0x45, 0x29f: 0x46, + 0x2a0: 0xee, 0x2a1: 0xef, 0x2a2: 0xf0, 0x2a3: 0xf1, 0x2a4: 0xf2, 0x2a5: 0xf3, 0x2a6: 0xf4, 0x2a7: 0xf5, + 0x2a8: 0xf6, 0x2a9: 0xf7, 0x2aa: 0xf8, 0x2ab: 0xf9, 0x2ac: 0xfa, 0x2ad: 0xfb, 0x2ae: 0xfc, 0x2af: 0xfd, + 0x2b0: 0xa6, 0x2b1: 0xa6, 0x2b2: 0xa6, 0x2b3: 0xa6, 0x2b4: 0xa6, 0x2b5: 0xa6, 0x2b6: 0xa6, 0x2b7: 0xa6, + 0x2b8: 0xa6, 0x2b9: 0xa6, 0x2ba: 0xa6, 0x2bb: 0xa6, 0x2bc: 0xa6, 0x2bd: 0xa6, 0x2be: 0xa6, 0x2bf: 0xa6, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xa6, 0x2c1: 0xa6, 0x2c2: 0xa6, 0x2c3: 0xa6, 0x2c4: 0xa6, 0x2c5: 0xa6, 0x2c6: 0xa6, 0x2c7: 0xa6, + 0x2c8: 0xa6, 0x2c9: 0xa6, 0x2ca: 0xa6, 0x2cb: 0xa6, 0x2cc: 0xa6, 0x2cd: 0xa6, 0x2ce: 0xa6, 0x2cf: 0xa6, + 0x2d0: 0xa6, 0x2d1: 0xa6, 0x2d2: 0xa6, 0x2d3: 0xa6, 0x2d4: 0xa6, 0x2d5: 0xa6, 0x2d6: 0xa6, 0x2d7: 0xa6, + 0x2d8: 0xa6, 0x2d9: 0xa6, 0x2da: 0xa6, 0x2db: 0xa6, 0x2dc: 0xa6, 0x2dd: 0xa6, 0x2de: 0xfe, 0x2df: 0xff, + // Block 0xc, offset 0x300 + 0x300: 0x100, 0x301: 0x100, 0x302: 0x100, 0x303: 0x100, 0x304: 0x100, 0x305: 0x100, 0x306: 0x100, 0x307: 0x100, + 0x308: 0x100, 0x309: 0x100, 0x30a: 0x100, 0x30b: 0x100, 0x30c: 0x100, 0x30d: 0x100, 0x30e: 0x100, 0x30f: 0x100, + 0x310: 0x100, 0x311: 0x100, 0x312: 0x100, 0x313: 0x100, 0x314: 0x100, 0x315: 0x100, 0x316: 0x100, 0x317: 0x100, + 0x318: 0x100, 0x319: 0x100, 0x31a: 0x100, 0x31b: 0x100, 0x31c: 0x100, 0x31d: 0x100, 0x31e: 0x100, 0x31f: 0x100, + 0x320: 0x100, 0x321: 0x100, 0x322: 0x100, 0x323: 0x100, 0x324: 0x100, 0x325: 0x100, 0x326: 0x100, 0x327: 0x100, + 0x328: 0x100, 0x329: 0x100, 0x32a: 0x100, 0x32b: 0x100, 0x32c: 0x100, 0x32d: 0x100, 0x32e: 0x100, 0x32f: 0x100, + 0x330: 0x100, 0x331: 0x100, 0x332: 0x100, 0x333: 0x100, 0x334: 0x100, 0x335: 0x100, 0x336: 0x100, 0x337: 0x100, + 0x338: 0x100, 0x339: 0x100, 0x33a: 0x100, 0x33b: 0x100, 0x33c: 0x100, 0x33d: 0x100, 0x33e: 0x100, 0x33f: 0x100, + // Block 0xd, offset 0x340 + 0x340: 0x100, 0x341: 0x100, 0x342: 0x100, 0x343: 0x100, 0x344: 0x100, 0x345: 0x100, 0x346: 0x100, 0x347: 0x100, + 0x348: 0x100, 0x349: 0x100, 0x34a: 0x100, 0x34b: 0x100, 0x34c: 0x100, 0x34d: 0x100, 0x34e: 0x100, 0x34f: 0x100, + 0x350: 0x100, 0x351: 0x100, 0x352: 0x100, 0x353: 0x100, 0x354: 0x100, 0x355: 0x100, 0x356: 0x100, 0x357: 0x100, + 0x358: 0x100, 0x359: 0x100, 0x35a: 0x100, 0x35b: 0x100, 0x35c: 0x100, 0x35d: 0x100, 0x35e: 0x100, 0x35f: 0x100, + 0x360: 0x100, 0x361: 0x100, 0x362: 0x100, 0x363: 0x100, 0x364: 0x101, 0x365: 0x102, 0x366: 0x103, 0x367: 0x104, + 0x368: 0x47, 0x369: 0x105, 0x36a: 0x106, 0x36b: 0x48, 0x36c: 0x49, 0x36d: 0x4a, 0x36e: 0x4b, 0x36f: 0x4c, + 0x370: 0x107, 0x371: 0x4d, 0x372: 0x4e, 0x373: 0x4f, 0x374: 0x50, 0x375: 0x51, 0x376: 0x108, 0x377: 0x52, + 0x378: 0x53, 0x379: 0x54, 0x37a: 0x55, 0x37b: 0x56, 0x37c: 0x57, 0x37d: 0x58, 0x37e: 0x59, 0x37f: 0x5a, + // Block 0xe, offset 0x380 + 0x380: 0x109, 0x381: 0x10a, 0x382: 0xa6, 0x383: 0x10b, 0x384: 0x10c, 0x385: 0xa2, 0x386: 0x10d, 0x387: 0x10e, + 0x388: 0x100, 0x389: 0x100, 0x38a: 0x10f, 0x38b: 0x110, 0x38c: 0x111, 0x38d: 0x112, 0x38e: 0x113, 0x38f: 0x114, + 0x390: 0x115, 0x391: 0xa6, 0x392: 0x116, 0x393: 0x117, 0x394: 0x118, 0x395: 0x5b, 0x396: 0x5c, 0x397: 0x100, + 0x398: 0xa6, 0x399: 0xa6, 0x39a: 0xa6, 0x39b: 0xa6, 0x39c: 0x119, 0x39d: 0x11a, 0x39e: 0x5d, 0x39f: 0x100, + 0x3a0: 0x11b, 0x3a1: 0x11c, 0x3a2: 0x11d, 0x3a3: 0x11e, 0x3a4: 0x11f, 0x3a5: 0x100, 0x3a6: 0x120, 0x3a7: 0x121, + 0x3a8: 0x122, 0x3a9: 0x123, 0x3aa: 0x124, 0x3ab: 0x5e, 0x3ac: 0x125, 0x3ad: 0x126, 0x3ae: 0x5f, 0x3af: 0x100, + 0x3b0: 0x127, 0x3b1: 0x128, 0x3b2: 0x129, 0x3b3: 0x12a, 0x3b4: 0x12b, 0x3b5: 0x100, 0x3b6: 0x100, 0x3b7: 0x100, + 0x3b8: 0x100, 0x3b9: 0x12c, 0x3ba: 0x12d, 0x3bb: 0x12e, 0x3bc: 0x12f, 0x3bd: 0x130, 0x3be: 0x131, 0x3bf: 0x132, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x133, 0x3c1: 0x134, 0x3c2: 0x135, 0x3c3: 0x136, 0x3c4: 0x137, 0x3c5: 0x138, 0x3c6: 0x139, 0x3c7: 0x13a, + 0x3c8: 0x13b, 0x3c9: 0x13c, 0x3ca: 0x13d, 0x3cb: 0x13e, 0x3cc: 0x60, 0x3cd: 0x61, 0x3ce: 0x100, 0x3cf: 0x100, + 0x3d0: 0x13f, 0x3d1: 0x140, 0x3d2: 0x141, 0x3d3: 0x142, 0x3d4: 0x100, 0x3d5: 0x100, 0x3d6: 0x143, 0x3d7: 0x144, + 0x3d8: 0x145, 0x3d9: 0x146, 0x3da: 0x147, 0x3db: 0x148, 0x3dc: 0x149, 0x3dd: 0x14a, 0x3de: 0x100, 0x3df: 0x100, + 0x3e0: 0x14b, 0x3e1: 0x100, 0x3e2: 0x14c, 0x3e3: 0x14d, 0x3e4: 0x62, 0x3e5: 0x14e, 0x3e6: 0x14f, 0x3e7: 0x150, + 0x3e8: 0x151, 0x3e9: 0x152, 0x3ea: 0x153, 0x3eb: 0x154, 0x3ec: 0x155, 0x3ed: 0x100, 0x3ee: 0x100, 0x3ef: 0x100, + 0x3f0: 0x156, 0x3f1: 0x157, 0x3f2: 0x158, 0x3f3: 0x100, 0x3f4: 0x159, 0x3f5: 0x15a, 0x3f6: 0x15b, 0x3f7: 0x100, + 0x3f8: 0x100, 0x3f9: 0x100, 0x3fa: 0x100, 0x3fb: 0x15c, 0x3fc: 0x15d, 0x3fd: 0x15e, 0x3fe: 0x15f, 0x3ff: 0x160, + // Block 0x10, offset 0x400 + 0x400: 0xa6, 0x401: 0xa6, 0x402: 0xa6, 0x403: 0xa6, 0x404: 0xa6, 0x405: 0xa6, 0x406: 0xa6, 0x407: 0xa6, + 0x408: 0xa6, 0x409: 0xa6, 0x40a: 0xa6, 0x40b: 0xa6, 0x40c: 0xa6, 0x40d: 0xa6, 0x40e: 0x161, 0x40f: 0x100, + 0x410: 0xa2, 0x411: 0x162, 0x412: 0xa6, 0x413: 0xa6, 0x414: 0xa6, 0x415: 0x163, 0x416: 0x100, 0x417: 0x100, + 0x418: 0x100, 0x419: 0x100, 0x41a: 0x100, 0x41b: 0x100, 0x41c: 0x100, 0x41d: 0x100, 0x41e: 0x100, 0x41f: 0x100, + 0x420: 0x100, 0x421: 0x100, 0x422: 0x100, 0x423: 0x100, 0x424: 0x100, 0x425: 0x100, 0x426: 0x100, 0x427: 0x100, + 0x428: 0x100, 0x429: 0x100, 0x42a: 0x100, 0x42b: 0x100, 0x42c: 0x100, 0x42d: 0x100, 0x42e: 0x100, 0x42f: 0x100, + 0x430: 0x100, 0x431: 0x100, 0x432: 0x100, 0x433: 0x100, 0x434: 0x100, 0x435: 0x100, 0x436: 0x100, 0x437: 0x100, + 0x438: 0x100, 0x439: 0x100, 0x43a: 0x100, 0x43b: 0x100, 0x43c: 0x100, 0x43d: 0x100, 0x43e: 0x164, 0x43f: 0x165, + // Block 0x11, offset 0x440 + 0x440: 0xa6, 0x441: 0xa6, 0x442: 0xa6, 0x443: 0xa6, 0x444: 0xa6, 0x445: 0xa6, 0x446: 0xa6, 0x447: 0xa6, + 0x448: 0xa6, 0x449: 0xa6, 0x44a: 0xa6, 0x44b: 0xa6, 0x44c: 0xa6, 0x44d: 0xa6, 0x44e: 0xa6, 0x44f: 0xa6, + 0x450: 0x166, 0x451: 0x167, 0x452: 0x100, 0x453: 0x100, 0x454: 0x100, 0x455: 0x100, 0x456: 0x100, 0x457: 0x100, + 0x458: 0x100, 0x459: 0x100, 0x45a: 0x100, 0x45b: 0x100, 0x45c: 0x100, 0x45d: 0x100, 0x45e: 0x100, 0x45f: 0x100, + 0x460: 0x100, 0x461: 0x100, 0x462: 0x100, 0x463: 0x100, 0x464: 0x100, 0x465: 0x100, 0x466: 0x100, 0x467: 0x100, + 0x468: 0x100, 0x469: 0x100, 0x46a: 0x100, 0x46b: 0x100, 0x46c: 0x100, 0x46d: 0x100, 0x46e: 0x100, 0x46f: 0x100, + 0x470: 0x100, 0x471: 0x100, 0x472: 0x100, 0x473: 0x100, 0x474: 0x100, 0x475: 0x100, 0x476: 0x100, 0x477: 0x100, + 0x478: 0x100, 0x479: 0x100, 0x47a: 0x100, 0x47b: 0x100, 0x47c: 0x100, 0x47d: 0x100, 0x47e: 0x100, 0x47f: 0x100, + // Block 0x12, offset 0x480 + 0x480: 0x100, 0x481: 0x100, 0x482: 0x100, 0x483: 0x100, 0x484: 0x100, 0x485: 0x100, 0x486: 0x100, 0x487: 0x100, + 0x488: 0x100, 0x489: 0x100, 0x48a: 0x100, 0x48b: 0x100, 0x48c: 0x100, 0x48d: 0x100, 0x48e: 0x100, 0x48f: 0x100, + 0x490: 0xa6, 0x491: 0xa6, 0x492: 0xa6, 0x493: 0xa6, 0x494: 0xa6, 0x495: 0xa6, 0x496: 0xa6, 0x497: 0xa6, + 0x498: 0xa6, 0x499: 0x14a, 0x49a: 0x100, 0x49b: 0x100, 0x49c: 0x100, 0x49d: 0x100, 0x49e: 0x100, 0x49f: 0x100, + 0x4a0: 0x100, 0x4a1: 0x100, 0x4a2: 0x100, 0x4a3: 0x100, 0x4a4: 0x100, 0x4a5: 0x100, 0x4a6: 0x100, 0x4a7: 0x100, + 0x4a8: 0x100, 0x4a9: 0x100, 0x4aa: 0x100, 0x4ab: 0x100, 0x4ac: 0x100, 0x4ad: 0x100, 0x4ae: 0x100, 0x4af: 0x100, + 0x4b0: 0x100, 0x4b1: 0x100, 0x4b2: 0x100, 0x4b3: 0x100, 0x4b4: 0x100, 0x4b5: 0x100, 0x4b6: 0x100, 0x4b7: 0x100, + 0x4b8: 0x100, 0x4b9: 0x100, 0x4ba: 0x100, 0x4bb: 0x100, 0x4bc: 0x100, 0x4bd: 0x100, 0x4be: 0x100, 0x4bf: 0x100, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x100, 0x4c1: 0x100, 0x4c2: 0x100, 0x4c3: 0x100, 0x4c4: 0x100, 0x4c5: 0x100, 0x4c6: 0x100, 0x4c7: 0x100, + 0x4c8: 0x100, 0x4c9: 0x100, 0x4ca: 0x100, 0x4cb: 0x100, 0x4cc: 0x100, 0x4cd: 0x100, 0x4ce: 0x100, 0x4cf: 0x100, + 0x4d0: 0x100, 0x4d1: 0x100, 0x4d2: 0x100, 0x4d3: 0x100, 0x4d4: 0x100, 0x4d5: 0x100, 0x4d6: 0x100, 0x4d7: 0x100, + 0x4d8: 0x100, 0x4d9: 0x100, 0x4da: 0x100, 0x4db: 0x100, 0x4dc: 0x100, 0x4dd: 0x100, 0x4de: 0x100, 0x4df: 0x100, + 0x4e0: 0xa6, 0x4e1: 0xa6, 0x4e2: 0xa6, 0x4e3: 0xa6, 0x4e4: 0xa6, 0x4e5: 0xa6, 0x4e6: 0xa6, 0x4e7: 0xa6, + 0x4e8: 0x154, 0x4e9: 0x168, 0x4ea: 0x169, 0x4eb: 0x16a, 0x4ec: 0x16b, 0x4ed: 0x16c, 0x4ee: 0x16d, 0x4ef: 0x100, + 0x4f0: 0x100, 0x4f1: 0x100, 0x4f2: 0x100, 0x4f3: 0x100, 0x4f4: 0x100, 0x4f5: 0x100, 0x4f6: 0x100, 0x4f7: 0x100, + 0x4f8: 0x100, 0x4f9: 0x16e, 0x4fa: 0x16f, 0x4fb: 0x100, 0x4fc: 0xa6, 0x4fd: 0x170, 0x4fe: 0x171, 0x4ff: 0x172, + // Block 0x14, offset 0x500 + 0x500: 0xa6, 0x501: 0xa6, 0x502: 0xa6, 0x503: 0xa6, 0x504: 0xa6, 0x505: 0xa6, 0x506: 0xa6, 0x507: 0xa6, + 0x508: 0xa6, 0x509: 0xa6, 0x50a: 0xa6, 0x50b: 0xa6, 0x50c: 0xa6, 0x50d: 0xa6, 0x50e: 0xa6, 0x50f: 0xa6, + 0x510: 0xa6, 0x511: 0xa6, 0x512: 0xa6, 0x513: 0xa6, 0x514: 0xa6, 0x515: 0xa6, 0x516: 0xa6, 0x517: 0xa6, + 0x518: 0xa6, 0x519: 0xa6, 0x51a: 0xa6, 0x51b: 0xa6, 0x51c: 0xa6, 0x51d: 0xa6, 0x51e: 0xa6, 0x51f: 0x173, + 0x520: 0xa6, 0x521: 0xa6, 0x522: 0xa6, 0x523: 0xa6, 0x524: 0xa6, 0x525: 0xa6, 0x526: 0xa6, 0x527: 0xa6, + 0x528: 0xa6, 0x529: 0xa6, 0x52a: 0xa6, 0x52b: 0xa6, 0x52c: 0xa6, 0x52d: 0xa6, 0x52e: 0xa6, 0x52f: 0xa6, + 0x530: 0xa6, 0x531: 0xa6, 0x532: 0xa6, 0x533: 0x174, 0x534: 0x175, 0x535: 0x100, 0x536: 0x100, 0x537: 0x100, + 0x538: 0x100, 0x539: 0x100, 0x53a: 0x100, 0x53b: 0x100, 0x53c: 0x100, 0x53d: 0x100, 0x53e: 0x100, 0x53f: 0x100, + // Block 0x15, offset 0x540 + 0x540: 0x100, 0x541: 0x100, 0x542: 0x100, 0x543: 0x100, 0x544: 0x100, 0x545: 0x100, 0x546: 0x100, 0x547: 0x100, + 0x548: 0x100, 0x549: 0x100, 0x54a: 0x100, 0x54b: 0x100, 0x54c: 0x100, 0x54d: 0x100, 0x54e: 0x100, 0x54f: 0x100, + 0x550: 0x100, 0x551: 0x100, 0x552: 0x100, 0x553: 0x100, 0x554: 0x100, 0x555: 0x100, 0x556: 0x100, 0x557: 0x100, + 0x558: 0x100, 0x559: 0x100, 0x55a: 0x100, 0x55b: 0x100, 0x55c: 0x100, 0x55d: 0x100, 0x55e: 0x100, 0x55f: 0x100, + 0x560: 0x100, 0x561: 0x100, 0x562: 0x100, 0x563: 0x100, 0x564: 0x100, 0x565: 0x100, 0x566: 0x100, 0x567: 0x100, + 0x568: 0x100, 0x569: 0x100, 0x56a: 0x100, 0x56b: 0x100, 0x56c: 0x100, 0x56d: 0x100, 0x56e: 0x100, 0x56f: 0x100, + 0x570: 0x100, 0x571: 0x100, 0x572: 0x100, 0x573: 0x100, 0x574: 0x100, 0x575: 0x100, 0x576: 0x100, 0x577: 0x100, + 0x578: 0x100, 0x579: 0x100, 0x57a: 0x100, 0x57b: 0x100, 0x57c: 0x100, 0x57d: 0x100, 0x57e: 0x100, 0x57f: 0x176, + // Block 0x16, offset 0x580 + 0x580: 0xa6, 0x581: 0xa6, 0x582: 0xa6, 0x583: 0xa6, 0x584: 0x177, 0x585: 0x178, 0x586: 0xa6, 0x587: 0xa6, + 0x588: 0xa6, 0x589: 0xa6, 0x58a: 0xa6, 0x58b: 0x179, 0x58c: 0x100, 0x58d: 0x100, 0x58e: 0x100, 0x58f: 0x100, + 0x590: 0x100, 0x591: 0x100, 0x592: 0x100, 0x593: 0x100, 0x594: 0x100, 0x595: 0x100, 0x596: 0x100, 0x597: 0x100, + 0x598: 0x100, 0x599: 0x100, 0x59a: 0x100, 0x59b: 0x100, 0x59c: 0x100, 0x59d: 0x100, 0x59e: 0x100, 0x59f: 0x100, + 0x5a0: 0x100, 0x5a1: 0x100, 0x5a2: 0x100, 0x5a3: 0x100, 0x5a4: 0x100, 0x5a5: 0x100, 0x5a6: 0x100, 0x5a7: 0x100, + 0x5a8: 0x100, 0x5a9: 0x100, 0x5aa: 0x100, 0x5ab: 0x100, 0x5ac: 0x100, 0x5ad: 0x100, 0x5ae: 0x100, 0x5af: 0x100, + 0x5b0: 0xa6, 0x5b1: 0x17a, 0x5b2: 0x17b, 0x5b3: 0x100, 0x5b4: 0x100, 0x5b5: 0x100, 0x5b6: 0x100, 0x5b7: 0x100, + 0x5b8: 0x100, 0x5b9: 0x100, 0x5ba: 0x100, 0x5bb: 0x100, 0x5bc: 0x100, 0x5bd: 0x100, 0x5be: 0x100, 0x5bf: 0x100, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x100, 0x5c1: 0x100, 0x5c2: 0x100, 0x5c3: 0x100, 0x5c4: 0x100, 0x5c5: 0x100, 0x5c6: 0x100, 0x5c7: 0x100, + 0x5c8: 0x100, 0x5c9: 0x100, 0x5ca: 0x100, 0x5cb: 0x100, 0x5cc: 0x100, 0x5cd: 0x100, 0x5ce: 0x100, 0x5cf: 0x100, + 0x5d0: 0x100, 0x5d1: 0x100, 0x5d2: 0x100, 0x5d3: 0x100, 0x5d4: 0x100, 0x5d5: 0x100, 0x5d6: 0x100, 0x5d7: 0x100, + 0x5d8: 0x100, 0x5d9: 0x100, 0x5da: 0x100, 0x5db: 0x100, 0x5dc: 0x100, 0x5dd: 0x100, 0x5de: 0x100, 0x5df: 0x100, + 0x5e0: 0x100, 0x5e1: 0x100, 0x5e2: 0x100, 0x5e3: 0x100, 0x5e4: 0x100, 0x5e5: 0x100, 0x5e6: 0x100, 0x5e7: 0x100, + 0x5e8: 0x100, 0x5e9: 0x100, 0x5ea: 0x100, 0x5eb: 0x100, 0x5ec: 0x100, 0x5ed: 0x100, 0x5ee: 0x100, 0x5ef: 0x100, + 0x5f0: 0x100, 0x5f1: 0x100, 0x5f2: 0x100, 0x5f3: 0x100, 0x5f4: 0x100, 0x5f5: 0x100, 0x5f6: 0x100, 0x5f7: 0x100, + 0x5f8: 0x100, 0x5f9: 0x100, 0x5fa: 0x100, 0x5fb: 0x100, 0x5fc: 0x17c, 0x5fd: 0x17d, 0x5fe: 0xa2, 0x5ff: 0x17e, + // Block 0x18, offset 0x600 + 0x600: 0xa2, 0x601: 0xa2, 0x602: 0xa2, 0x603: 0x17f, 0x604: 0x180, 0x605: 0x181, 0x606: 0x182, 0x607: 0x183, + 0x608: 0xa2, 0x609: 0x184, 0x60a: 0x100, 0x60b: 0x185, 0x60c: 0xa2, 0x60d: 0x186, 0x60e: 0x100, 0x60f: 0x100, + 0x610: 0x63, 0x611: 0x64, 0x612: 0x65, 0x613: 0x66, 0x614: 0x67, 0x615: 0x68, 0x616: 0x69, 0x617: 0x6a, + 0x618: 0x6b, 0x619: 0x6c, 0x61a: 0x6d, 0x61b: 0x6e, 0x61c: 0x6f, 0x61d: 0x70, 0x61e: 0x71, 0x61f: 0x72, + 0x620: 0xa2, 0x621: 0xa2, 0x622: 0xa2, 0x623: 0xa2, 0x624: 0xa2, 0x625: 0xa2, 0x626: 0xa2, 0x627: 0xa2, + 0x628: 0x187, 0x629: 0x188, 0x62a: 0x189, 0x62b: 0x100, 0x62c: 0x100, 0x62d: 0x100, 0x62e: 0x100, 0x62f: 0x100, + 0x630: 0x100, 0x631: 0x100, 0x632: 0x100, 0x633: 0x100, 0x634: 0x100, 0x635: 0x100, 0x636: 0x100, 0x637: 0x100, + 0x638: 0x100, 0x639: 0x100, 0x63a: 0x100, 0x63b: 0x100, 0x63c: 0x18a, 0x63d: 0x100, 0x63e: 0x100, 0x63f: 0x100, + // Block 0x19, offset 0x640 + 0x640: 0x73, 0x641: 0x74, 0x642: 0x18b, 0x643: 0x100, 0x644: 0x18c, 0x645: 0x18d, 0x646: 0x100, 0x647: 0x100, + 0x648: 0x100, 0x649: 0x100, 0x64a: 0x18e, 0x64b: 0x18f, 0x64c: 0x100, 0x64d: 0x100, 0x64e: 0x100, 0x64f: 0x100, + 0x650: 0x100, 0x651: 0x100, 0x652: 0x100, 0x653: 0x190, 0x654: 0x100, 0x655: 0x100, 0x656: 0x100, 0x657: 0x100, + 0x658: 0x100, 0x659: 0x100, 0x65a: 0x100, 0x65b: 0x100, 0x65c: 0x100, 0x65d: 0x100, 0x65e: 0x100, 0x65f: 0x191, + 0x660: 0x127, 0x661: 0x127, 0x662: 0x127, 0x663: 0x192, 0x664: 0x75, 0x665: 0x193, 0x666: 0x100, 0x667: 0x100, + 0x668: 0x100, 0x669: 0x100, 0x66a: 0x100, 0x66b: 0x100, 0x66c: 0x100, 0x66d: 0x100, 0x66e: 0x100, 0x66f: 0x100, + 0x670: 0x100, 0x671: 0x194, 0x672: 0x195, 0x673: 0x100, 0x674: 0x196, 0x675: 0x100, 0x676: 0x100, 0x677: 0x100, + 0x678: 0x76, 0x679: 0x77, 0x67a: 0x78, 0x67b: 0x197, 0x67c: 0x100, 0x67d: 0x100, 0x67e: 0x100, 0x67f: 0x100, + // Block 0x1a, offset 0x680 + 0x680: 0x198, 0x681: 0xa2, 0x682: 0x199, 0x683: 0x19a, 0x684: 0x79, 0x685: 0x7a, 0x686: 0x19b, 0x687: 0x19c, + 0x688: 0x7b, 0x689: 0x19d, 0x68a: 0x100, 0x68b: 0x100, 0x68c: 0xa2, 0x68d: 0xa2, 0x68e: 0xa2, 0x68f: 0xa2, + 0x690: 0xa2, 0x691: 0xa2, 0x692: 0xa2, 0x693: 0xa2, 0x694: 0xa2, 0x695: 0xa2, 0x696: 0xa2, 0x697: 0xa2, + 0x698: 0xa2, 0x699: 0xa2, 0x69a: 0xa2, 0x69b: 0x19e, 0x69c: 0xa2, 0x69d: 0x19f, 0x69e: 0xa2, 0x69f: 0x1a0, + 0x6a0: 0x1a1, 0x6a1: 0x1a2, 0x6a2: 0x1a3, 0x6a3: 0x100, 0x6a4: 0xa2, 0x6a5: 0xa2, 0x6a6: 0xa2, 0x6a7: 0xa2, + 0x6a8: 0xa2, 0x6a9: 0x1a4, 0x6aa: 0x1a5, 0x6ab: 0x1a6, 0x6ac: 0xa2, 0x6ad: 0xa2, 0x6ae: 0x1a7, 0x6af: 0x1a8, + 0x6b0: 0x100, 0x6b1: 0x100, 0x6b2: 0x100, 0x6b3: 0x100, 0x6b4: 0x100, 0x6b5: 0x100, 0x6b6: 0x100, 0x6b7: 0x100, + 0x6b8: 0x100, 0x6b9: 0x100, 0x6ba: 0x100, 0x6bb: 0x100, 0x6bc: 0x100, 0x6bd: 0x100, 0x6be: 0x100, 0x6bf: 0x100, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0xa6, 0x6c1: 0xa6, 0x6c2: 0xa6, 0x6c3: 0xa6, 0x6c4: 0xa6, 0x6c5: 0xa6, 0x6c6: 0xa6, 0x6c7: 0xa6, + 0x6c8: 0xa6, 0x6c9: 0xa6, 0x6ca: 0xa6, 0x6cb: 0xa6, 0x6cc: 0xa6, 0x6cd: 0xa6, 0x6ce: 0xa6, 0x6cf: 0xa6, + 0x6d0: 0xa6, 0x6d1: 0xa6, 0x6d2: 0xa6, 0x6d3: 0xa6, 0x6d4: 0xa6, 0x6d5: 0xa6, 0x6d6: 0xa6, 0x6d7: 0xa6, + 0x6d8: 0xa6, 0x6d9: 0xa6, 0x6da: 0xa6, 0x6db: 0x1a9, 0x6dc: 0xa6, 0x6dd: 0xa6, 0x6de: 0xa6, 0x6df: 0xa6, + 0x6e0: 0xa6, 0x6e1: 0xa6, 0x6e2: 0xa6, 0x6e3: 0xa6, 0x6e4: 0xa6, 0x6e5: 0xa6, 0x6e6: 0xa6, 0x6e7: 0xa6, + 0x6e8: 0xa6, 0x6e9: 0xa6, 0x6ea: 0xa6, 0x6eb: 0xa6, 0x6ec: 0xa6, 0x6ed: 0xa6, 0x6ee: 0xa6, 0x6ef: 0xa6, + 0x6f0: 0xa6, 0x6f1: 0xa6, 0x6f2: 0xa6, 0x6f3: 0xa6, 0x6f4: 0xa6, 0x6f5: 0xa6, 0x6f6: 0xa6, 0x6f7: 0xa6, + 0x6f8: 0xa6, 0x6f9: 0xa6, 0x6fa: 0xa6, 0x6fb: 0xa6, 0x6fc: 0xa6, 0x6fd: 0xa6, 0x6fe: 0xa6, 0x6ff: 0xa6, + // Block 0x1c, offset 0x700 + 0x700: 0xa6, 0x701: 0xa6, 0x702: 0xa6, 0x703: 0xa6, 0x704: 0xa6, 0x705: 0xa6, 0x706: 0xa6, 0x707: 0xa6, + 0x708: 0xa6, 0x709: 0xa6, 0x70a: 0xa6, 0x70b: 0xa6, 0x70c: 0xa6, 0x70d: 0xa6, 0x70e: 0xa6, 0x70f: 0xa6, + 0x710: 0xa6, 0x711: 0xa6, 0x712: 0xa6, 0x713: 0xa6, 0x714: 0xa6, 0x715: 0xa6, 0x716: 0xa6, 0x717: 0xa6, + 0x718: 0xa6, 0x719: 0xa6, 0x71a: 0xa6, 0x71b: 0xa6, 0x71c: 0x1aa, 0x71d: 0xa6, 0x71e: 0xa6, 0x71f: 0xa6, + 0x720: 0x1ab, 0x721: 0xa6, 0x722: 0xa6, 0x723: 0xa6, 0x724: 0xa6, 0x725: 0xa6, 0x726: 0xa6, 0x727: 0xa6, + 0x728: 0xa6, 0x729: 0xa6, 0x72a: 0xa6, 0x72b: 0xa6, 0x72c: 0xa6, 0x72d: 0xa6, 0x72e: 0xa6, 0x72f: 0xa6, + 0x730: 0xa6, 0x731: 0xa6, 0x732: 0xa6, 0x733: 0xa6, 0x734: 0xa6, 0x735: 0xa6, 0x736: 0xa6, 0x737: 0xa6, + 0x738: 0xa6, 0x739: 0xa6, 0x73a: 0xa6, 0x73b: 0xa6, 0x73c: 0xa6, 0x73d: 0xa6, 0x73e: 0xa6, 0x73f: 0xa6, + // Block 0x1d, offset 0x740 + 0x740: 0xa6, 0x741: 0xa6, 0x742: 0xa6, 0x743: 0xa6, 0x744: 0xa6, 0x745: 0xa6, 0x746: 0xa6, 0x747: 0xa6, + 0x748: 0xa6, 0x749: 0xa6, 0x74a: 0xa6, 0x74b: 0xa6, 0x74c: 0xa6, 0x74d: 0xa6, 0x74e: 0xa6, 0x74f: 0xa6, + 0x750: 0xa6, 0x751: 0xa6, 0x752: 0xa6, 0x753: 0xa6, 0x754: 0xa6, 0x755: 0xa6, 0x756: 0xa6, 0x757: 0xa6, + 0x758: 0xa6, 0x759: 0xa6, 0x75a: 0xa6, 0x75b: 0xa6, 0x75c: 0xa6, 0x75d: 0xa6, 0x75e: 0xa6, 0x75f: 0xa6, + 0x760: 0xa6, 0x761: 0xa6, 0x762: 0xa6, 0x763: 0xa6, 0x764: 0xa6, 0x765: 0xa6, 0x766: 0xa6, 0x767: 0xa6, + 0x768: 0xa6, 0x769: 0xa6, 0x76a: 0xa6, 0x76b: 0xa6, 0x76c: 0xa6, 0x76d: 0xa6, 0x76e: 0xa6, 0x76f: 0xa6, + 0x770: 0xa6, 0x771: 0xa6, 0x772: 0xa6, 0x773: 0xa6, 0x774: 0xa6, 0x775: 0xa6, 0x776: 0xa6, 0x777: 0xa6, + 0x778: 0xa6, 0x779: 0xa6, 0x77a: 0x1ac, 0x77b: 0xa6, 0x77c: 0xa6, 0x77d: 0xa6, 0x77e: 0xa6, 0x77f: 0xa6, + // Block 0x1e, offset 0x780 + 0x780: 0xa6, 0x781: 0xa6, 0x782: 0xa6, 0x783: 0xa6, 0x784: 0xa6, 0x785: 0xa6, 0x786: 0xa6, 0x787: 0xa6, + 0x788: 0xa6, 0x789: 0xa6, 0x78a: 0xa6, 0x78b: 0xa6, 0x78c: 0xa6, 0x78d: 0xa6, 0x78e: 0xa6, 0x78f: 0xa6, + 0x790: 0xa6, 0x791: 0xa6, 0x792: 0xa6, 0x793: 0xa6, 0x794: 0xa6, 0x795: 0xa6, 0x796: 0xa6, 0x797: 0xa6, + 0x798: 0xa6, 0x799: 0xa6, 0x79a: 0xa6, 0x79b: 0xa6, 0x79c: 0xa6, 0x79d: 0xa6, 0x79e: 0xa6, 0x79f: 0xa6, + 0x7a0: 0xa6, 0x7a1: 0xa6, 0x7a2: 0xa6, 0x7a3: 0xa6, 0x7a4: 0xa6, 0x7a5: 0xa6, 0x7a6: 0xa6, 0x7a7: 0xa6, + 0x7a8: 0xa6, 0x7a9: 0xa6, 0x7aa: 0xa6, 0x7ab: 0xa6, 0x7ac: 0xa6, 0x7ad: 0xa6, 0x7ae: 0xa6, 0x7af: 0x1ad, + 0x7b0: 0x100, 0x7b1: 0x100, 0x7b2: 0x100, 0x7b3: 0x100, 0x7b4: 0x100, 0x7b5: 0x100, 0x7b6: 0x100, 0x7b7: 0x100, + 0x7b8: 0x100, 0x7b9: 0x100, 0x7ba: 0x100, 0x7bb: 0x100, 0x7bc: 0x100, 0x7bd: 0x100, 0x7be: 0x100, 0x7bf: 0x100, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x100, 0x7c1: 0x100, 0x7c2: 0x100, 0x7c3: 0x100, 0x7c4: 0x100, 0x7c5: 0x100, 0x7c6: 0x100, 0x7c7: 0x100, + 0x7c8: 0x100, 0x7c9: 0x100, 0x7ca: 0x100, 0x7cb: 0x100, 0x7cc: 0x100, 0x7cd: 0x100, 0x7ce: 0x100, 0x7cf: 0x100, + 0x7d0: 0x100, 0x7d1: 0x100, 0x7d2: 0x100, 0x7d3: 0x100, 0x7d4: 0x100, 0x7d5: 0x100, 0x7d6: 0x100, 0x7d7: 0x100, + 0x7d8: 0x100, 0x7d9: 0x100, 0x7da: 0x100, 0x7db: 0x100, 0x7dc: 0x100, 0x7dd: 0x100, 0x7de: 0x100, 0x7df: 0x100, + 0x7e0: 0x7c, 0x7e1: 0x7d, 0x7e2: 0x7e, 0x7e3: 0x7f, 0x7e4: 0x80, 0x7e5: 0x81, 0x7e6: 0x82, 0x7e7: 0x83, + 0x7e8: 0x84, 0x7e9: 0x100, 0x7ea: 0x100, 0x7eb: 0x100, 0x7ec: 0x100, 0x7ed: 0x100, 0x7ee: 0x100, 0x7ef: 0x100, + 0x7f0: 0x100, 0x7f1: 0x100, 0x7f2: 0x100, 0x7f3: 0x100, 0x7f4: 0x100, 0x7f5: 0x100, 0x7f6: 0x100, 0x7f7: 0x100, + 0x7f8: 0x100, 0x7f9: 0x100, 0x7fa: 0x100, 0x7fb: 0x100, 0x7fc: 0x100, 0x7fd: 0x100, 0x7fe: 0x100, 0x7ff: 0x100, + // Block 0x20, offset 0x800 + 0x800: 0xa6, 0x801: 0xa6, 0x802: 0xa6, 0x803: 0xa6, 0x804: 0xa6, 0x805: 0xa6, 0x806: 0xa6, 0x807: 0xa6, + 0x808: 0xa6, 0x809: 0xa6, 0x80a: 0xa6, 0x80b: 0xa6, 0x80c: 0xa6, 0x80d: 0x1ae, 0x80e: 0xa6, 0x80f: 0xa6, + 0x810: 0xa6, 0x811: 0xa6, 0x812: 0xa6, 0x813: 0xa6, 0x814: 0xa6, 0x815: 0xa6, 0x816: 0xa6, 0x817: 0xa6, + 0x818: 0xa6, 0x819: 0xa6, 0x81a: 0xa6, 0x81b: 0xa6, 0x81c: 0xa6, 0x81d: 0xa6, 0x81e: 0xa6, 0x81f: 0xa6, + 0x820: 0xa6, 0x821: 0xa6, 0x822: 0xa6, 0x823: 0xa6, 0x824: 0xa6, 0x825: 0xa6, 0x826: 0xa6, 0x827: 0xa6, + 0x828: 0xa6, 0x829: 0xa6, 0x82a: 0xa6, 0x82b: 0xa6, 0x82c: 0xa6, 0x82d: 0xa6, 0x82e: 0xa6, 0x82f: 0xa6, + 0x830: 0xa6, 0x831: 0xa6, 0x832: 0xa6, 0x833: 0xa6, 0x834: 0xa6, 0x835: 0xa6, 0x836: 0xa6, 0x837: 0xa6, + 0x838: 0xa6, 0x839: 0xa6, 0x83a: 0xa6, 0x83b: 0xa6, 0x83c: 0xa6, 0x83d: 0xa6, 0x83e: 0xa6, 0x83f: 0xa6, + // Block 0x21, offset 0x840 + 0x840: 0xa6, 0x841: 0xa6, 0x842: 0xa6, 0x843: 0xa6, 0x844: 0xa6, 0x845: 0xa6, 0x846: 0xa6, 0x847: 0xa6, + 0x848: 0xa6, 0x849: 0xa6, 0x84a: 0xa6, 0x84b: 0xa6, 0x84c: 0xa6, 0x84d: 0xa6, 0x84e: 0x1af, 0x84f: 0x100, + 0x850: 0x100, 0x851: 0x100, 0x852: 0x100, 0x853: 0x100, 0x854: 0x100, 0x855: 0x100, 0x856: 0x100, 0x857: 0x100, + 0x858: 0x100, 0x859: 0x100, 0x85a: 0x100, 0x85b: 0x100, 0x85c: 0x100, 0x85d: 0x100, 0x85e: 0x100, 0x85f: 0x100, + 0x860: 0x100, 0x861: 0x100, 0x862: 0x100, 0x863: 0x100, 0x864: 0x100, 0x865: 0x100, 0x866: 0x100, 0x867: 0x100, + 0x868: 0x100, 0x869: 0x100, 0x86a: 0x100, 0x86b: 0x100, 0x86c: 0x100, 0x86d: 0x100, 0x86e: 0x100, 0x86f: 0x100, + 0x870: 0x100, 0x871: 0x100, 0x872: 0x100, 0x873: 0x100, 0x874: 0x100, 0x875: 0x100, 0x876: 0x100, 0x877: 0x100, + 0x878: 0x100, 0x879: 0x100, 0x87a: 0x100, 0x87b: 0x100, 0x87c: 0x100, 0x87d: 0x100, 0x87e: 0x100, 0x87f: 0x100, + // Block 0x22, offset 0x880 + 0x890: 0x0c, 0x891: 0x0d, 0x892: 0x0e, 0x893: 0x0f, 0x894: 0x10, 0x895: 0x0a, 0x896: 0x11, 0x897: 0x07, + 0x898: 0x12, 0x899: 0x0a, 0x89a: 0x13, 0x89b: 0x14, 0x89c: 0x15, 0x89d: 0x16, 0x89e: 0x17, 0x89f: 0x18, + 0x8a0: 0x07, 0x8a1: 0x07, 0x8a2: 0x07, 0x8a3: 0x07, 0x8a4: 0x07, 0x8a5: 0x07, 0x8a6: 0x07, 0x8a7: 0x07, + 0x8a8: 0x07, 0x8a9: 0x07, 0x8aa: 0x19, 0x8ab: 0x1a, 0x8ac: 0x1b, 0x8ad: 0x07, 0x8ae: 0x1c, 0x8af: 0x1d, + 0x8b0: 0x07, 0x8b1: 0x1e, 0x8b2: 0x1f, 0x8b3: 0x0a, 0x8b4: 0x0a, 0x8b5: 0x0a, 0x8b6: 0x0a, 0x8b7: 0x0a, + 0x8b8: 0x0a, 0x8b9: 0x0a, 0x8ba: 0x0a, 0x8bb: 0x0a, 0x8bc: 0x0a, 0x8bd: 0x0a, 0x8be: 0x0a, 0x8bf: 0x0a, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0a, 0x8c1: 0x0a, 0x8c2: 0x0a, 0x8c3: 0x0a, 0x8c4: 0x0a, 0x8c5: 0x0a, 0x8c6: 0x0a, 0x8c7: 0x0a, + 0x8c8: 0x0a, 0x8c9: 0x0a, 0x8ca: 0x0a, 0x8cb: 0x0a, 0x8cc: 0x0a, 0x8cd: 0x0a, 0x8ce: 0x0a, 0x8cf: 0x0a, + 0x8d0: 0x0a, 0x8d1: 0x0a, 0x8d2: 0x0a, 0x8d3: 0x0a, 0x8d4: 0x0a, 0x8d5: 0x0a, 0x8d6: 0x0a, 0x8d7: 0x0a, + 0x8d8: 0x0a, 0x8d9: 0x0a, 0x8da: 0x0a, 0x8db: 0x0a, 0x8dc: 0x0a, 0x8dd: 0x0a, 0x8de: 0x0a, 0x8df: 0x0a, + 0x8e0: 0x0a, 0x8e1: 0x0a, 0x8e2: 0x0a, 0x8e3: 0x0a, 0x8e4: 0x0a, 0x8e5: 0x0a, 0x8e6: 0x0a, 0x8e7: 0x0a, + 0x8e8: 0x0a, 0x8e9: 0x0a, 0x8ea: 0x0a, 0x8eb: 0x0a, 0x8ec: 0x0a, 0x8ed: 0x0a, 0x8ee: 0x0a, 0x8ef: 0x0a, + 0x8f0: 0x0a, 0x8f1: 0x0a, 0x8f2: 0x0a, 0x8f3: 0x0a, 0x8f4: 0x0a, 0x8f5: 0x0a, 0x8f6: 0x0a, 0x8f7: 0x0a, + 0x8f8: 0x0a, 0x8f9: 0x0a, 0x8fa: 0x0a, 0x8fb: 0x0a, 0x8fc: 0x0a, 0x8fd: 0x0a, 0x8fe: 0x0a, 0x8ff: 0x0a, + // Block 0x24, offset 0x900 + 0x900: 0x1b0, 0x901: 0x1b1, 0x902: 0x100, 0x903: 0x100, 0x904: 0x1b2, 0x905: 0x1b2, 0x906: 0x1b2, 0x907: 0x1b3, + 0x908: 0x100, 0x909: 0x100, 0x90a: 0x100, 0x90b: 0x100, 0x90c: 0x100, 0x90d: 0x100, 0x90e: 0x100, 0x90f: 0x100, + 0x910: 0x100, 0x911: 0x100, 0x912: 0x100, 0x913: 0x100, 0x914: 0x100, 0x915: 0x100, 0x916: 0x100, 0x917: 0x100, + 0x918: 0x100, 0x919: 0x100, 0x91a: 0x100, 0x91b: 0x100, 0x91c: 0x100, 0x91d: 0x100, 0x91e: 0x100, 0x91f: 0x100, + 0x920: 0x100, 0x921: 0x100, 0x922: 0x100, 0x923: 0x100, 0x924: 0x100, 0x925: 0x100, 0x926: 0x100, 0x927: 0x100, + 0x928: 0x100, 0x929: 0x100, 0x92a: 0x100, 0x92b: 0x100, 0x92c: 0x100, 0x92d: 0x100, 0x92e: 0x100, 0x92f: 0x100, + 0x930: 0x100, 0x931: 0x100, 0x932: 0x100, 0x933: 0x100, 0x934: 0x100, 0x935: 0x100, 0x936: 0x100, 0x937: 0x100, + 0x938: 0x100, 0x939: 0x100, 0x93a: 0x100, 0x93b: 0x100, 0x93c: 0x100, 0x93d: 0x100, 0x93e: 0x100, 0x93f: 0x100, + // Block 0x25, offset 0x940 + 0x940: 0x0a, 0x941: 0x0a, 0x942: 0x0a, 0x943: 0x0a, 0x944: 0x0a, 0x945: 0x0a, 0x946: 0x0a, 0x947: 0x0a, + 0x948: 0x0a, 0x949: 0x0a, 0x94a: 0x0a, 0x94b: 0x0a, 0x94c: 0x0a, 0x94d: 0x0a, 0x94e: 0x0a, 0x94f: 0x0a, + 0x950: 0x0a, 0x951: 0x0a, 0x952: 0x0a, 0x953: 0x0a, 0x954: 0x0a, 0x955: 0x0a, 0x956: 0x0a, 0x957: 0x0a, + 0x958: 0x0a, 0x959: 0x0a, 0x95a: 0x0a, 0x95b: 0x0a, 0x95c: 0x0a, 0x95d: 0x0a, 0x95e: 0x0a, 0x95f: 0x0a, + 0x960: 0x22, 0x961: 0x0a, 0x962: 0x0a, 0x963: 0x0a, 0x964: 0x0a, 0x965: 0x0a, 0x966: 0x0a, 0x967: 0x0a, + 0x968: 0x0a, 0x969: 0x0a, 0x96a: 0x0a, 0x96b: 0x0a, 0x96c: 0x0a, 0x96d: 0x0a, 0x96e: 0x0a, 0x96f: 0x0a, + 0x970: 0x0a, 0x971: 0x0a, 0x972: 0x0a, 0x973: 0x0a, 0x974: 0x0a, 0x975: 0x0a, 0x976: 0x0a, 0x977: 0x0a, + 0x978: 0x0a, 0x979: 0x0a, 0x97a: 0x0a, 0x97b: 0x0a, 0x97c: 0x0a, 0x97d: 0x0a, 0x97e: 0x0a, 0x97f: 0x0a, + // Block 0x26, offset 0x980 + 0x980: 0x0a, 0x981: 0x0a, 0x982: 0x0a, 0x983: 0x0a, 0x984: 0x0a, 0x985: 0x0a, 0x986: 0x0a, 0x987: 0x0a, + 0x988: 0x0a, 0x989: 0x0a, 0x98a: 0x0a, 0x98b: 0x0a, 0x98c: 0x0a, 0x98d: 0x0a, 0x98e: 0x0a, 0x98f: 0x0a, +} + +// idnaSparseOffset: 303 entries, 606 bytes +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x7e, 0x87, 0x97, 0xa6, 0xb1, 0xbe, 0xcf, 0xd9, 0xe0, 0xed, 0xfe, 0x105, 0x110, 0x11f, 0x12d, 0x137, 0x139, 0x13e, 0x141, 0x144, 0x146, 0x152, 0x15d, 0x165, 0x16b, 0x171, 0x176, 0x17b, 0x17e, 0x182, 0x188, 0x18d, 0x198, 0x1a2, 0x1a8, 0x1b9, 0x1c4, 0x1c7, 0x1cf, 0x1d2, 0x1df, 0x1e7, 0x1eb, 0x1f2, 0x1fa, 0x20a, 0x216, 0x219, 0x223, 0x22f, 0x23b, 0x247, 0x24f, 0x254, 0x261, 0x272, 0x27d, 0x282, 0x28b, 0x293, 0x299, 0x29e, 0x2a1, 0x2a5, 0x2ab, 0x2af, 0x2b3, 0x2b7, 0x2bc, 0x2c4, 0x2cb, 0x2d6, 0x2e0, 0x2e4, 0x2e7, 0x2ed, 0x2f1, 0x2f3, 0x2f6, 0x2f8, 0x2fb, 0x305, 0x308, 0x317, 0x31b, 0x31f, 0x321, 0x32a, 0x32e, 0x333, 0x338, 0x33e, 0x34e, 0x354, 0x358, 0x367, 0x36c, 0x374, 0x37e, 0x389, 0x391, 0x3a2, 0x3ab, 0x3bb, 0x3c8, 0x3d4, 0x3d9, 0x3e6, 0x3ea, 0x3ef, 0x3f1, 0x3f3, 0x3f7, 0x3f9, 0x3fd, 0x406, 0x40c, 0x410, 0x420, 0x42a, 0x42f, 0x432, 0x438, 0x43f, 0x444, 0x448, 0x44e, 0x453, 0x45c, 0x461, 0x467, 0x46e, 0x475, 0x47c, 0x480, 0x483, 0x488, 0x494, 0x49a, 0x49f, 0x4a6, 0x4ae, 0x4b3, 0x4b7, 0x4c7, 0x4ce, 0x4d2, 0x4d6, 0x4dd, 0x4df, 0x4e2, 0x4e5, 0x4e9, 0x4f2, 0x4f6, 0x4fe, 0x501, 0x509, 0x514, 0x523, 0x52f, 0x535, 0x542, 0x54e, 0x556, 0x55f, 0x56a, 0x571, 0x580, 0x58d, 0x591, 0x59e, 0x5a7, 0x5ab, 0x5ba, 0x5c2, 0x5cd, 0x5d6, 0x5dc, 0x5e4, 0x5ed, 0x5f9, 0x5fc, 0x608, 0x60b, 0x614, 0x617, 0x61c, 0x625, 0x62a, 0x637, 0x642, 0x64b, 0x656, 0x659, 0x65c, 0x666, 0x66f, 0x67b, 0x688, 0x695, 0x6a3, 0x6aa, 0x6b5, 0x6bc, 0x6c0, 0x6c4, 0x6c7, 0x6cc, 0x6cf, 0x6d2, 0x6d6, 0x6d9, 0x6de, 0x6e5, 0x6e8, 0x6f0, 0x6f4, 0x6ff, 0x702, 0x705, 0x708, 0x70e, 0x714, 0x71d, 0x720, 0x723, 0x726, 0x72e, 0x733, 0x73c, 0x73f, 0x744, 0x74e, 0x752, 0x756, 0x759, 0x75c, 0x760, 0x76f, 0x77b, 0x77f, 0x784, 0x789, 0x78e, 0x792, 0x797, 0x7a0, 0x7a5, 0x7a9, 0x7af, 0x7b5, 0x7ba, 0x7c0, 0x7c6, 0x7d0, 0x7d6, 0x7df, 0x7e2, 0x7e5, 0x7e9, 0x7ed, 0x7f1, 0x7f7, 0x7fd, 0x802, 0x805, 0x815, 0x81c, 0x820, 0x827, 0x82b, 0x831, 0x838, 0x83f, 0x845, 0x84e, 0x852, 0x860, 0x863, 0x866, 0x86a, 0x86e, 0x871, 0x875, 0x878, 0x87d, 0x87f, 0x881} + +// idnaSparseValues: 2180 entries, 8720 bytes +var idnaSparseValues = [2180]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x07}, + {value: 0xe105, lo: 0x80, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0x97}, + {value: 0xe105, lo: 0x98, hi: 0x9e}, + {value: 0x001f, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbf}, + // Block 0x1, offset 0x8 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0xe01d, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0335, lo: 0x83, hi: 0x83}, + {value: 0x034d, lo: 0x84, hi: 0x84}, + {value: 0x0365, lo: 0x85, hi: 0x85}, + {value: 0xe00d, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0xe00d, lo: 0x88, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x89}, + {value: 0xe00d, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe00d, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0x8d}, + {value: 0xe00d, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0xbf}, + // Block 0x2, offset 0x19 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x00a9, lo: 0xb0, hi: 0xb0}, + {value: 0x037d, lo: 0xb1, hi: 0xb1}, + {value: 0x00b1, lo: 0xb2, hi: 0xb2}, + {value: 0x00b9, lo: 0xb3, hi: 0xb3}, + {value: 0x034d, lo: 0xb4, hi: 0xb4}, + {value: 0x0395, lo: 0xb5, hi: 0xb5}, + {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, + {value: 0x00c1, lo: 0xb7, hi: 0xb7}, + {value: 0x00c9, lo: 0xb8, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbf}, + // Block 0x3, offset 0x25 + {value: 0x0000, lo: 0x01}, + {value: 0x3308, lo: 0x80, hi: 0xbf}, + // Block 0x4, offset 0x27 + {value: 0x0000, lo: 0x04}, + {value: 0x03f5, lo: 0x80, hi: 0x8f}, + {value: 0xe105, lo: 0x90, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x5, offset 0x2c + {value: 0x0000, lo: 0x06}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x0545, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x0008, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x6, offset 0x33 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0131, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0018, lo: 0x89, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x3308, lo: 0x91, hi: 0xbd}, + {value: 0x0818, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x7, offset 0x3e + {value: 0x0000, lo: 0x0b}, + {value: 0x0818, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x82}, + {value: 0x0818, lo: 0x83, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x85}, + {value: 0x0818, lo: 0x86, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xae}, + {value: 0x0808, lo: 0xaf, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x8, offset 0x4a + {value: 0x0000, lo: 0x03}, + {value: 0x0a08, lo: 0x80, hi: 0x87}, + {value: 0x0c08, lo: 0x88, hi: 0x99}, + {value: 0x0a08, lo: 0x9a, hi: 0xbf}, + // Block 0x9, offset 0x4e + {value: 0x0000, lo: 0x0e}, + {value: 0x3308, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0c08, lo: 0x8d, hi: 0x8d}, + {value: 0x0a08, lo: 0x8e, hi: 0x98}, + {value: 0x0c08, lo: 0x99, hi: 0x9b}, + {value: 0x0a08, lo: 0x9c, hi: 0xaa}, + {value: 0x0c08, lo: 0xab, hi: 0xac}, + {value: 0x0a08, lo: 0xad, hi: 0xb0}, + {value: 0x0c08, lo: 0xb1, hi: 0xb1}, + {value: 0x0a08, lo: 0xb2, hi: 0xb2}, + {value: 0x0c08, lo: 0xb3, hi: 0xb4}, + {value: 0x0a08, lo: 0xb5, hi: 0xb7}, + {value: 0x0c08, lo: 0xb8, hi: 0xb9}, + {value: 0x0a08, lo: 0xba, hi: 0xbf}, + // Block 0xa, offset 0x5d + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xb0}, + {value: 0x0808, lo: 0xb1, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xb, offset 0x62 + {value: 0x0000, lo: 0x09}, + {value: 0x0808, lo: 0x80, hi: 0x89}, + {value: 0x0a08, lo: 0x8a, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xb3}, + {value: 0x0808, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb9}, + {value: 0x0818, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x0818, lo: 0xbe, hi: 0xbf}, + // Block 0xc, offset 0x6c + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x99}, + {value: 0x0808, lo: 0x9a, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0xa3}, + {value: 0x0808, lo: 0xa4, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa7}, + {value: 0x0808, lo: 0xa8, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0818, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xd, offset 0x78 + {value: 0x0000, lo: 0x05}, + {value: 0x0a08, lo: 0x80, hi: 0x88}, + {value: 0x0808, lo: 0x89, hi: 0x89}, + {value: 0x3308, lo: 0x8a, hi: 0xa1}, + {value: 0x0840, lo: 0xa2, hi: 0xa2}, + {value: 0x3308, lo: 0xa3, hi: 0xbf}, + // Block 0xe, offset 0x7e + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0xf, offset 0x87 + {value: 0x0000, lo: 0x0f}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x85}, + {value: 0x3008, lo: 0x86, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x3008, lo: 0x8a, hi: 0x8c}, + {value: 0x3b08, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x10, offset 0x97 + {value: 0x0000, lo: 0x0e}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbf}, + // Block 0x11, offset 0xa6 + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xba}, + {value: 0x3b08, lo: 0xbb, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x12, offset 0xb1 + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x13, offset 0xbe + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x89}, + {value: 0x3b08, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x3008, lo: 0x8f, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x3008, lo: 0x98, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb1}, + {value: 0x3008, lo: 0xb2, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x14, offset 0xcf + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x01f1, lo: 0xb3, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb9}, + {value: 0x3b08, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x15, offset 0xd9 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0xbf}, + // Block 0x16, offset 0xe0 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x3308, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0201, lo: 0x9c, hi: 0x9c}, + {value: 0x0209, lo: 0x9d, hi: 0x9d}, + {value: 0x0008, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x17, offset 0xed + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe03d, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xb8}, + {value: 0x3308, lo: 0xb9, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x18, offset 0xfe + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0x19, offset 0x105 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x3008, lo: 0xab, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xb0}, + {value: 0x3008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x1a, offset 0x110 + {value: 0x0000, lo: 0x0e}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x3008, lo: 0x96, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x3308, lo: 0x9e, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x3008, lo: 0xa2, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbf}, + // Block 0x1b, offset 0x11f + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x3008, lo: 0x87, hi: 0x8c}, + {value: 0x3308, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x3008, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x3008, lo: 0x9a, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x1c, offset 0x12d + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x86}, + {value: 0x055d, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8c}, + {value: 0x055d, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0xe105, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0x137 + {value: 0x0000, lo: 0x01}, + {value: 0x0018, lo: 0x80, hi: 0xbf}, + // Block 0x1e, offset 0x139 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa0}, + {value: 0x2018, lo: 0xa1, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x1f, offset 0x13e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa7}, + {value: 0x2018, lo: 0xa8, hi: 0xbf}, + // Block 0x20, offset 0x141 + {value: 0x0000, lo: 0x02}, + {value: 0x2018, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0xbf}, + // Block 0x21, offset 0x144 + {value: 0x0000, lo: 0x01}, + {value: 0x0008, lo: 0x80, hi: 0xbf}, + // Block 0x22, offset 0x146 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x23, offset 0x152 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x15d + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x25, offset 0x165 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x26, offset 0x16b + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x27, offset 0x171 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x28, offset 0x176 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x29, offset 0x17b + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x2a, offset 0x17e + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xbf}, + // Block 0x2b, offset 0x182 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x2c, offset 0x188 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x2d, offset 0x18d + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x93}, + {value: 0x3b08, lo: 0x94, hi: 0x94}, + {value: 0x3808, lo: 0x95, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x3808, lo: 0xb4, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x2e, offset 0x198 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x2f, offset 0x1a2 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xb3}, + {value: 0x3340, lo: 0xb4, hi: 0xb5}, + {value: 0x3008, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x30, offset 0x1a8 + {value: 0x0000, lo: 0x10}, + {value: 0x3008, lo: 0x80, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x3008, lo: 0x87, hi: 0x88}, + {value: 0x3308, lo: 0x89, hi: 0x91}, + {value: 0x3b08, lo: 0x92, hi: 0x92}, + {value: 0x3308, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0x96}, + {value: 0x0008, lo: 0x97, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x31, offset 0x1b9 + {value: 0x0000, lo: 0x0a}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x86}, + {value: 0x0218, lo: 0x87, hi: 0x87}, + {value: 0x0018, lo: 0x88, hi: 0x8a}, + {value: 0x33c0, lo: 0x8b, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x33c0, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0208, lo: 0xa0, hi: 0xbf}, + // Block 0x32, offset 0x1c4 + {value: 0x0000, lo: 0x02}, + {value: 0x0208, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x33, offset 0x1c7 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x0208, lo: 0x87, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xa9}, + {value: 0x0208, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x34, offset 0x1cf + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x35, offset 0x1d2 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb8}, + {value: 0x3308, lo: 0xb9, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x36, offset 0x1df + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x37, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x38, offset 0x1eb + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0028, lo: 0x9a, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xbf}, + // Block 0x39, offset 0x1f2 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x3308, lo: 0x97, hi: 0x98}, + {value: 0x3008, lo: 0x99, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1fa + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x94}, + {value: 0x3008, lo: 0x95, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3b08, lo: 0xa0, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xac}, + {value: 0x3008, lo: 0xad, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x3b, offset 0x20a + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xbd}, + {value: 0x3318, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x3c, offset 0x216 + {value: 0x0000, lo: 0x02}, + {value: 0x3308, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0xbf}, + // Block 0x3d, offset 0x219 + {value: 0x0000, lo: 0x09}, + {value: 0x3308, lo: 0x80, hi: 0x83}, + {value: 0x3008, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x3008, lo: 0xbd, hi: 0xbf}, + // Block 0x3e, offset 0x223 + {value: 0x0000, lo: 0x0b}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x3808, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x3f, offset 0x22f + {value: 0x0000, lo: 0x0b}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa9}, + {value: 0x3808, lo: 0xaa, hi: 0xaa}, + {value: 0x3b08, lo: 0xab, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xbf}, + // Block 0x40, offset 0x23b + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa9}, + {value: 0x3008, lo: 0xaa, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb1}, + {value: 0x3808, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbf}, + // Block 0x41, offset 0x247 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x3008, lo: 0xa4, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x42, offset 0x24f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x43, offset 0x254 + {value: 0x0000, lo: 0x0c}, + {value: 0x02a9, lo: 0x80, hi: 0x80}, + {value: 0x02b1, lo: 0x81, hi: 0x81}, + {value: 0x02b9, lo: 0x82, hi: 0x82}, + {value: 0x02c1, lo: 0x83, hi: 0x83}, + {value: 0x02c9, lo: 0x84, hi: 0x85}, + {value: 0x02d1, lo: 0x86, hi: 0x86}, + {value: 0x02d9, lo: 0x87, hi: 0x87}, + {value: 0x057d, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x059d, lo: 0x90, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x059d, lo: 0xbd, hi: 0xbf}, + // Block 0x44, offset 0x261 + {value: 0x0000, lo: 0x10}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x92}, + {value: 0x0018, lo: 0x93, hi: 0x93}, + {value: 0x3308, lo: 0x94, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa8}, + {value: 0x0008, lo: 0xa9, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x3008, lo: 0xb7, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x45, offset 0x272 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x87}, + {value: 0xe045, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0xe045, lo: 0x98, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0xe045, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbf}, + // Block 0x46, offset 0x27d + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x8f}, + {value: 0x3318, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x47, offset 0x282 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x0851, lo: 0x89, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x48, offset 0x28b + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0859, lo: 0xac, hi: 0xac}, + {value: 0x0861, lo: 0xad, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xae}, + {value: 0x0869, lo: 0xaf, hi: 0xaf}, + {value: 0x0871, lo: 0xb0, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x49, offset 0x293 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x9f}, + {value: 0x0080, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xad}, + {value: 0x0080, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x4a, offset 0x299 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xa8}, + {value: 0x09dd, lo: 0xa9, hi: 0xa9}, + {value: 0x09fd, lo: 0xaa, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xbf}, + // Block 0x4b, offset 0x29e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xbf}, + // Block 0x4c, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0929, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0xbf}, + // Block 0x4d, offset 0x2a5 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0e7e, lo: 0xb4, hi: 0xb4}, + {value: 0x0932, lo: 0xb5, hi: 0xb5}, + {value: 0x0e9e, lo: 0xb6, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x4e, offset 0x2ab + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x9b}, + {value: 0x0939, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0xbf}, + // Block 0x4f, offset 0x2af + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x50, offset 0x2b3 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0xbf}, + // Block 0x51, offset 0x2b7 + {value: 0x0000, lo: 0x04}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x03f5, lo: 0x90, hi: 0x9f}, + {value: 0x0ebd, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x52, offset 0x2bc + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x53, offset 0x2c4 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xae}, + {value: 0xe075, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0x54, offset 0x2cb + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x55, offset 0x2d6 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xbf}, + // Block 0x56, offset 0x2e0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x57, offset 0x2e4 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x58, offset 0x2e7 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9e}, + {value: 0x0ef5, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x59, offset 0x2ed + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb2}, + {value: 0x0f15, lo: 0xb3, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x5a, offset 0x2f1 + {value: 0x0020, lo: 0x01}, + {value: 0x0f35, lo: 0x80, hi: 0xbf}, + // Block 0x5b, offset 0x2f3 + {value: 0x0020, lo: 0x02}, + {value: 0x1735, lo: 0x80, hi: 0x8f}, + {value: 0x1915, lo: 0x90, hi: 0xbf}, + // Block 0x5c, offset 0x2f6 + {value: 0x0020, lo: 0x01}, + {value: 0x1f15, lo: 0x80, hi: 0xbf}, + // Block 0x5d, offset 0x2f8 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x5e, offset 0x2fb + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x3308, lo: 0x99, hi: 0x9a}, + {value: 0x096a, lo: 0x9b, hi: 0x9b}, + {value: 0x0972, lo: 0x9c, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9e}, + {value: 0x0979, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xbf}, + // Block 0x5f, offset 0x305 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x0981, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x308 + {value: 0x0000, lo: 0x0e}, + {value: 0x0040, lo: 0x80, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb0}, + {value: 0x2a35, lo: 0xb1, hi: 0xb1}, + {value: 0x2a55, lo: 0xb2, hi: 0xb2}, + {value: 0x2a75, lo: 0xb3, hi: 0xb3}, + {value: 0x2a95, lo: 0xb4, hi: 0xb4}, + {value: 0x2a75, lo: 0xb5, hi: 0xb5}, + {value: 0x2ab5, lo: 0xb6, hi: 0xb6}, + {value: 0x2ad5, lo: 0xb7, hi: 0xb7}, + {value: 0x2af5, lo: 0xb8, hi: 0xb9}, + {value: 0x2b15, lo: 0xba, hi: 0xbb}, + {value: 0x2b35, lo: 0xbc, hi: 0xbd}, + {value: 0x2b15, lo: 0xbe, hi: 0xbf}, + // Block 0x61, offset 0x317 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x62, offset 0x31b + {value: 0x0008, lo: 0x03}, + {value: 0x098a, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0a82, lo: 0xa0, hi: 0xbf}, + // Block 0x63, offset 0x31f + {value: 0x0008, lo: 0x01}, + {value: 0x0d19, lo: 0x80, hi: 0xbf}, + // Block 0x64, offset 0x321 + {value: 0x0008, lo: 0x08}, + {value: 0x0f19, lo: 0x80, hi: 0xb0}, + {value: 0x4045, lo: 0xb1, hi: 0xb1}, + {value: 0x10a1, lo: 0xb2, hi: 0xb3}, + {value: 0x4065, lo: 0xb4, hi: 0xb4}, + {value: 0x10b1, lo: 0xb5, hi: 0xb7}, + {value: 0x4085, lo: 0xb8, hi: 0xb8}, + {value: 0x4085, lo: 0xb9, hi: 0xb9}, + {value: 0x10c9, lo: 0xba, hi: 0xbf}, + // Block 0x65, offset 0x32a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x66, offset 0x32e + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x67, offset 0x333 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xbf}, + // Block 0x68, offset 0x338 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb1}, + {value: 0x0018, lo: 0xb2, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x69, offset 0x33e + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0x85}, + {value: 0x3b08, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x3308, lo: 0x8b, hi: 0x8b}, + {value: 0x0008, lo: 0x8c, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xab}, + {value: 0x3b08, lo: 0xac, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x6a, offset 0x34e + {value: 0x0000, lo: 0x05}, + {value: 0x0208, lo: 0x80, hi: 0xb1}, + {value: 0x0108, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x6b, offset 0x354 + {value: 0x0000, lo: 0x03}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xbf}, + // Block 0x6c, offset 0x358 + {value: 0x0000, lo: 0x0e}, + {value: 0x3008, lo: 0x80, hi: 0x83}, + {value: 0x3b08, lo: 0x84, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xba}, + {value: 0x0008, lo: 0xbb, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x6d, offset 0x367 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x6e, offset 0x36c + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x91}, + {value: 0x3008, lo: 0x92, hi: 0x92}, + {value: 0x3808, lo: 0x93, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x6f, offset 0x374 + {value: 0x0000, lo: 0x09}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb9}, + {value: 0x3008, lo: 0xba, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x70, offset 0x37e + {value: 0x0000, lo: 0x0a}, + {value: 0x3808, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x71, offset 0x389 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x72, offset 0x391 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8b}, + {value: 0x3308, lo: 0x8c, hi: 0x8c}, + {value: 0x3008, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x3008, lo: 0xbd, hi: 0xbd}, + {value: 0x0008, lo: 0xbe, hi: 0xbf}, + // Block 0x73, offset 0x3a2 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbf}, + // Block 0x74, offset 0x3ab + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x9a}, + {value: 0x0008, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xaa}, + {value: 0x3008, lo: 0xab, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb5}, + {value: 0x3b08, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x75, offset 0x3bb + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x90}, + {value: 0x0008, lo: 0x91, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x76, offset 0x3c8 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x449d, lo: 0x9c, hi: 0x9c}, + {value: 0x44b5, lo: 0x9d, hi: 0x9d}, + {value: 0x0941, lo: 0x9e, hi: 0x9e}, + {value: 0xe06d, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa8}, + {value: 0x13f9, lo: 0xa9, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x44cd, lo: 0xb0, hi: 0xbf}, + // Block 0x77, offset 0x3d4 + {value: 0x0000, lo: 0x04}, + {value: 0x44ed, lo: 0x80, hi: 0x8f}, + {value: 0x450d, lo: 0x90, hi: 0x9f}, + {value: 0x452d, lo: 0xa0, hi: 0xaf}, + {value: 0x450d, lo: 0xb0, hi: 0xbf}, + // Block 0x78, offset 0x3d9 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3b08, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x79, offset 0x3e6 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x7a, offset 0x3ea + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x7b, offset 0x3ef + {value: 0x0000, lo: 0x01}, + {value: 0x0040, lo: 0x80, hi: 0xbf}, + // Block 0x7c, offset 0x3f1 + {value: 0x0020, lo: 0x01}, + {value: 0x454d, lo: 0x80, hi: 0xbf}, + // Block 0x7d, offset 0x3f3 + {value: 0x0020, lo: 0x03}, + {value: 0x4d4d, lo: 0x80, hi: 0x94}, + {value: 0x4b0d, lo: 0x95, hi: 0x95}, + {value: 0x4fed, lo: 0x96, hi: 0xbf}, + // Block 0x7e, offset 0x3f7 + {value: 0x0020, lo: 0x01}, + {value: 0x552d, lo: 0x80, hi: 0xbf}, + // Block 0x7f, offset 0x3f9 + {value: 0x0020, lo: 0x03}, + {value: 0x5d2d, lo: 0x80, hi: 0x84}, + {value: 0x568d, lo: 0x85, hi: 0x85}, + {value: 0x5dcd, lo: 0x86, hi: 0xbf}, + // Block 0x80, offset 0x3fd + {value: 0x0020, lo: 0x08}, + {value: 0x6b8d, lo: 0x80, hi: 0x8f}, + {value: 0x6d4d, lo: 0x90, hi: 0x90}, + {value: 0x6d8d, lo: 0x91, hi: 0xab}, + {value: 0x1401, lo: 0xac, hi: 0xac}, + {value: 0x70ed, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x710d, lo: 0xb0, hi: 0xbf}, + // Block 0x81, offset 0x406 + {value: 0x0020, lo: 0x05}, + {value: 0x730d, lo: 0x80, hi: 0xad}, + {value: 0x656d, lo: 0xae, hi: 0xae}, + {value: 0x78cd, lo: 0xaf, hi: 0xb5}, + {value: 0x6f8d, lo: 0xb6, hi: 0xb6}, + {value: 0x79ad, lo: 0xb7, hi: 0xbf}, + // Block 0x82, offset 0x40c + {value: 0x0008, lo: 0x03}, + {value: 0x1751, lo: 0x80, hi: 0x82}, + {value: 0x1741, lo: 0x83, hi: 0x83}, + {value: 0x1769, lo: 0x84, hi: 0xbf}, + // Block 0x83, offset 0x410 + {value: 0x0008, lo: 0x0f}, + {value: 0x1d81, lo: 0x80, hi: 0x83}, + {value: 0x1d99, lo: 0x84, hi: 0x85}, + {value: 0x1da1, lo: 0x86, hi: 0x87}, + {value: 0x1da9, lo: 0x88, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x1de9, lo: 0x92, hi: 0x97}, + {value: 0x1e11, lo: 0x98, hi: 0x9c}, + {value: 0x1e31, lo: 0x9d, hi: 0xb3}, + {value: 0x1d71, lo: 0xb4, hi: 0xb4}, + {value: 0x1d81, lo: 0xb5, hi: 0xb5}, + {value: 0x1ee9, lo: 0xb6, hi: 0xbb}, + {value: 0x1f09, lo: 0xbc, hi: 0xbc}, + {value: 0x1ef9, lo: 0xbd, hi: 0xbd}, + {value: 0x1f19, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x420 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x0008, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x85, offset 0x42a + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x86, offset 0x42f + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x87, offset 0x432 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x88, offset 0x438 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x89, offset 0x43f + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x444 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8b, offset 0x448 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x8c, offset 0x44e + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xbf}, + // Block 0x8d, offset 0x453 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x8e, offset 0x45c + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8f, offset 0x461 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0x90, offset 0x467 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x97}, + {value: 0x8b0d, lo: 0x98, hi: 0x9f}, + {value: 0x8b25, lo: 0xa0, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xbf}, + // Block 0x91, offset 0x46e + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x8b25, lo: 0xb0, hi: 0xb7}, + {value: 0x8b0d, lo: 0xb8, hi: 0xbf}, + // Block 0x92, offset 0x475 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x93, offset 0x47c + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x94, offset 0x480 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x95, offset 0x483 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xbf}, + // Block 0x96, offset 0x488 + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0808, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0808, lo: 0x8a, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb6}, + {value: 0x0808, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbb}, + {value: 0x0808, lo: 0xbc, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x0808, lo: 0xbf, hi: 0xbf}, + // Block 0x97, offset 0x494 + {value: 0x0000, lo: 0x05}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0818, lo: 0x97, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb6}, + {value: 0x0818, lo: 0xb7, hi: 0xbf}, + // Block 0x98, offset 0x49a + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa6}, + {value: 0x0818, lo: 0xa7, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x99, offset 0x49f + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb3}, + {value: 0x0808, lo: 0xb4, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xba}, + {value: 0x0818, lo: 0xbb, hi: 0xbf}, + // Block 0x9a, offset 0x4a6 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0818, lo: 0x96, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0818, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x4ae + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbb}, + {value: 0x0818, lo: 0xbc, hi: 0xbd}, + {value: 0x0808, lo: 0xbe, hi: 0xbf}, + // Block 0x9c, offset 0x4b3 + {value: 0x0000, lo: 0x03}, + {value: 0x0818, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x0818, lo: 0x92, hi: 0xbf}, + // Block 0x9d, offset 0x4b7 + {value: 0x0000, lo: 0x0f}, + {value: 0x0808, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8b}, + {value: 0x3308, lo: 0x8c, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x94}, + {value: 0x0808, lo: 0x95, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x98}, + {value: 0x0808, lo: 0x99, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x4c7 + {value: 0x0000, lo: 0x06}, + {value: 0x0818, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0818, lo: 0x90, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xbc}, + {value: 0x0818, lo: 0xbd, hi: 0xbf}, + // Block 0x9f, offset 0x4ce + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0x9c}, + {value: 0x0818, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xa0, offset 0x4d2 + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xbf}, + // Block 0xa1, offset 0x4d6 + {value: 0x0000, lo: 0x06}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0818, lo: 0x98, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb7}, + {value: 0x0818, lo: 0xb8, hi: 0xbf}, + // Block 0xa2, offset 0x4dd + {value: 0x0000, lo: 0x01}, + {value: 0x0808, lo: 0x80, hi: 0xbf}, + // Block 0xa3, offset 0x4df + {value: 0x0000, lo: 0x02}, + {value: 0x0808, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xa4, offset 0x4e2 + {value: 0x0000, lo: 0x02}, + {value: 0x03dd, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xa5, offset 0x4e5 + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb9}, + {value: 0x0818, lo: 0xba, hi: 0xbf}, + // Block 0xa6, offset 0x4e9 + {value: 0x0000, lo: 0x08}, + {value: 0x0908, lo: 0x80, hi: 0x80}, + {value: 0x0a08, lo: 0x81, hi: 0xa1}, + {value: 0x0c08, lo: 0xa2, hi: 0xa2}, + {value: 0x0a08, lo: 0xa3, hi: 0xa3}, + {value: 0x3308, lo: 0xa4, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0808, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xa7, offset 0x4f2 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0818, lo: 0xa0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xa8, offset 0x4f6 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xac}, + {value: 0x0818, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0808, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xa9, offset 0x4fe + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbf}, + // Block 0xaa, offset 0x501 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0x9c}, + {value: 0x0818, lo: 0x9d, hi: 0xa6}, + {value: 0x0808, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb2}, + {value: 0x0c08, lo: 0xb3, hi: 0xb3}, + {value: 0x0a08, lo: 0xb4, hi: 0xbf}, + // Block 0xab, offset 0x509 + {value: 0x0000, lo: 0x0a}, + {value: 0x0a08, lo: 0x80, hi: 0x84}, + {value: 0x0808, lo: 0x85, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x90}, + {value: 0x0a18, lo: 0x91, hi: 0x93}, + {value: 0x0c18, lo: 0x94, hi: 0x94}, + {value: 0x0818, lo: 0x95, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb3}, + {value: 0x0c08, lo: 0xb4, hi: 0xb5}, + {value: 0x0a08, lo: 0xb6, hi: 0xbf}, + // Block 0xac, offset 0x514 + {value: 0x0000, lo: 0x0e}, + {value: 0x0a08, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x85}, + {value: 0x0818, lo: 0x86, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb0}, + {value: 0x0808, lo: 0xb1, hi: 0xb1}, + {value: 0x0a08, lo: 0xb2, hi: 0xb3}, + {value: 0x0c08, lo: 0xb4, hi: 0xb6}, + {value: 0x0808, lo: 0xb7, hi: 0xb7}, + {value: 0x0a08, lo: 0xb8, hi: 0xb8}, + {value: 0x0c08, lo: 0xb9, hi: 0xba}, + {value: 0x0a08, lo: 0xbb, hi: 0xbc}, + {value: 0x0c08, lo: 0xbd, hi: 0xbd}, + {value: 0x0a08, lo: 0xbe, hi: 0xbf}, + // Block 0xad, offset 0x523 + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x80}, + {value: 0x0a08, lo: 0x81, hi: 0x81}, + {value: 0x0c08, lo: 0x82, hi: 0x83}, + {value: 0x0a08, lo: 0x84, hi: 0x84}, + {value: 0x0818, lo: 0x85, hi: 0x88}, + {value: 0x0c18, lo: 0x89, hi: 0x89}, + {value: 0x0a18, lo: 0x8a, hi: 0x8a}, + {value: 0x0918, lo: 0x8b, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xae, offset 0x52f + {value: 0x0000, lo: 0x05}, + {value: 0x3008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbf}, + // Block 0xaf, offset 0x535 + {value: 0x0000, lo: 0x0c}, + {value: 0x3308, lo: 0x80, hi: 0x85}, + {value: 0x3b08, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x91}, + {value: 0x0018, lo: 0x92, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x3b08, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xb0, offset 0x542 + {value: 0x0000, lo: 0x0b}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb6}, + {value: 0x3008, lo: 0xb7, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0xb1, offset 0x54e + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xb2, offset 0x556 + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xb2}, + {value: 0x3b08, lo: 0xb3, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xbf}, + // Block 0xb3, offset 0x55f + {value: 0x0000, lo: 0x0a}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x3008, lo: 0x85, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xb4, offset 0x56a + {value: 0x0000, lo: 0x06}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xbe}, + {value: 0x3008, lo: 0xbf, hi: 0xbf}, + // Block 0xb5, offset 0x571 + {value: 0x0000, lo: 0x0e}, + {value: 0x3808, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x3308, lo: 0x89, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8d}, + {value: 0x3008, lo: 0x8e, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xb6, offset 0x580 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb1}, + {value: 0x3008, lo: 0xb2, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x3808, lo: 0xb5, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x58d + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0xbf}, + // Block 0xb8, offset 0x591 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xb9, offset 0x59e + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x3308, lo: 0x9f, hi: 0x9f}, + {value: 0x3008, lo: 0xa0, hi: 0xa2}, + {value: 0x3308, lo: 0xa3, hi: 0xa9}, + {value: 0x3b08, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xba, offset 0x5a7 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbf}, + // Block 0xbb, offset 0x5ab + {value: 0x0000, lo: 0x0e}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x84}, + {value: 0x3008, lo: 0x85, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9d}, + {value: 0x3308, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xbf}, + // Block 0xbc, offset 0x5ba + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb8}, + {value: 0x3008, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0xbd, offset 0x5c2 + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x85}, + {value: 0x0018, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xbe, offset 0x5cd + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xbf, offset 0x5d6 + {value: 0x0000, lo: 0x05}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9b}, + {value: 0x3308, lo: 0x9c, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0xc0, offset 0x5dc + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xc1, offset 0x5e4 + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xc2, offset 0x5ed + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb5}, + {value: 0x3808, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xc3, offset 0x5f9 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xc4, offset 0x5fc + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9f}, + {value: 0x3008, lo: 0xa0, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xaa}, + {value: 0x3b08, lo: 0xab, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbf}, + // Block 0xc5, offset 0x608 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0xbf}, + // Block 0xc6, offset 0x60b + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0xc7, offset 0x614 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xbf}, + // Block 0xc8, offset 0x617 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x61c + {value: 0x0000, lo: 0x08}, + {value: 0x3008, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xca, offset 0x625 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xbf}, + // Block 0xcb, offset 0x62a + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x3008, lo: 0x91, hi: 0x93}, + {value: 0x3308, lo: 0x94, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x99}, + {value: 0x3308, lo: 0x9a, hi: 0x9b}, + {value: 0x3008, lo: 0x9c, hi: 0x9f}, + {value: 0x3b08, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x0018, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xa3}, + {value: 0x3008, lo: 0xa4, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xbf}, + // Block 0xcc, offset 0x637 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x3b08, lo: 0xb4, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb8}, + {value: 0x3008, lo: 0xb9, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x3308, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0xcd, offset 0x642 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x3b08, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x3308, lo: 0x91, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x98}, + {value: 0x3308, lo: 0x99, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0xbf}, + // Block 0xce, offset 0x64b + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x3308, lo: 0x8a, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x98}, + {value: 0x3b08, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xa2}, + {value: 0x0040, lo: 0xa3, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xcf, offset 0x656 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xd0, offset 0x659 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xd1, offset 0x65c + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xd2, offset 0x666 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xbf}, + // Block 0xd3, offset 0x66f + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xa9}, + {value: 0x3308, lo: 0xaa, hi: 0xb0}, + {value: 0x3008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xd4, offset 0x67b + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x688 + {value: 0x0000, lo: 0x0c}, + {value: 0x3308, lo: 0x80, hi: 0x83}, + {value: 0x3b08, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xbf}, + // Block 0xd6, offset 0x695 + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x3008, lo: 0x8a, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x3008, lo: 0x93, hi: 0x94}, + {value: 0x3308, lo: 0x95, hi: 0x95}, + {value: 0x3008, lo: 0x96, hi: 0x96}, + {value: 0x3b08, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xbf}, + // Block 0xd7, offset 0x6a3 + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xd8, offset 0x6aa + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0xd9, offset 0x6b5 + {value: 0x0000, lo: 0x06}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3808, lo: 0x81, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xda, offset 0x6bc + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0xdb, offset 0x6c0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x6c4 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xdd, offset 0x6c7 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xde, offset 0x6cc + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xdf, offset 0x6cf + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbf}, + // Block 0xe0, offset 0x6d2 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xe1, offset 0x6d6 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0340, lo: 0xb0, hi: 0xbf}, + // Block 0xe2, offset 0x6d9 + {value: 0x0000, lo: 0x04}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0xe3, offset 0x6de + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xe4, offset 0x6e5 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x6e8 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xe6, offset 0x6f0 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0xe7, offset 0x6f4 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0xe8, offset 0x6ff + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0xe9, offset 0x702 + {value: 0x0000, lo: 0x02}, + {value: 0xe105, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0xea, offset 0x705 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0xeb, offset 0x708 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x3008, lo: 0x91, hi: 0xbf}, + // Block 0xec, offset 0x70e + {value: 0x0000, lo: 0x05}, + {value: 0x3008, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xed, offset 0x714 + {value: 0x0000, lo: 0x08}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa1}, + {value: 0x0018, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xa3}, + {value: 0x3308, lo: 0xa4, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xee, offset 0x71d + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0xef, offset 0x720 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0xf0, offset 0x723 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xf1, offset 0x726 + {value: 0x0000, lo: 0x07}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xf2, offset 0x72e + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x0040, lo: 0xa3, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xf3, offset 0x733 + {value: 0x0000, lo: 0x08}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x94}, + {value: 0x0008, lo: 0x95, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xa3}, + {value: 0x0008, lo: 0xa4, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xf4, offset 0x73c + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0xf5, offset 0x73f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0xf6, offset 0x744 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x03c0, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xbf}, + // Block 0xf7, offset 0x74e + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xbf}, + // Block 0xf8, offset 0x752 + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0xf9, offset 0x756 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xfa, offset 0x759 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xfb, offset 0x75c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xbf}, + // Block 0xfc, offset 0x760 + {value: 0x0000, lo: 0x0e}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0x2379, lo: 0x9e, hi: 0x9e}, + {value: 0x2381, lo: 0x9f, hi: 0x9f}, + {value: 0x2389, lo: 0xa0, hi: 0xa0}, + {value: 0x2391, lo: 0xa1, hi: 0xa1}, + {value: 0x2399, lo: 0xa2, hi: 0xa2}, + {value: 0x23a1, lo: 0xa3, hi: 0xa3}, + {value: 0x23a9, lo: 0xa4, hi: 0xa4}, + {value: 0x3018, lo: 0xa5, hi: 0xa6}, + {value: 0x3318, lo: 0xa7, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xac}, + {value: 0x3018, lo: 0xad, hi: 0xb2}, + {value: 0x0340, lo: 0xb3, hi: 0xba}, + {value: 0x3318, lo: 0xbb, hi: 0xbf}, + // Block 0xfd, offset 0x76f + {value: 0x0000, lo: 0x0b}, + {value: 0x3318, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x84}, + {value: 0x3318, lo: 0x85, hi: 0x8b}, + {value: 0x0018, lo: 0x8c, hi: 0xa9}, + {value: 0x3318, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xba}, + {value: 0x23b1, lo: 0xbb, hi: 0xbb}, + {value: 0x23b9, lo: 0xbc, hi: 0xbc}, + {value: 0x23c1, lo: 0xbd, hi: 0xbd}, + {value: 0x23c9, lo: 0xbe, hi: 0xbe}, + {value: 0x23d1, lo: 0xbf, hi: 0xbf}, + // Block 0xfe, offset 0x77b + {value: 0x0000, lo: 0x03}, + {value: 0x23d9, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0xff, offset 0x77f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x3318, lo: 0x82, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0xbf}, + // Block 0x100, offset 0x784 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x101, offset 0x789 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x102, offset 0x78e + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xba}, + {value: 0x3308, lo: 0xbb, hi: 0xbf}, + // Block 0x103, offset 0x792 + {value: 0x0000, lo: 0x04}, + {value: 0x3308, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x104, offset 0x797 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x3308, lo: 0xa1, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x105, offset 0x7a0 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0x106, offset 0x7a5 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0x107, offset 0x7a9 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0008, lo: 0xb7, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x108, offset 0x7af + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0x109, offset 0x7b5 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x3308, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xbf}, + // Block 0x10a, offset 0x7ba + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x10b, offset 0x7c0 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x10c, offset 0x7c6 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x10d, offset 0x7d0 + {value: 0x0000, lo: 0x05}, + {value: 0x0808, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x86}, + {value: 0x0818, lo: 0x87, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0xbf}, + // Block 0x10e, offset 0x7d6 + {value: 0x0000, lo: 0x08}, + {value: 0x0a08, lo: 0x80, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x8a}, + {value: 0x0b08, lo: 0x8b, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0818, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x10f, offset 0x7df + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xb0}, + {value: 0x0818, lo: 0xb1, hi: 0xbf}, + // Block 0x110, offset 0x7e2 + {value: 0x0000, lo: 0x02}, + {value: 0x0818, lo: 0x80, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x111, offset 0x7e5 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0818, lo: 0x81, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x112, offset 0x7e9 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0x113, offset 0x7ed + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x114, offset 0x7f1 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x115, offset 0x7f7 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x116, offset 0x7fd + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x8f}, + {value: 0x2709, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xbf}, + // Block 0x117, offset 0x802 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xbf}, + // Block 0x118, offset 0x805 + {value: 0x0000, lo: 0x0f}, + {value: 0x2889, lo: 0x80, hi: 0x80}, + {value: 0x2891, lo: 0x81, hi: 0x81}, + {value: 0x2899, lo: 0x82, hi: 0x82}, + {value: 0x28a1, lo: 0x83, hi: 0x83}, + {value: 0x28a9, lo: 0x84, hi: 0x84}, + {value: 0x28b1, lo: 0x85, hi: 0x85}, + {value: 0x28b9, lo: 0x86, hi: 0x86}, + {value: 0x28c1, lo: 0x87, hi: 0x87}, + {value: 0x28c9, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x28d1, lo: 0x90, hi: 0x90}, + {value: 0x28d9, lo: 0x91, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xbf}, + // Block 0x119, offset 0x815 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x11a, offset 0x81c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x11b, offset 0x820 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x11c, offset 0x827 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x11d, offset 0x82b + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x11e, offset 0x831 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0x11f, offset 0x838 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x120, offset 0x83f + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x121, offset 0x845 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x122, offset 0x84e + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0xbf}, + // Block 0x123, offset 0x852 + {value: 0x0000, lo: 0x0d}, + {value: 0x0018, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0xaf}, + {value: 0x06e1, lo: 0xb0, hi: 0xb0}, + {value: 0x0049, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb2, hi: 0xb2}, + {value: 0x0031, lo: 0xb3, hi: 0xb3}, + {value: 0x06e9, lo: 0xb4, hi: 0xb4}, + {value: 0x06f1, lo: 0xb5, hi: 0xb5}, + {value: 0x06f9, lo: 0xb6, hi: 0xb6}, + {value: 0x0701, lo: 0xb7, hi: 0xb7}, + {value: 0x0709, lo: 0xb8, hi: 0xb8}, + {value: 0x0711, lo: 0xb9, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x124, offset 0x860 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x125, offset 0x863 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x126, offset 0x866 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x127, offset 0x86a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x128, offset 0x86e + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x129, offset 0x871 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbf}, + // Block 0x12a, offset 0x875 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x12b, offset 0x878 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0340, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0x9f}, + {value: 0x0340, lo: 0xa0, hi: 0xbf}, + // Block 0x12c, offset 0x87d + {value: 0x0000, lo: 0x01}, + {value: 0x0340, lo: 0x80, hi: 0xbf}, + // Block 0x12d, offset 0x87f + {value: 0x0000, lo: 0x01}, + {value: 0x33c0, lo: 0x80, hi: 0xbf}, + // Block 0x12e, offset 0x881 + {value: 0x0000, lo: 0x02}, + {value: 0x33c0, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, +} + +// Total table size 46723 bytes (45KiB); checksum: 4CF3143A diff --git a/vendor/golang.org/x/net/idna/trie.go b/vendor/golang.org/x/net/idna/trie.go index c4ef847e7a..4212741728 100644 --- a/vendor/golang.org/x/net/idna/trie.go +++ b/vendor/golang.org/x/net/idna/trie.go @@ -6,27 +6,6 @@ package idna -// appendMapping appends the mapping for the respective rune. isMapped must be -// true. A mapping is a categorization of a rune as defined in UTS #46. -func (c info) appendMapping(b []byte, s string) []byte { - index := int(c >> indexShift) - if c&xorBit == 0 { - s := mappings[index:] - return append(b, s[1:s[0]+1]...) - } - b = append(b, s...) - if c&inlineXOR == inlineXOR { - // TODO: support and handle two-byte inline masks - b[len(b)-1] ^= byte(index) - } else { - for p := len(b) - int(xorData[index]); p < len(b); p++ { - index++ - b[p] ^= xorData[index] - } - } - return b -} - // Sparse block handling code. type valueRange struct { diff --git a/vendor/golang.org/x/net/idna/trie12.0.0.go b/vendor/golang.org/x/net/idna/trie12.0.0.go new file mode 100644 index 0000000000..bb63f904b3 --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie12.0.0.go @@ -0,0 +1,31 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.16 +// +build !go1.16 + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + s := mappings[index:] + return append(b, s[1:s[0]+1]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} diff --git a/vendor/golang.org/x/net/idna/trie13.0.0.go b/vendor/golang.org/x/net/idna/trie13.0.0.go new file mode 100644 index 0000000000..7d68a8dc13 --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie13.0.0.go @@ -0,0 +1,31 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.16 +// +build go1.16 + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + p := index + return append(b, mappings[mappingIndex[p]:mappingIndex[p+1]]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} diff --git a/vendor/golang.org/x/net/internal/socks/socks.go b/vendor/golang.org/x/net/internal/socks/socks.go index 97db2340ec..84fcc32b63 100644 --- a/vendor/golang.org/x/net/internal/socks/socks.go +++ b/vendor/golang.org/x/net/internal/socks/socks.go @@ -289,7 +289,7 @@ func (up *UsernamePassword) Authenticate(ctx context.Context, rw io.ReadWriter, case AuthMethodNotRequired: return nil case AuthMethodUsernamePassword: - if len(up.Username) == 0 || len(up.Username) > 255 || len(up.Password) == 0 || len(up.Password) > 255 { + if len(up.Username) == 0 || len(up.Username) > 255 || len(up.Password) > 255 { return errors.New("invalid username/password") } b := []byte{authUsernamePasswordVersion} diff --git a/vendor/golang.org/x/sys/cpu/endian_little.go b/vendor/golang.org/x/sys/cpu/endian_little.go index fe545966b6..55db853efb 100644 --- a/vendor/golang.org/x/sys/cpu/endian_little.go +++ b/vendor/golang.org/x/sys/cpu/endian_little.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh +//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh || wasm +// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh wasm package cpu diff --git a/vendor/golang.org/x/sys/unix/ioctl_signed.go b/vendor/golang.org/x/sys/unix/ioctl_signed.go new file mode 100644 index 0000000000..7def9580e6 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ioctl_signed.go @@ -0,0 +1,70 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || solaris +// +build aix solaris + +package unix + +import ( + "unsafe" +) + +// ioctl itself should not be exposed directly, but additional get/set +// functions for specific types are permissible. + +// IoctlSetInt performs an ioctl operation which sets an integer value +// on fd, using the specified request number. +func IoctlSetInt(fd int, req int, value int) error { + return ioctl(fd, req, uintptr(value)) +} + +// IoctlSetPointerInt performs an ioctl operation which sets an +// integer value on fd, using the specified request number. The ioctl +// argument is called with a pointer to the integer value, rather than +// passing the integer value directly. +func IoctlSetPointerInt(fd int, req int, value int) error { + v := int32(value) + return ioctlPtr(fd, req, unsafe.Pointer(&v)) +} + +// IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. +// +// To change fd's window size, the req argument should be TIOCSWINSZ. +func IoctlSetWinsize(fd int, req int, value *Winsize) error { + // TODO: if we get the chance, remove the req parameter and + // hardcode TIOCSWINSZ. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlSetTermios performs an ioctl on fd with a *Termios. +// +// The req value will usually be TCSETA or TIOCSETA. +func IoctlSetTermios(fd int, req int, value *Termios) error { + // TODO: if we get the chance, remove the req parameter. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlGetInt performs an ioctl operation which gets an integer value +// from fd, using the specified request number. +// +// A few ioctl requests use the return value as an output parameter; +// for those, IoctlRetInt should be used instead of this function. +func IoctlGetInt(fd int, req int) (int, error) { + var value int + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return value, err +} + +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { + var value Winsize + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} + +func IoctlGetTermios(fd int, req int) (*Termios, error) { + var value Termios + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} diff --git a/vendor/golang.org/x/sys/unix/ioctl.go b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go similarity index 92% rename from vendor/golang.org/x/sys/unix/ioctl.go rename to vendor/golang.org/x/sys/unix/ioctl_unsigned.go index 7ce8dd406f..649913d1ea 100644 --- a/vendor/golang.org/x/sys/unix/ioctl.go +++ b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd hurd linux netbsd openbsd solaris +//go:build darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd +// +build darwin dragonfly freebsd hurd linux netbsd openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_zos.go b/vendor/golang.org/x/sys/unix/ioctl_zos.go index 6532f09af2..cdc21bf76d 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_zos.go +++ b/vendor/golang.org/x/sys/unix/ioctl_zos.go @@ -17,14 +17,14 @@ import ( // IoctlSetInt performs an ioctl operation which sets an integer value // on fd, using the specified request number. -func IoctlSetInt(fd int, req uint, value int) error { +func IoctlSetInt(fd int, req int, value int) error { return ioctl(fd, req, uintptr(value)) } // IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. // // To change fd's window size, the req argument should be TIOCSWINSZ. -func IoctlSetWinsize(fd int, req uint, value *Winsize) error { +func IoctlSetWinsize(fd int, req int, value *Winsize) error { // TODO: if we get the chance, remove the req parameter and // hardcode TIOCSWINSZ. return ioctlPtr(fd, req, unsafe.Pointer(value)) @@ -33,7 +33,7 @@ func IoctlSetWinsize(fd int, req uint, value *Winsize) error { // IoctlSetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCSETS, TCSETSW, or TCSETSF -func IoctlSetTermios(fd int, req uint, value *Termios) error { +func IoctlSetTermios(fd int, req int, value *Termios) error { if (req != TCSETS) && (req != TCSETSW) && (req != TCSETSF) { return ENOSYS } @@ -47,13 +47,13 @@ func IoctlSetTermios(fd int, req uint, value *Termios) error { // // A few ioctl requests use the return value as an output parameter; // for those, IoctlRetInt should be used instead of this function. -func IoctlGetInt(fd int, req uint) (int, error) { +func IoctlGetInt(fd int, req int) (int, error) { var value int err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return value, err } -func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { var value Winsize err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err @@ -62,7 +62,7 @@ func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { // IoctlGetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCGETS -func IoctlGetTermios(fd int, req uint) (*Termios, error) { +func IoctlGetTermios(fd int, req int) (*Termios, error) { var value Termios if req != TCGETS { return &value, ENOSYS diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c368..e6f31d374d 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index 7456d9ddde..8f775fafa6 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -66,6 +66,7 @@ includes_Darwin=' #include #include #include +#include #include #include #include @@ -203,6 +204,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -517,10 +519,11 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT)_/ || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || + $2 ~ /^[US]F_/ || $2 ~ /^TP_STATUS_/ || $2 ~ /^FALLOC_/ || $2 ~ /^ICMPV?6?_(FILTER|SEC)/ || @@ -621,7 +624,7 @@ ccflags="$@" $2 ~ /^MEM/ || $2 ~ /^WG/ || $2 ~ /^FIB_RULE_/ || - $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} + $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} @@ -738,7 +741,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -757,7 +761,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go new file mode 100644 index 0000000000..ca0513632e --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -0,0 +1,14 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris +// +build aix darwin dragonfly freebsd openbsd solaris + +package unix + +var mapper = &mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, +} diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 0000000000..fa93d0aa90 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,53 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux || netbsd +// +build linux netbsd + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&mremapDontunmap == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} + +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index d9f5544ccf..9a6e5acacb 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -408,8 +408,8 @@ func (w WaitStatus) CoreDump() bool { return w&0x80 == 0x80 } func (w WaitStatus) TrapCause() int { return -1 } -//sys ioctl(fd int, req uint, arg uintptr) (err error) -//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = ioctl +//sys ioctl(fd int, req int, arg uintptr) (err error) +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = ioctl // fcntl must never be called with cmd=F_DUP2FD because it doesn't work on AIX // There is no way to create a custom fcntl and to keep //sys fcntl easily, @@ -535,21 +535,6 @@ func Fsync(fd int) error { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go index e92a0be163..f2871fa953 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go @@ -8,7 +8,6 @@ package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) = getrlimit64 -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) = setrlimit64 //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek64 //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go index 16eed17098..75718ec0f1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go @@ -8,7 +8,6 @@ package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) = mmap64 diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 7705c3270b..4217de518b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -601,20 +601,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { // Gethostuuid(uuid *byte, timeout *Timespec) (err error) // Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, behav int) (err error) //sys Mlock(b []byte) (err error) //sys Mlockall(flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 7064d6ebab..135cc3cd75 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -510,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { return nil, err } - // Find size. - n := uintptr(0) - if err := sysctl(mib, nil, &n, nil, 0); err != nil { - return nil, err - } - if n == 0 { - return nil, nil - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + for { + // Find size. + n := uintptr(0) + if err := sysctl(mib, nil, &n, nil, 0); err != nil { + return nil, err + } + if n == 0 { + return nil, nil + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // Read into buffer of that size. - buf := make([]KinfoProc, n/SizeofKinfoProc) - if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { - return nil, err - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + // Read into buffer of that size. + buf := make([]KinfoProc, n/SizeofKinfoProc) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { + if err == ENOMEM { + // Process table grew. Try again. + continue + } + return nil, err + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // The actual call may return less than the original reported required - // size so ensure we deal with that. - return buf[:n/SizeofKinfoProc], nil + // The actual call may return less than the original reported required + // size so ensure we deal with that. + return buf[:n/SizeofKinfoProc], nil + } } //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) @@ -613,6 +619,7 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Rmdir(path string) (err error) //sys Seek(fd int, offset int64, whence int) (newoffset int64, err error) = SYS_LSEEK //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) +//sys Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) //sys Setegid(egid int) (err error) //sysnb Seteuid(euid int) (err error) //sysnb Setgid(gid int) (err error) @@ -622,7 +629,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Setprivexec(flag int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -676,7 +682,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { // Kqueue_from_portset_np // Kqueue_portset // Getattrlist -// Setattrlist // Getdirentriesattr // Searchfs // Delete diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go index 221efc26bc..d4ce988e72 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go @@ -326,7 +326,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go index 5bdde03e4a..afb10106f6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -433,7 +433,6 @@ func Dup3(oldfd, newfd, flags int) error { //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index 9735331530..a730878e49 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1873,9 +1884,8 @@ func Getpgrp() (pid int) { //sys OpenTree(dfd int, fileName string, flags uint) (r int, err error) //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT -//sysnb Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) = SYS_PRLIMIT64 //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) -//sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 +//sys pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Removexattr(path string, attr string) (err error) //sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) @@ -1887,6 +1897,15 @@ func Getpgrp() (pid int) { //sysnb Settimeofday(tv *Timeval) (err error) //sys Setns(fd int, nstype int) (err error) +//go:linkname syscall_prlimit syscall.prlimit +func syscall_prlimit(pid, resource int, newlimit, old *syscall.Rlimit) error + +func Prlimit(pid, resource int, newlimit, old *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall_prlimit(pid, resource, (*syscall.Rlimit)(newlimit), (*syscall.Rlimit)(old)) +} + // PrctlRetInt performs a prctl operation specified by option and further // optional arguments arg2 through arg5 depending on option. It returns a // non-negative integer that is returned by the prctl syscall. @@ -2105,21 +2124,7 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2128,6 +2133,12 @@ func Munmap(b []byte) (err error) { //sys Munlock(b []byte) (err error) //sys Munlockall() (err error) +const ( + mremapFixed = MREMAP_FIXED + mremapDontunmap = MREMAP_DONTUNMAP + mremapMaymove = MREMAP_MAYMOVE +) + // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd, // using the specified flags. func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) { @@ -2412,6 +2423,54 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + +// Pselect is a wrapper around the Linux pselect6 system call. +// This version does not modify the timeout argument. +func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + // Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES, + // The Linux pselect6() system call modifies its timeout argument. + // [Not modifying the argument] is the behavior required by POSIX.1-2001. + var mutableTimeout *Timespec + if timeout != nil { + mutableTimeout = new(Timespec) + *mutableTimeout = *timeout + } + + // The final argument of the pselect6() system call is not a + // sigset_t * pointer, but is instead a structure + var kernelMask *sigset_argpack + if sigmask != nil { + wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize + + // A sigset stores one bit per signal, + // offset by 1 (because signal 0 does not exist). + // So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉. + sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits) + + sigsetBytes := uintptr(sigsetWords * (wordBits / 8)) + kernelMask = &sigset_argpack{ + ss: sigmask, + ssLen: sigsetBytes, + } + } + + return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) +} + /* * Unimplemented */ @@ -2453,7 +2512,6 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { // MqTimedreceive // MqTimedsend // MqUnlink -// Mremap // Msgctl // Msgget // Msgrcv diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go index ff5b5899d6..c7d9945ea1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go @@ -97,33 +97,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { newoffset, errno := seek(fd, offset, whence) if errno != 0 { diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 9b27035329..70601ce369 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -40,13 +40,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go index 856ad1d635..da2986415a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go @@ -171,33 +171,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint64 { return uint64(r.Uregs[15]) } func (r *PtraceRegs) SetPC(pc uint64) { r.Uregs[15] = uint32(pc) } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index 6422704bc5..f5266689af 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -33,13 +33,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) @@ -143,15 +142,6 @@ func Getrlimit(resource int, rlim *Rlimit) error { return getrlimit(resource, rlim) } -// Setrlimit prefers the prlimit64 system call. See issue 38604. -func Setrlimit(resource int, rlim *Rlimit) error { - err := Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - return setrlimit(resource, rlim) -} - func (r *PtraceRegs) PC() uint64 { return r.Pc } func (r *PtraceRegs) SetPC(pc uint64) { r.Pc = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 59dab510e9..f6ab02ec15 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -28,7 +28,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) @@ -126,11 +126,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - return -} - func futimesat(dirfd int, path string, tv *[2]Timeval) (err error) { if tv == nil { return utimensat(dirfd, path, nil, 0) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index bfef09a39e..93fe59d25d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -31,13 +31,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go index ab30250966..aae7f0ffd3 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go @@ -151,33 +151,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint64 { return r.Epc } func (r *PtraceRegs) SetPC(pc uint64) { r.Epc = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go index eac1cf1acc..66eff19a32 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go @@ -159,33 +159,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint32 { return r.Nip } func (r *PtraceRegs) SetPC(pc uint32) { r.Nip = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go index 4df56616b8..806aa2574d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go @@ -34,7 +34,6 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 5f4243dea2..5e6ceee129 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -32,13 +32,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) @@ -178,3 +177,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error } return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) } + +//sys riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) + +func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) { + var setSize uintptr + + if set != nil { + setSize = uintptr(unsafe.Sizeof(*set)) + } + return riscvHWProbe(pairs, setSize, set, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go index d0a7d40668..2f89e8f5de 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go @@ -34,7 +34,6 @@ import ( //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go index f5c793be26..7ca064ae76 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go @@ -31,7 +31,6 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go index e66865dccb..ddd1ac8534 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -340,7 +340,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys Setpriority(which int, who int, prio int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -361,6 +360,18 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) +const ( + mremapFixed = MAP_FIXED + mremapDontunmap = 0 + mremapMaymove = 0 +) + +//sys mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP + +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) { + return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags) +} + /* * Unimplemented */ @@ -501,7 +512,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { // compat_43_osendmsg // compat_43_osethostid // compat_43_osethostname -// compat_43_osetrlimit // compat_43_osigblock // compat_43_osigsetmask // compat_43_osigstack @@ -566,7 +576,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { // mq_timedreceive // mq_timedsend // mq_unlink -// mremap // msgget // msgrcv // msgsnd diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index 5e9de23ae3..c5f166a115 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -151,6 +151,21 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL @@ -294,7 +309,6 @@ func Uname(uname *Utsname) error { //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setrtable(rtable int) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) @@ -339,8 +353,6 @@ func Uname(uname *Utsname) error { // getgid // getitimer // getlogin -// getresgid -// getresuid // getthrid // ktrace // lfs_bmapv diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index d3444b64d6..72d23575fa 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -545,24 +545,24 @@ func Minor(dev uint64) uint32 { * Expose the ioctl function */ -//sys ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) = libc.ioctl -//sys ioctlPtrRet(fd int, req uint, arg unsafe.Pointer) (ret int, err error) = libc.ioctl +//sys ioctlRet(fd int, req int, arg uintptr) (ret int, err error) = libc.ioctl +//sys ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) = libc.ioctl -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { _, err = ioctlRet(fd, req, arg) return err } -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { _, err = ioctlPtrRet(fd, req, arg) return err } -func IoctlSetTermio(fd int, req uint, value *Termio) error { +func IoctlSetTermio(fd int, req int, value *Termio) error { return ioctlPtr(fd, req, unsafe.Pointer(value)) } -func IoctlGetTermio(fd int, req uint) (*Termio, error) { +func IoctlGetTermio(fd int, req int) (*Termio, error) { var value Termio err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err @@ -665,7 +665,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys Setpriority(which int, who int, prio int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Setuid(uid int) (err error) //sys Shutdown(s int, how int) (err error) = libsocket.shutdown @@ -717,20 +716,6 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - // Event Ports type fileObjCookie struct { @@ -1080,11 +1065,11 @@ func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags return retCl, retData, flags, nil } -func IoctlSetIntRetInt(fd int, req uint, arg int) (int, error) { +func IoctlSetIntRetInt(fd int, req int, arg int) (int, error) { return ioctlRet(fd, req, uintptr(arg)) } -func IoctlSetString(fd int, req uint, val string) error { +func IoctlSetString(fd int, req int, val string) error { bs := make([]byte, len(val)+1) copy(bs[:len(bs)-1], val) err := ioctlPtr(fd, req, unsafe.Pointer(&bs[0])) @@ -1120,7 +1105,7 @@ func (l *Lifreq) GetLifruUint() uint { return *(*uint)(unsafe.Pointer(&l.Lifru[0])) } -func IoctlLifreq(fd int, req uint, l *Lifreq) error { +func IoctlLifreq(fd int, req int, l *Lifreq) error { return ioctlPtr(fd, req, unsafe.Pointer(l)) } @@ -1131,6 +1116,6 @@ func (s *Strioctl) SetInt(i int) { s.Dp = (*int8)(unsafe.Pointer(&i)) } -func IoctlSetStrioctlRetInt(fd int, req uint, s *Strioctl) (int, error) { +func IoctlSetStrioctlRetInt(fd int, req int, s *Strioctl) (int, error) { return ioctlPtrRet(fd, req, unsafe.Pointer(s)) } diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 00f0aa3758..8bb30e7ce3 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -147,6 +147,14 @@ func (m *mmapper) Munmap(data []byte) (err error) { return nil } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + func Read(fd int, p []byte) (n int, err error) { n, err = read(fd, p) if raceenabled { @@ -587,3 +595,10 @@ func emptyIovecs(iov []Iovec) bool { } return true } + +// Setrlimit sets a resource limit. +func Setrlimit(resource int, rlim *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall.Setrlimit(resource, (*syscall.Rlimit)(rlim)) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index b295497ae4..44e72edb42 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -212,8 +212,8 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = SYS___SENDMSG_A //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) = SYS_MMAP //sys munmap(addr uintptr, length uintptr) (err error) = SYS_MUNMAP -//sys ioctl(fd int, req uint, arg uintptr) (err error) = SYS_IOCTL -//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL +//sys ioctl(fd int, req int, arg uintptr) (err error) = SYS_IOCTL +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = SYS_IOCTL //sys Access(path string, mode uint32) (err error) = SYS___ACCESS_A //sys Chdir(path string) (err error) = SYS___CHDIR_A @@ -285,25 +285,11 @@ func Close(fd int) (err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - // Dummy function: there are no semantics for Madvise on z/OS func Madvise(b []byte, advice int) (err error) { return } -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go index 476a1c7e77..1430076271 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go @@ -1270,6 +1270,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1553,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go index e36f5178d6..ab044a7427 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go @@ -1270,6 +1270,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1553,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 398c37e52d..3784f402e5 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -493,6 +493,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -826,9 +827,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-07-28)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2f + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1197,6 +1198,7 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 @@ -1233,6 +1235,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1860,6 +1864,7 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 @@ -1875,6 +1880,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1898,6 +1904,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2204,6 +2213,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2221,6 +2231,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2361,6 +2372,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2369,6 +2381,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2389,6 +2403,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2423,6 +2438,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2506,6 +2523,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2536,6 +2554,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -2967,6 +2986,7 @@ const ( SOL_TCP = 0x6 SOL_TIPC = 0x10f SOL_TLS = 0x11a + SOL_UDP = 0x11 SOL_X25 = 0x106 SOL_XDP = 0x11b SOMAXCONN = 0x1000 @@ -3071,7 +3091,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3237,6 +3257,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 @@ -3251,6 +3272,19 @@ const ( TRACEFS_MAGIC = 0x74726163 TS_COMM_LEN = 0x20 UDF_SUPER_MAGIC = 0x15013346 + UDP_CORK = 0x1 + UDP_ENCAP = 0x64 + UDP_ENCAP_ESPINUDP = 0x2 + UDP_ENCAP_ESPINUDP_NON_IKE = 0x1 + UDP_ENCAP_GTP0 = 0x4 + UDP_ENCAP_GTP1U = 0x5 + UDP_ENCAP_L2TPINUDP = 0x3 + UDP_GRO = 0x68 + UDP_NO_CHECK6_RX = 0x66 + UDP_NO_CHECK6_TX = 0x65 + UDP_SEGMENT = 0x67 + UDP_V4_FLOW = 0x2 + UDP_V6_FLOW = 0x6 UMOUNT_NOFOLLOW = 0x8 USBDEVICE_SUPER_MAGIC = 0x9fa2 UTIME_NOW = 0x3fffffff diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index a46df0f1e5..cfb1430018 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 6cd4a3ea9d..df64f2d590 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index c7ebee24df..3025cd5b2d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9d5352c3e4..09e1ffbef9 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -443,6 +452,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -515,6 +525,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index f26a164f4a..a457235407 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 890bc3c9b7..fee7dfb819 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 549f26ac64..a5b2373aea 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index e0365e32c1..5dde82c98a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index fdccce15ca..2e80ea6b33 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index b2205c83fa..a65dcd7cbe 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 81aa5ad0f6..cbd34e3d89 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 76807a1fd4..e4afa7a317 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d4a5ab9e4e..44f45a039d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 66e65db951..74733e260f 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f619252691..f5f3934b1a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -30,22 +30,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -329,6 +338,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go index ef9dcd1bef..9a257219d7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go @@ -124,7 +124,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit64(int, uintptr_t); -int setrlimit64(int, uintptr_t); long long lseek64(int, long long, int); uintptr_t mmap(uintptr_t, uintptr_t, int, int, int, long long); @@ -213,7 +212,7 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(arg)) if r0 == -1 && er != nil { err = er @@ -223,7 +222,7 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(uintptr(arg))) if r0 == -1 && er != nil { err = er @@ -1464,16 +1463,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - r0, er := C.setrlimit64(C.int(resource), C.uintptr_t(uintptr(unsafe.Pointer(rlim)))) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, er := C.lseek64(C.int(fd), C.longlong(offset), C.int(whence)) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go index f86a945923..6de80c20cf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go @@ -93,8 +93,8 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { - _, e1 := callioctl(fd, int(req), arg) +func ioctl(fd int, req int, arg uintptr) (err error) { + _, e1 := callioctl(fd, req, arg) if e1 != 0 { err = errnoErr(e1) } @@ -103,8 +103,8 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { - _, e1 := callioctl_ptr(fd, int(req), arg) +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { + _, e1 := callioctl_ptr(fd, req, arg) if e1 != 0 { err = errnoErr(e1) } @@ -1422,16 +1422,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, e1 := callsetrlimit(resource, uintptr(unsafe.Pointer(rlim))) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, e1 := calllseek(fd, offset, whence) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go index d32a84cae2..c4d50ae500 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go @@ -124,7 +124,6 @@ import ( //go:cgo_import_dynamic libc_getsystemcfg getsystemcfg "libc.a/shr_64.o" //go:cgo_import_dynamic libc_umount umount "libc.a/shr_64.o" //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.a/shr_64.o" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.a/shr_64.o" //go:cgo_import_dynamic libc_lseek lseek "libc.a/shr_64.o" //go:cgo_import_dynamic libc_mmap64 mmap64 "libc.a/shr_64.o" @@ -242,7 +241,6 @@ import ( //go:linkname libc_getsystemcfg libc_getsystemcfg //go:linkname libc_umount libc_umount //go:linkname libc_getrlimit libc_getrlimit -//go:linkname libc_setrlimit libc_setrlimit //go:linkname libc_lseek libc_lseek //go:linkname libc_mmap64 libc_mmap64 @@ -363,7 +361,6 @@ var ( libc_getsystemcfg, libc_umount, libc_getrlimit, - libc_setrlimit, libc_lseek, libc_mmap64 syscallFunc ) @@ -1179,13 +1176,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1, _, e1 = rawSyscall6(uintptr(unsafe.Pointer(&libc_setrlimit)), 2, uintptr(resource), rlim, 0, 0, 0, 0) - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_lseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) return diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go index d7d8baf819..6903d3b09e 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go @@ -123,7 +123,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit(int, uintptr_t); -int setrlimit(int, uintptr_t); long long lseek(int, long long, int); uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); @@ -131,6 +130,7 @@ uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); import "C" import ( "syscall" + "unsafe" ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -1055,14 +1055,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1 = uintptr(C.setrlimit(C.int(resource), C.uintptr_t(rlim))) - e1 = syscall.GetErrno() - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1 = uintptr(C.lseek(C.int(fd), C.longlong(offset), C.int(whence))) e1 = syscall.GetErrno() diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index a29ffdd566..4037ccf7a9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -1992,6 +1992,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2123,20 +2148,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index 95fe4c0eb9..4baaed0bc1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -705,6 +705,11 @@ TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) @@ -759,12 +764,6 @@ TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 2fd4590bb7..51d6f3fb25 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -1992,6 +1992,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2123,20 +2148,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index efa5b4c987..c3b82c0379 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -705,6 +705,11 @@ TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) @@ -759,12 +764,6 @@ TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go index 3b85134707..0eabac7ade 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go @@ -1410,16 +1410,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go index 1129065624..ee313eb007 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go @@ -1645,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go index 55f5abfe59..4c986e448e 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go @@ -1645,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go index d39651c2b5..555216944a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go @@ -1645,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go index ddb7408680..67a226fbf5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go @@ -1645,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go index 09a53a616c..f0b9ddaaa2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go @@ -1645,16 +1645,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index 430cb24de7..a07321bed9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -1346,16 +1346,6 @@ func PivotRoot(newroot string, putold string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) { - _, _, e1 := RawSyscall6(SYS_PRLIMIT64, uintptr(pid), uintptr(resource), uintptr(unsafe.Pointer(newlimit)), uintptr(unsafe.Pointer(old)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) { _, _, e1 := Syscall6(SYS_PRCTL, uintptr(option), uintptr(arg2), uintptr(arg3), uintptr(arg4), uintptr(arg5), 0) if e1 != 0 { @@ -1366,7 +1356,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { +func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) { r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask))) n = int(r0) if e1 != 0 { @@ -1878,6 +1868,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2182,3 +2183,17 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index c81b0ad477..07b549cc25 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -411,16 +411,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func futimesat(dirfd int, path string, times *[2]Timeval) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index 2206bce7f4..5f481bf83f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -334,16 +334,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index edf6b39f16..824cd52c7f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -578,16 +578,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func armSyncFileRange(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_ARM_SYNC_FILE_RANGE, uintptr(fd), uintptr(flags), uintptr(off), uintptr(off>>32), uintptr(n), uintptr(n>>32)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index 190609f214..e77aecfe98 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -289,16 +289,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index 5f984cbb1c..961a3afb7b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -644,16 +644,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index 46fc380a40..ed05005e91 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -278,16 +278,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index cbd0d4dadb..d365b718f3 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -278,16 +278,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index 0c13d15f07..c3f1b8bbde 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -644,16 +644,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index e01432aed5..a6574cf98b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -624,16 +624,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func syncFileRange2(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_SYNC_FILE_RANGE2, uintptr(fd), uintptr(flags), uintptr(off>>32), uintptr(off), uintptr(n>>32), uintptr(n)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index 13c7ee7baf..f40990264f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -349,16 +349,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index 02d0c0fd61..9dfcc29974 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -349,16 +349,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 9fee3b1d23..0ab4f2ed72 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -269,16 +269,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { @@ -541,3 +531,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) { + var _p0 unsafe.Pointer + if len(pairs) > 0 { + _p0 = unsafe.Pointer(&pairs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index 647bbfecd6..6cde32237d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -319,16 +319,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) { r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) n = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index ada057f891..5253d65bf1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -329,16 +329,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index 8e1d9c8f66..35f499b32a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -1607,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1868,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 21c6950400..3cda65b0da 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -1607,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1868,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index 298168f90a..1e1fea902b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -1607,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1868,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 68b8bd492f..3b77da1107 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -1607,16 +1607,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1868,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 0b0f910e1a..9ab9abf721 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1894,20 +1916,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 087444250c..3dcacd30d7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -573,11 +583,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $4 -DATA ·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 48ff5de75b..915761eab7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -1894,20 +1918,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 5782cd1084..2763620b01 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -573,11 +583,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 2452a641da..8e87fdf153 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1894,20 +1916,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index cf310420c9..c922314048 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -573,11 +583,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $4 -DATA ·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 5e35600a60..12a7a2160e 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1894,20 +1916,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index 484bb42e0a..a6bc32c922 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -573,11 +583,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index b04cef1a19..b19e8aa031 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1894,20 +1916,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 55af27263a..b4e7bceabf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -573,11 +583,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 47a07ee0c2..fb99594c93 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1894,20 +1916,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 4028255b0d..ca3f766009 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET @@ -687,12 +699,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - CALL libc_setrlimit(SB) - RET -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_setrtable(SB) RET diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 573378fdb9..32cbbbc52b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1894,20 +1916,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index e1fbd4dfa8..477a7d5b21 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -573,11 +583,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index 4873a1e5d3..609d1c598a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -110,7 +110,6 @@ import ( //go:cgo_import_dynamic libc_setpriority setpriority "libc.so" //go:cgo_import_dynamic libc_setregid setregid "libc.so" //go:cgo_import_dynamic libc_setreuid setreuid "libc.so" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" //go:cgo_import_dynamic libc_setsid setsid "libc.so" //go:cgo_import_dynamic libc_setuid setuid "libc.so" //go:cgo_import_dynamic libc_shutdown shutdown "libsocket.so" @@ -250,7 +249,6 @@ import ( //go:linkname procSetpriority libc_setpriority //go:linkname procSetregid libc_setregid //go:linkname procSetreuid libc_setreuid -//go:linkname procSetrlimit libc_setrlimit //go:linkname procSetsid libc_setsid //go:linkname procSetuid libc_setuid //go:linkname procshutdown libc_shutdown @@ -391,7 +389,6 @@ var ( procSetpriority, procSetregid, procSetreuid, - procSetrlimit, procSetsid, procSetuid, procshutdown, @@ -646,7 +643,7 @@ func __minor(version int, dev uint64) (val uint) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) { +func ioctlRet(fd int, req int, arg uintptr) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { @@ -657,7 +654,7 @@ func ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtrRet(fd int, req uint, arg unsafe.Pointer) (ret int, err error) { +func ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { @@ -1650,16 +1647,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) - if e1 != 0 { - err = e1 - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetsid)), 0, 0, 0, 0, 0, 0, 0) pid = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go index 07bfe2ef9a..c31681743c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go @@ -257,7 +257,7 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) @@ -267,7 +267,7 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3e594a8c09..ef285c567b 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -251,6 +251,8 @@ const ( SYS_ACCEPT4 = 242 SYS_RECVMMSG = 243 SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_RISCV_HWPROBE = 258 + SYS_RISCV_FLUSH_ICACHE = 259 SYS_WAIT4 = 260 SYS_PRLIMIT64 = 261 SYS_FANOTIFY_INIT = 262 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 7ea465204b..e6ed7d637d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -372,6 +372,7 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index e2a64f0991..690cefc3d0 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -151,6 +151,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +620,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index 34aa775219..5bffc10eac 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -151,6 +151,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +620,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727cfe..26ef52aafc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -866,6 +866,11 @@ const ( POLLNVAL = 0x20 ) +type sigset_argpack struct { + ss *Sigset_t + ssLen uintptr +} + type SignalfdSiginfo struct { Signo uint32 Errno int32 @@ -1538,6 +1543,10 @@ const ( IFLA_GRO_MAX_SIZE = 0x3a IFLA_TSO_MAX_SIZE = 0x3b IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1968,7 +1977,7 @@ const ( NFT_MSG_GETFLOWTABLE = 0x17 NFT_MSG_DELFLOWTABLE = 0x18 NFT_MSG_GETRULE_RESET = 0x19 - NFT_MSG_MAX = 0x1a + NFT_MSG_MAX = 0x21 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2555,6 +2564,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2580,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2625,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2636,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2671,7 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2710,12 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2723,9 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2733,6 +2763,7 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2778,7 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2803,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2838,6 +2876,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2889,19 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc ) const ( @@ -3605,7 +3660,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3645,7 +3700,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3749,7 +3804,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3787,14 +3842,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4444,7 +4499,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x141 + NL80211_ATTR_MAX = 0x145 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4673,7 +4728,7 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 @@ -4814,7 +4869,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x98 + NL80211_CMD_MAX = 0x99 NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5795,6 +5850,8 @@ const ( TUN_F_TSO6 = 0x4 TUN_F_TSO_ECN = 0x8 TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 ) const ( @@ -5804,9 +5861,10 @@ const ( ) const ( - VIRTIO_NET_HDR_GSO_NONE = 0x0 - VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 - VIRTIO_NET_HDR_GSO_UDP = 0x3 - VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 - VIRTIO_NET_HDR_GSO_ECN = 0x80 + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 ) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 4ecc1495cd..6d8acbcc57 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -337,6 +337,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 34fddff964..59293c6884 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -350,6 +350,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 3b14a6031f..40cfa38c29 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -328,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 0517651ab3..055bc4216d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -329,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 3b0c518134..f28affbc60 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -330,6 +330,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index fccdf4dd0f..9d71e7ccd8 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 500de8fc07..fd5ccd332a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index d0434cd2c6..7704de77a2 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 84206ba534..df00b87571 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index ab078cf1f5..0942840db6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -340,6 +340,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 42eb2c4cef..0348743950 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 31304a4e8b..bad0670475 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index c311f9612d..83c69c119f 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -357,6 +357,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -716,3 +718,26 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +type RISCVHWProbePairs struct { + Key int64 + Value uint64 +} + +const ( + RISCV_HWPROBE_KEY_MVENDORID = 0x0 + RISCV_HWPROBE_KEY_MARCHID = 0x1 + RISCV_HWPROBE_KEY_MIMPID = 0x2 + RISCV_HWPROBE_KEY_BASE_BEHAVIOR = 0x3 + RISCV_HWPROBE_BASE_BEHAVIOR_IMA = 0x1 + RISCV_HWPROBE_KEY_IMA_EXT_0 = 0x4 + RISCV_HWPROBE_IMA_FD = 0x1 + RISCV_HWPROBE_IMA_C = 0x2 + RISCV_HWPROBE_KEY_CPUPERF_0 = 0x5 + RISCV_HWPROBE_MISALIGNED_UNKNOWN = 0x0 + RISCV_HWPROBE_MISALIGNED_EMULATED = 0x1 + RISCV_HWPROBE_MISALIGNED_SLOW = 0x2 + RISCV_HWPROBE_MISALIGNED_FAST = 0x3 + RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4 + RISCV_HWPROBE_MISALIGNED_MASK = 0x7 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index bba3cefac1..aa268d025c 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -352,6 +352,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ad8a013804..444045b6c5 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -334,6 +334,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/windows/env_windows.go b/vendor/golang.org/x/sys/windows/env_windows.go index 92ac05ff4e..b8ad192506 100644 --- a/vendor/golang.org/x/sys/windows/env_windows.go +++ b/vendor/golang.org/x/sys/windows/env_windows.go @@ -37,14 +37,14 @@ func (token Token) Environ(inheritExisting bool) (env []string, err error) { return nil, err } defer DestroyEnvironmentBlock(block) - blockp := uintptr(unsafe.Pointer(block)) + blockp := unsafe.Pointer(block) for { - entry := UTF16PtrToString((*uint16)(unsafe.Pointer(blockp))) + entry := UTF16PtrToString((*uint16)(blockp)) if len(entry) == 0 { break } env = append(env, entry) - blockp += 2 * (uintptr(len(entry)) + 1) + blockp = unsafe.Add(blockp, 2*(len(entry)+1)) } return env, nil } diff --git a/vendor/golang.org/x/sys/windows/exec_windows.go b/vendor/golang.org/x/sys/windows/exec_windows.go index 75980fd44a..a52e0331d8 100644 --- a/vendor/golang.org/x/sys/windows/exec_windows.go +++ b/vendor/golang.org/x/sys/windows/exec_windows.go @@ -95,12 +95,17 @@ func ComposeCommandLine(args []string) string { // DecomposeCommandLine breaks apart its argument command line into unescaped parts using CommandLineToArgv, // as gathered from GetCommandLine, QUERY_SERVICE_CONFIG's BinaryPathName argument, or elsewhere that // command lines are passed around. +// DecomposeCommandLine returns error if commandLine contains NUL. func DecomposeCommandLine(commandLine string) ([]string, error) { if len(commandLine) == 0 { return []string{}, nil } + utf16CommandLine, err := UTF16FromString(commandLine) + if err != nil { + return nil, errorspkg.New("string with NUL passed to DecomposeCommandLine") + } var argc int32 - argv, err := CommandLineToArgv(StringToUTF16Ptr(commandLine), &argc) + argv, err := CommandLineToArgv(&utf16CommandLine[0], &argc) if err != nil { return nil, err } diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go index f8deca8397..c44a1b9636 100644 --- a/vendor/golang.org/x/sys/windows/service.go +++ b/vendor/golang.org/x/sys/windows/service.go @@ -141,6 +141,12 @@ const ( SERVICE_DYNAMIC_INFORMATION_LEVEL_START_REASON = 1 ) +type ENUM_SERVICE_STATUS struct { + ServiceName *uint16 + DisplayName *uint16 + ServiceStatus SERVICE_STATUS +} + type SERVICE_STATUS struct { ServiceType uint32 CurrentState uint32 @@ -212,6 +218,10 @@ type SERVICE_FAILURE_ACTIONS struct { Actions *SC_ACTION } +type SERVICE_FAILURE_ACTIONS_FLAG struct { + FailureActionsOnNonCrashFailures int32 +} + type SC_ACTION struct { Type uint32 Delay uint32 @@ -245,3 +255,4 @@ type QUERY_SERVICE_LOCK_STATUS struct { //sys UnsubscribeServiceChangeNotifications(subscription uintptr) = sechost.UnsubscribeServiceChangeNotifications? //sys RegisterServiceCtrlHandlerEx(serviceName *uint16, handlerProc uintptr, context uintptr) (handle Handle, err error) = advapi32.RegisterServiceCtrlHandlerExW //sys QueryServiceDynamicInformation(service Handle, infoLevel uint32, dynamicInfo unsafe.Pointer) (err error) = advapi32.QueryServiceDynamicInformation? +//sys EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) = advapi32.EnumDependentServicesW diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 3723b2c224..373d16388a 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -135,14 +135,14 @@ func Getpagesize() int { return 4096 } // NewCallback converts a Go function to a function pointer conforming to the stdcall calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallback(fn interface{}) uintptr { return syscall.NewCallback(fn) } // NewCallbackCDecl converts a Go function to a function pointer conforming to the cdecl calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallbackCDecl(fn interface{}) uintptr { return syscall.NewCallbackCDecl(fn) } @@ -405,7 +405,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation @@ -1354,6 +1354,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index 857acf1032..88e62a6385 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -2220,19 +2220,23 @@ type JOBOBJECT_BASIC_UI_RESTRICTIONS struct { } const ( - // JobObjectInformationClass + // JobObjectInformationClass for QueryInformationJobObject and SetInformationJobObject JobObjectAssociateCompletionPortInformation = 7 + JobObjectBasicAccountingInformation = 1 + JobObjectBasicAndIoAccountingInformation = 8 JobObjectBasicLimitInformation = 2 + JobObjectBasicProcessIdList = 3 JobObjectBasicUIRestrictions = 4 JobObjectCpuRateControlInformation = 15 JobObjectEndOfJobTimeInformation = 6 JobObjectExtendedLimitInformation = 9 JobObjectGroupInformation = 11 JobObjectGroupInformationEx = 14 - JobObjectLimitViolationInformation2 = 35 + JobObjectLimitViolationInformation = 13 + JobObjectLimitViolationInformation2 = 34 JobObjectNetRateControlInformation = 32 JobObjectNotificationLimitInformation = 12 - JobObjectNotificationLimitInformation2 = 34 + JobObjectNotificationLimitInformation2 = 33 JobObjectSecurityLimitInformation = 5 ) diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index 6d2a268534..566dd3e315 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -86,6 +86,7 @@ var ( procDeleteService = modadvapi32.NewProc("DeleteService") procDeregisterEventSource = modadvapi32.NewProc("DeregisterEventSource") procDuplicateTokenEx = modadvapi32.NewProc("DuplicateTokenEx") + procEnumDependentServicesW = modadvapi32.NewProc("EnumDependentServicesW") procEnumServicesStatusExW = modadvapi32.NewProc("EnumServicesStatusExW") procEqualSid = modadvapi32.NewProc("EqualSid") procFreeSid = modadvapi32.NewProc("FreeSid") @@ -734,6 +735,14 @@ func DuplicateTokenEx(existingToken Token, desiredAccess uint32, tokenAttributes return } +func EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall6(procEnumDependentServicesW.Addr(), 6, uintptr(service), uintptr(activityState), uintptr(unsafe.Pointer(services)), uintptr(buffSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned))) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func EnumServicesStatusEx(mgr Handle, infoLevel uint32, serviceType uint32, serviceState uint32, services *byte, bufSize uint32, bytesNeeded *uint32, servicesReturned *uint32, resumeHandle *uint32, groupName *uint16) (err error) { r1, _, e1 := syscall.Syscall12(procEnumServicesStatusExW.Addr(), 10, uintptr(mgr), uintptr(infoLevel), uintptr(serviceType), uintptr(serviceState), uintptr(unsafe.Pointer(services)), uintptr(bufSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned)), uintptr(unsafe.Pointer(resumeHandle)), uintptr(unsafe.Pointer(groupName)), 0, 0) if r1 == 0 { @@ -3507,12 +3516,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/term/term_unix.go b/vendor/golang.org/x/term/term_unix.go index a4e31ab1b2..62c2b3f41f 100644 --- a/vendor/golang.org/x/term/term_unix.go +++ b/vendor/golang.org/x/term/term_unix.go @@ -60,7 +60,7 @@ func restore(fd int, state *State) error { func getSize(fd int) (width, height int, err error) { ws, err := unix.IoctlGetWinsize(fd, unix.TIOCGWINSZ) if err != nil { - return -1, -1, err + return 0, 0, err } return int(ws.Col), int(ws.Row), nil } diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de599..a09ed198a5 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b58378b..14167e74e4 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f49474..1153baf291 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b699..a6573dcb21 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go index f248effae1..ffadb7bebd 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go new file mode 100644 index 0000000000..92cce5802c --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go @@ -0,0 +1,2043 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 19904 bytes (19.44 KiB). Checksum: b1f201ed2debb6c8. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 259 blocks, 16576 entries, 16576 bytes +// The third block is the zero block. +var bidiValues = [16576]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001, + 0x5f0: 0x000d, 0x5f1: 0x000d, 0x5f2: 0x000d, 0x5f3: 0x000d, 0x5f4: 0x000d, 0x5f5: 0x000d, + 0x5f6: 0x000d, 0x5f7: 0x000d, 0x5f8: 0x000d, 0x5f9: 0x000d, 0x5fa: 0x000d, 0x5fb: 0x000d, + 0x5fc: 0x000d, 0x5fd: 0x000d, 0x5fe: 0x000d, 0x5ff: 0x000d, + // Block 0x18, offset 0x600 + 0x600: 0x000d, 0x601: 0x000d, 0x602: 0x000d, 0x603: 0x000d, 0x604: 0x000d, 0x605: 0x000d, + 0x606: 0x000d, 0x607: 0x000d, 0x608: 0x000d, 0x609: 0x000d, 0x60a: 0x000d, 0x60b: 0x000d, + 0x60c: 0x000d, 0x60d: 0x000d, 0x60e: 0x000d, 0x60f: 0x0001, 0x610: 0x0005, 0x611: 0x0005, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x000c, 0x619: 0x000c, 0x61a: 0x000c, 0x61b: 0x000c, 0x61c: 0x000c, 0x61d: 0x000c, + 0x61e: 0x000c, 0x61f: 0x000c, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000c, 0x64b: 0x000c, + 0x64c: 0x000c, 0x64d: 0x000c, 0x64e: 0x000c, 0x64f: 0x000c, 0x650: 0x000c, 0x651: 0x000c, + 0x652: 0x000c, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + 0x77e: 0x000c, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x895: 0x000c, 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, 0x944: 0x000c, + 0x97c: 0x000c, 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa81: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaca: 0x000c, + 0xad2: 0x000c, 0xad3: 0x000c, 0xad4: 0x000c, 0xad6: 0x000c, + // Block 0x2c, offset 0xb00 + 0xb31: 0x000c, 0xb34: 0x000c, 0xb35: 0x000c, + 0xb36: 0x000c, 0xb37: 0x000c, 0xb38: 0x000c, 0xb39: 0x000c, 0xb3a: 0x000c, + 0xb3f: 0x0004, + // Block 0x2d, offset 0xb40 + 0xb47: 0x000c, 0xb48: 0x000c, 0xb49: 0x000c, 0xb4a: 0x000c, 0xb4b: 0x000c, + 0xb4c: 0x000c, 0xb4d: 0x000c, 0xb4e: 0x000c, + // Block 0x2e, offset 0xb80 + 0xbb1: 0x000c, 0xbb4: 0x000c, 0xbb5: 0x000c, + 0xbb6: 0x000c, 0xbb7: 0x000c, 0xbb8: 0x000c, 0xbb9: 0x000c, 0xbba: 0x000c, 0xbbb: 0x000c, + 0xbbc: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbc8: 0x000c, 0xbc9: 0x000c, 0xbca: 0x000c, 0xbcb: 0x000c, + 0xbcc: 0x000c, 0xbcd: 0x000c, 0xbce: 0x000c, + // Block 0x30, offset 0xc00 + 0xc18: 0x000c, 0xc19: 0x000c, + 0xc35: 0x000c, + 0xc37: 0x000c, 0xc39: 0x000c, 0xc3a: 0x003a, 0xc3b: 0x002a, + 0xc3c: 0x003a, 0xc3d: 0x002a, + // Block 0x31, offset 0xc40 + 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, 0xc7d: 0x000c, 0xc7e: 0x000c, + // Block 0x32, offset 0xc80 + 0xc80: 0x000c, 0xc81: 0x000c, 0xc82: 0x000c, 0xc83: 0x000c, 0xc84: 0x000c, + 0xc86: 0x000c, 0xc87: 0x000c, + 0xc8d: 0x000c, 0xc8e: 0x000c, 0xc8f: 0x000c, 0xc90: 0x000c, 0xc91: 0x000c, + 0xc92: 0x000c, 0xc93: 0x000c, 0xc94: 0x000c, 0xc95: 0x000c, 0xc96: 0x000c, 0xc97: 0x000c, + 0xc99: 0x000c, 0xc9a: 0x000c, 0xc9b: 0x000c, 0xc9c: 0x000c, 0xc9d: 0x000c, + 0xc9e: 0x000c, 0xc9f: 0x000c, 0xca0: 0x000c, 0xca1: 0x000c, 0xca2: 0x000c, 0xca3: 0x000c, + 0xca4: 0x000c, 0xca5: 0x000c, 0xca6: 0x000c, 0xca7: 0x000c, 0xca8: 0x000c, 0xca9: 0x000c, + 0xcaa: 0x000c, 0xcab: 0x000c, 0xcac: 0x000c, 0xcad: 0x000c, 0xcae: 0x000c, 0xcaf: 0x000c, + 0xcb0: 0x000c, 0xcb1: 0x000c, 0xcb2: 0x000c, 0xcb3: 0x000c, 0xcb4: 0x000c, 0xcb5: 0x000c, + 0xcb6: 0x000c, 0xcb7: 0x000c, 0xcb8: 0x000c, 0xcb9: 0x000c, 0xcba: 0x000c, 0xcbb: 0x000c, + 0xcbc: 0x000c, + // Block 0x33, offset 0xcc0 + 0xcc6: 0x000c, + // Block 0x34, offset 0xd00 + 0xd2d: 0x000c, 0xd2e: 0x000c, 0xd2f: 0x000c, + 0xd30: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, 0xd35: 0x000c, + 0xd36: 0x000c, 0xd37: 0x000c, 0xd39: 0x000c, 0xd3a: 0x000c, + 0xd3d: 0x000c, 0xd3e: 0x000c, + // Block 0x35, offset 0xd40 + 0xd58: 0x000c, 0xd59: 0x000c, + 0xd5e: 0x000c, 0xd5f: 0x000c, 0xd60: 0x000c, + 0xd71: 0x000c, 0xd72: 0x000c, 0xd73: 0x000c, 0xd74: 0x000c, + // Block 0x36, offset 0xd80 + 0xd82: 0x000c, 0xd85: 0x000c, + 0xd86: 0x000c, + 0xd8d: 0x000c, + 0xd9d: 0x000c, + // Block 0x37, offset 0xdc0 + 0xddd: 0x000c, + 0xdde: 0x000c, 0xddf: 0x000c, + // Block 0x38, offset 0xe00 + 0xe10: 0x000a, 0xe11: 0x000a, + 0xe12: 0x000a, 0xe13: 0x000a, 0xe14: 0x000a, 0xe15: 0x000a, 0xe16: 0x000a, 0xe17: 0x000a, + 0xe18: 0x000a, 0xe19: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x000a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x0009, + 0xe9b: 0x007a, 0xe9c: 0x006a, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, 0xed4: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf12: 0x000c, 0xf13: 0x000c, + 0xf32: 0x000c, 0xf33: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf74: 0x000c, 0xf75: 0x000c, + 0xf77: 0x000c, 0xf78: 0x000c, 0xf79: 0x000c, 0xf7a: 0x000c, 0xf7b: 0x000c, + 0xf7c: 0x000c, 0xf7d: 0x000c, + // Block 0x3e, offset 0xf80 + 0xf86: 0x000c, 0xf89: 0x000c, 0xf8a: 0x000c, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000c, 0xf8f: 0x000c, 0xf90: 0x000c, 0xf91: 0x000c, + 0xf92: 0x000c, 0xf93: 0x000c, + 0xf9b: 0x0004, 0xf9d: 0x000c, + 0xfb0: 0x000a, 0xfb1: 0x000a, 0xfb2: 0x000a, 0xfb3: 0x000a, 0xfb4: 0x000a, 0xfb5: 0x000a, + 0xfb6: 0x000a, 0xfb7: 0x000a, 0xfb8: 0x000a, 0xfb9: 0x000a, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x000a, 0xfc1: 0x000a, 0xfc2: 0x000a, 0xfc3: 0x000a, 0xfc4: 0x000a, 0xfc5: 0x000a, + 0xfc6: 0x000a, 0xfc7: 0x000a, 0xfc8: 0x000a, 0xfc9: 0x000a, 0xfca: 0x000a, 0xfcb: 0x000c, + 0xfcc: 0x000c, 0xfcd: 0x000c, 0xfce: 0x000b, 0xfcf: 0x000c, + // Block 0x40, offset 0x1000 + 0x1005: 0x000c, + 0x1006: 0x000c, + 0x1029: 0x000c, + // Block 0x41, offset 0x1040 + 0x1060: 0x000c, 0x1061: 0x000c, 0x1062: 0x000c, + 0x1067: 0x000c, 0x1068: 0x000c, + 0x1072: 0x000c, + 0x1079: 0x000c, 0x107a: 0x000c, 0x107b: 0x000c, + // Block 0x42, offset 0x1080 + 0x1080: 0x000a, 0x1084: 0x000a, 0x1085: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10de: 0x000a, 0x10df: 0x000a, 0x10e0: 0x000a, 0x10e1: 0x000a, 0x10e2: 0x000a, 0x10e3: 0x000a, + 0x10e4: 0x000a, 0x10e5: 0x000a, 0x10e6: 0x000a, 0x10e7: 0x000a, 0x10e8: 0x000a, 0x10e9: 0x000a, + 0x10ea: 0x000a, 0x10eb: 0x000a, 0x10ec: 0x000a, 0x10ed: 0x000a, 0x10ee: 0x000a, 0x10ef: 0x000a, + 0x10f0: 0x000a, 0x10f1: 0x000a, 0x10f2: 0x000a, 0x10f3: 0x000a, 0x10f4: 0x000a, 0x10f5: 0x000a, + 0x10f6: 0x000a, 0x10f7: 0x000a, 0x10f8: 0x000a, 0x10f9: 0x000a, 0x10fa: 0x000a, 0x10fb: 0x000a, + 0x10fc: 0x000a, 0x10fd: 0x000a, 0x10fe: 0x000a, 0x10ff: 0x000a, + // Block 0x44, offset 0x1100 + 0x1117: 0x000c, + 0x1118: 0x000c, 0x111b: 0x000c, + // Block 0x45, offset 0x1140 + 0x1156: 0x000c, + 0x1158: 0x000c, 0x1159: 0x000c, 0x115a: 0x000c, 0x115b: 0x000c, 0x115c: 0x000c, 0x115d: 0x000c, + 0x115e: 0x000c, 0x1160: 0x000c, 0x1162: 0x000c, + 0x1165: 0x000c, 0x1166: 0x000c, 0x1167: 0x000c, 0x1168: 0x000c, 0x1169: 0x000c, + 0x116a: 0x000c, 0x116b: 0x000c, 0x116c: 0x000c, + 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117f: 0x000c, + // Block 0x46, offset 0x1180 + 0x11b0: 0x000c, 0x11b1: 0x000c, 0x11b2: 0x000c, 0x11b3: 0x000c, 0x11b4: 0x000c, 0x11b5: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, 0x11bb: 0x000c, + 0x11bc: 0x000c, 0x11bd: 0x000c, 0x11be: 0x000c, 0x11bf: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x000c, 0x11c1: 0x000c, 0x11c2: 0x000c, 0x11c3: 0x000c, 0x11c4: 0x000c, 0x11c5: 0x000c, + 0x11c6: 0x000c, 0x11c7: 0x000c, 0x11c8: 0x000c, 0x11c9: 0x000c, 0x11ca: 0x000c, 0x11cb: 0x000c, + 0x11cc: 0x000c, 0x11cd: 0x000c, 0x11ce: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, 0x1202: 0x000c, 0x1203: 0x000c, + 0x1234: 0x000c, + 0x1236: 0x000c, 0x1237: 0x000c, 0x1238: 0x000c, 0x1239: 0x000c, 0x123a: 0x000c, + 0x123c: 0x000c, + // Block 0x49, offset 0x1240 + 0x1242: 0x000c, + 0x126b: 0x000c, 0x126c: 0x000c, 0x126d: 0x000c, 0x126e: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, 0x1272: 0x000c, 0x1273: 0x000c, + // Block 0x4a, offset 0x1280 + 0x1280: 0x000c, 0x1281: 0x000c, + 0x12a2: 0x000c, 0x12a3: 0x000c, + 0x12a4: 0x000c, 0x12a5: 0x000c, 0x12a8: 0x000c, 0x12a9: 0x000c, + 0x12ab: 0x000c, 0x12ac: 0x000c, 0x12ad: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12e6: 0x000c, 0x12e8: 0x000c, 0x12e9: 0x000c, + 0x12ed: 0x000c, 0x12ef: 0x000c, + 0x12f0: 0x000c, 0x12f1: 0x000c, + // Block 0x4c, offset 0x1300 + 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, + // Block 0x4d, offset 0x1340 + 0x1350: 0x000c, 0x1351: 0x000c, + 0x1352: 0x000c, 0x1354: 0x000c, 0x1355: 0x000c, 0x1356: 0x000c, 0x1357: 0x000c, + 0x1358: 0x000c, 0x1359: 0x000c, 0x135a: 0x000c, 0x135b: 0x000c, 0x135c: 0x000c, 0x135d: 0x000c, + 0x135e: 0x000c, 0x135f: 0x000c, 0x1360: 0x000c, 0x1362: 0x000c, 0x1363: 0x000c, + 0x1364: 0x000c, 0x1365: 0x000c, 0x1366: 0x000c, 0x1367: 0x000c, 0x1368: 0x000c, + 0x136d: 0x000c, + 0x1374: 0x000c, + 0x1378: 0x000c, 0x1379: 0x000c, + // Block 0x4e, offset 0x1380 + 0x13bd: 0x000a, 0x13bf: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x000a, 0x13c1: 0x000a, + 0x13cd: 0x000a, 0x13ce: 0x000a, 0x13cf: 0x000a, + 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, + 0x13ed: 0x000a, 0x13ee: 0x000a, 0x13ef: 0x000a, + 0x13fd: 0x000a, 0x13fe: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x0009, 0x1401: 0x0009, 0x1402: 0x0009, 0x1403: 0x0009, 0x1404: 0x0009, 0x1405: 0x0009, + 0x1406: 0x0009, 0x1407: 0x0009, 0x1408: 0x0009, 0x1409: 0x0009, 0x140a: 0x0009, 0x140b: 0x000b, + 0x140c: 0x000b, 0x140d: 0x000b, 0x140f: 0x0001, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x000a, 0x1420: 0x000a, 0x1421: 0x000a, 0x1422: 0x000a, 0x1423: 0x000a, + 0x1424: 0x000a, 0x1425: 0x000a, 0x1426: 0x000a, 0x1427: 0x000a, 0x1428: 0x0009, 0x1429: 0x0007, + 0x142a: 0x000e, 0x142b: 0x000e, 0x142c: 0x000e, 0x142d: 0x000e, 0x142e: 0x000e, 0x142f: 0x0006, + 0x1430: 0x0004, 0x1431: 0x0004, 0x1432: 0x0004, 0x1433: 0x0004, 0x1434: 0x0004, 0x1435: 0x000a, + 0x1436: 0x000a, 0x1437: 0x000a, 0x1438: 0x000a, 0x1439: 0x000a, 0x143a: 0x000a, 0x143b: 0x000a, + 0x143c: 0x000a, 0x143d: 0x000a, 0x143e: 0x000a, 0x143f: 0x000a, + // Block 0x51, offset 0x1440 + 0x1440: 0x000a, 0x1441: 0x000a, 0x1442: 0x000a, 0x1443: 0x000a, 0x1444: 0x0006, 0x1445: 0x009a, + 0x1446: 0x008a, 0x1447: 0x000a, 0x1448: 0x000a, 0x1449: 0x000a, 0x144a: 0x000a, 0x144b: 0x000a, + 0x144c: 0x000a, 0x144d: 0x000a, 0x144e: 0x000a, 0x144f: 0x000a, 0x1450: 0x000a, 0x1451: 0x000a, + 0x1452: 0x000a, 0x1453: 0x000a, 0x1454: 0x000a, 0x1455: 0x000a, 0x1456: 0x000a, 0x1457: 0x000a, + 0x1458: 0x000a, 0x1459: 0x000a, 0x145a: 0x000a, 0x145b: 0x000a, 0x145c: 0x000a, 0x145d: 0x000a, + 0x145e: 0x000a, 0x145f: 0x0009, 0x1460: 0x000b, 0x1461: 0x000b, 0x1462: 0x000b, 0x1463: 0x000b, + 0x1464: 0x000b, 0x1465: 0x000b, 0x1466: 0x000e, 0x1467: 0x000e, 0x1468: 0x000e, 0x1469: 0x000e, + 0x146a: 0x000b, 0x146b: 0x000b, 0x146c: 0x000b, 0x146d: 0x000b, 0x146e: 0x000b, 0x146f: 0x000b, + 0x1470: 0x0002, 0x1474: 0x0002, 0x1475: 0x0002, + 0x1476: 0x0002, 0x1477: 0x0002, 0x1478: 0x0002, 0x1479: 0x0002, 0x147a: 0x0003, 0x147b: 0x0003, + 0x147c: 0x000a, 0x147d: 0x009a, 0x147e: 0x008a, + // Block 0x52, offset 0x1480 + 0x1480: 0x0002, 0x1481: 0x0002, 0x1482: 0x0002, 0x1483: 0x0002, 0x1484: 0x0002, 0x1485: 0x0002, + 0x1486: 0x0002, 0x1487: 0x0002, 0x1488: 0x0002, 0x1489: 0x0002, 0x148a: 0x0003, 0x148b: 0x0003, + 0x148c: 0x000a, 0x148d: 0x009a, 0x148e: 0x008a, + 0x14a0: 0x0004, 0x14a1: 0x0004, 0x14a2: 0x0004, 0x14a3: 0x0004, + 0x14a4: 0x0004, 0x14a5: 0x0004, 0x14a6: 0x0004, 0x14a7: 0x0004, 0x14a8: 0x0004, 0x14a9: 0x0004, + 0x14aa: 0x0004, 0x14ab: 0x0004, 0x14ac: 0x0004, 0x14ad: 0x0004, 0x14ae: 0x0004, 0x14af: 0x0004, + 0x14b0: 0x0004, 0x14b1: 0x0004, 0x14b2: 0x0004, 0x14b3: 0x0004, 0x14b4: 0x0004, 0x14b5: 0x0004, + 0x14b6: 0x0004, 0x14b7: 0x0004, 0x14b8: 0x0004, 0x14b9: 0x0004, 0x14ba: 0x0004, 0x14bb: 0x0004, + 0x14bc: 0x0004, 0x14bd: 0x0004, 0x14be: 0x0004, 0x14bf: 0x0004, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0004, 0x14c1: 0x0004, 0x14c2: 0x0004, 0x14c3: 0x0004, 0x14c4: 0x0004, 0x14c5: 0x0004, + 0x14c6: 0x0004, 0x14c7: 0x0004, 0x14c8: 0x0004, 0x14c9: 0x0004, 0x14ca: 0x0004, 0x14cb: 0x0004, + 0x14cc: 0x0004, 0x14cd: 0x0004, 0x14ce: 0x0004, 0x14cf: 0x0004, 0x14d0: 0x000c, 0x14d1: 0x000c, + 0x14d2: 0x000c, 0x14d3: 0x000c, 0x14d4: 0x000c, 0x14d5: 0x000c, 0x14d6: 0x000c, 0x14d7: 0x000c, + 0x14d8: 0x000c, 0x14d9: 0x000c, 0x14da: 0x000c, 0x14db: 0x000c, 0x14dc: 0x000c, 0x14dd: 0x000c, + 0x14de: 0x000c, 0x14df: 0x000c, 0x14e0: 0x000c, 0x14e1: 0x000c, 0x14e2: 0x000c, 0x14e3: 0x000c, + 0x14e4: 0x000c, 0x14e5: 0x000c, 0x14e6: 0x000c, 0x14e7: 0x000c, 0x14e8: 0x000c, 0x14e9: 0x000c, + 0x14ea: 0x000c, 0x14eb: 0x000c, 0x14ec: 0x000c, 0x14ed: 0x000c, 0x14ee: 0x000c, 0x14ef: 0x000c, + 0x14f0: 0x000c, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, 0x1505: 0x000a, + 0x1506: 0x000a, 0x1508: 0x000a, 0x1509: 0x000a, + 0x1514: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, 0x1520: 0x000a, 0x1521: 0x000a, 0x1522: 0x000a, 0x1523: 0x000a, + 0x1525: 0x000a, 0x1527: 0x000a, 0x1529: 0x000a, + 0x152e: 0x0004, + 0x153a: 0x000a, 0x153b: 0x000a, + // Block 0x55, offset 0x1540 + 0x1540: 0x000a, 0x1541: 0x000a, 0x1542: 0x000a, 0x1543: 0x000a, 0x1544: 0x000a, + 0x154a: 0x000a, 0x154b: 0x000a, + 0x154c: 0x000a, 0x154d: 0x000a, 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x000a, 0x15d3: 0x000a, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x000a, 0x1609: 0x000a, 0x160a: 0x000a, 0x160b: 0x000a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x0003, 0x1613: 0x0004, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x000a, + 0x162a: 0x000a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + 0x1636: 0x000a, 0x1637: 0x000a, 0x1638: 0x000a, 0x1639: 0x000a, 0x163a: 0x000a, 0x163b: 0x000a, + 0x163c: 0x000a, 0x163d: 0x000a, 0x163e: 0x000a, 0x163f: 0x000a, + // Block 0x59, offset 0x1640 + 0x1640: 0x000a, 0x1641: 0x000a, 0x1642: 0x000a, 0x1643: 0x000a, 0x1644: 0x000a, 0x1645: 0x000a, + 0x1646: 0x000a, 0x1647: 0x000a, 0x1648: 0x003a, 0x1649: 0x002a, 0x164a: 0x003a, 0x164b: 0x002a, + 0x164c: 0x000a, 0x164d: 0x000a, 0x164e: 0x000a, 0x164f: 0x000a, 0x1650: 0x000a, 0x1651: 0x000a, + 0x1652: 0x000a, 0x1653: 0x000a, 0x1654: 0x000a, 0x1655: 0x000a, 0x1656: 0x000a, 0x1657: 0x000a, + 0x1658: 0x000a, 0x1659: 0x000a, 0x165a: 0x000a, 0x165b: 0x000a, 0x165c: 0x000a, 0x165d: 0x000a, + 0x165e: 0x000a, 0x165f: 0x000a, 0x1660: 0x000a, 0x1661: 0x000a, 0x1662: 0x000a, 0x1663: 0x000a, + 0x1664: 0x000a, 0x1665: 0x000a, 0x1666: 0x000a, 0x1667: 0x000a, 0x1668: 0x000a, 0x1669: 0x009a, + 0x166a: 0x008a, 0x166b: 0x000a, 0x166c: 0x000a, 0x166d: 0x000a, 0x166e: 0x000a, 0x166f: 0x000a, + 0x1670: 0x000a, 0x1671: 0x000a, 0x1672: 0x000a, 0x1673: 0x000a, 0x1674: 0x000a, 0x1675: 0x000a, + // Block 0x5a, offset 0x1680 + 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a, + 0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a, + 0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a, + 0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a, + 0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, 0x16ff: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a, + 0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a, + 0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a, + 0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a, + 0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a, + 0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a, + 0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a, + 0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a, + 0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a, + 0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a, + 0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a, + // Block 0x5e, offset 0x1780 + 0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a, + 0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002, + 0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002, + 0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002, + 0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002, + // Block 0x5f, offset 0x17c0 + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a, + 0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a, + 0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a, + 0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a, + 0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a, + 0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a, + 0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a, + 0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a, + 0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a, + 0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a, + 0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba, + 0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1997: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a, + 0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a, + 0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x009a, 0x1ad6: 0x008a, 0x1ad7: 0x00ba, + 0x1ad8: 0x00aa, 0x1ad9: 0x009a, 0x1ada: 0x008a, 0x1adb: 0x007a, 0x1adc: 0x006a, 0x1add: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, 0x206c: 0x000c, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + 0x20ff: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, 0x21bd: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x232a: 0x000a, 0x232b: 0x000a, + // Block 0x8d, offset 0x2340 + 0x2365: 0x000c, 0x2368: 0x000c, + 0x236d: 0x000c, + // Block 0x8e, offset 0x2380 + 0x239d: 0x0001, + 0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001, + 0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003, + 0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001, + 0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001, + 0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001, + 0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001, + 0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001, + 0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d, + 0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d, + 0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d, + 0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d, + 0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d, + 0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a, + // Block 0x91, offset 0x2440 + 0x2440: 0x000a, 0x2441: 0x000a, 0x2442: 0x000a, 0x2443: 0x000a, 0x2444: 0x000a, 0x2445: 0x000a, + 0x2446: 0x000a, 0x2447: 0x000a, 0x2448: 0x000a, 0x2449: 0x000a, 0x244a: 0x000a, 0x244b: 0x000a, + 0x244c: 0x000a, 0x244d: 0x000a, 0x244e: 0x000a, 0x244f: 0x000a, 0x2450: 0x000d, 0x2451: 0x000d, + 0x2452: 0x000d, 0x2453: 0x000d, 0x2454: 0x000d, 0x2455: 0x000d, 0x2456: 0x000d, 0x2457: 0x000d, + 0x2458: 0x000d, 0x2459: 0x000d, 0x245a: 0x000d, 0x245b: 0x000d, 0x245c: 0x000d, 0x245d: 0x000d, + 0x245e: 0x000d, 0x245f: 0x000d, 0x2460: 0x000d, 0x2461: 0x000d, 0x2462: 0x000d, 0x2463: 0x000d, + 0x2464: 0x000d, 0x2465: 0x000d, 0x2466: 0x000d, 0x2467: 0x000d, 0x2468: 0x000d, 0x2469: 0x000d, + 0x246a: 0x000d, 0x246b: 0x000d, 0x246c: 0x000d, 0x246d: 0x000d, 0x246e: 0x000d, 0x246f: 0x000d, + 0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d, + 0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d, + 0x247c: 0x000d, 0x247d: 0x000d, 0x247e: 0x000d, 0x247f: 0x000d, + // Block 0x92, offset 0x2480 + 0x2480: 0x000d, 0x2481: 0x000d, 0x2482: 0x000d, 0x2483: 0x000d, 0x2484: 0x000d, 0x2485: 0x000d, + 0x2486: 0x000d, 0x2487: 0x000d, 0x2488: 0x000d, 0x2489: 0x000d, 0x248a: 0x000d, 0x248b: 0x000d, + 0x248c: 0x000d, 0x248d: 0x000d, 0x248e: 0x000d, 0x248f: 0x000a, 0x2490: 0x000b, 0x2491: 0x000b, + 0x2492: 0x000b, 0x2493: 0x000b, 0x2494: 0x000b, 0x2495: 0x000b, 0x2496: 0x000b, 0x2497: 0x000b, + 0x2498: 0x000b, 0x2499: 0x000b, 0x249a: 0x000b, 0x249b: 0x000b, 0x249c: 0x000b, 0x249d: 0x000b, + 0x249e: 0x000b, 0x249f: 0x000b, 0x24a0: 0x000b, 0x24a1: 0x000b, 0x24a2: 0x000b, 0x24a3: 0x000b, + 0x24a4: 0x000b, 0x24a5: 0x000b, 0x24a6: 0x000b, 0x24a7: 0x000b, 0x24a8: 0x000b, 0x24a9: 0x000b, + 0x24aa: 0x000b, 0x24ab: 0x000b, 0x24ac: 0x000b, 0x24ad: 0x000b, 0x24ae: 0x000b, 0x24af: 0x000b, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000c, 0x24c1: 0x000c, 0x24c2: 0x000c, 0x24c3: 0x000c, 0x24c4: 0x000c, 0x24c5: 0x000c, + 0x24c6: 0x000c, 0x24c7: 0x000c, 0x24c8: 0x000c, 0x24c9: 0x000c, 0x24ca: 0x000c, 0x24cb: 0x000c, + 0x24cc: 0x000c, 0x24cd: 0x000c, 0x24ce: 0x000c, 0x24cf: 0x000c, 0x24d0: 0x000a, 0x24d1: 0x000a, + 0x24d2: 0x000a, 0x24d3: 0x000a, 0x24d4: 0x000a, 0x24d5: 0x000a, 0x24d6: 0x000a, 0x24d7: 0x000a, + 0x24d8: 0x000a, 0x24d9: 0x000a, + 0x24e0: 0x000c, 0x24e1: 0x000c, 0x24e2: 0x000c, 0x24e3: 0x000c, + 0x24e4: 0x000c, 0x24e5: 0x000c, 0x24e6: 0x000c, 0x24e7: 0x000c, 0x24e8: 0x000c, 0x24e9: 0x000c, + 0x24ea: 0x000c, 0x24eb: 0x000c, 0x24ec: 0x000c, 0x24ed: 0x000c, 0x24ee: 0x000c, 0x24ef: 0x000c, + 0x24f0: 0x000a, 0x24f1: 0x000a, 0x24f2: 0x000a, 0x24f3: 0x000a, 0x24f4: 0x000a, 0x24f5: 0x000a, + 0x24f6: 0x000a, 0x24f7: 0x000a, 0x24f8: 0x000a, 0x24f9: 0x000a, 0x24fa: 0x000a, 0x24fb: 0x000a, + 0x24fc: 0x000a, 0x24fd: 0x000a, 0x24fe: 0x000a, 0x24ff: 0x000a, + // Block 0x94, offset 0x2500 + 0x2500: 0x000a, 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x000a, 0x2504: 0x000a, 0x2505: 0x000a, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x000a, 0x2509: 0x000a, 0x250a: 0x000a, 0x250b: 0x000a, + 0x250c: 0x000a, 0x250d: 0x000a, 0x250e: 0x000a, 0x250f: 0x000a, 0x2510: 0x0006, 0x2511: 0x000a, + 0x2512: 0x0006, 0x2514: 0x000a, 0x2515: 0x0006, 0x2516: 0x000a, 0x2517: 0x000a, + 0x2518: 0x000a, 0x2519: 0x009a, 0x251a: 0x008a, 0x251b: 0x007a, 0x251c: 0x006a, 0x251d: 0x009a, + 0x251e: 0x008a, 0x251f: 0x0004, 0x2520: 0x000a, 0x2521: 0x000a, 0x2522: 0x0003, 0x2523: 0x0003, + 0x2524: 0x000a, 0x2525: 0x000a, 0x2526: 0x000a, 0x2528: 0x000a, 0x2529: 0x0004, + 0x252a: 0x0004, 0x252b: 0x000a, + 0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d, + 0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d, + 0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000d, + // Block 0x95, offset 0x2540 + 0x2540: 0x000d, 0x2541: 0x000d, 0x2542: 0x000d, 0x2543: 0x000d, 0x2544: 0x000d, 0x2545: 0x000d, + 0x2546: 0x000d, 0x2547: 0x000d, 0x2548: 0x000d, 0x2549: 0x000d, 0x254a: 0x000d, 0x254b: 0x000d, + 0x254c: 0x000d, 0x254d: 0x000d, 0x254e: 0x000d, 0x254f: 0x000d, 0x2550: 0x000d, 0x2551: 0x000d, + 0x2552: 0x000d, 0x2553: 0x000d, 0x2554: 0x000d, 0x2555: 0x000d, 0x2556: 0x000d, 0x2557: 0x000d, + 0x2558: 0x000d, 0x2559: 0x000d, 0x255a: 0x000d, 0x255b: 0x000d, 0x255c: 0x000d, 0x255d: 0x000d, + 0x255e: 0x000d, 0x255f: 0x000d, 0x2560: 0x000d, 0x2561: 0x000d, 0x2562: 0x000d, 0x2563: 0x000d, + 0x2564: 0x000d, 0x2565: 0x000d, 0x2566: 0x000d, 0x2567: 0x000d, 0x2568: 0x000d, 0x2569: 0x000d, + 0x256a: 0x000d, 0x256b: 0x000d, 0x256c: 0x000d, 0x256d: 0x000d, 0x256e: 0x000d, 0x256f: 0x000d, + 0x2570: 0x000d, 0x2571: 0x000d, 0x2572: 0x000d, 0x2573: 0x000d, 0x2574: 0x000d, 0x2575: 0x000d, + 0x2576: 0x000d, 0x2577: 0x000d, 0x2578: 0x000d, 0x2579: 0x000d, 0x257a: 0x000d, 0x257b: 0x000d, + 0x257c: 0x000d, 0x257d: 0x000d, 0x257e: 0x000d, 0x257f: 0x000b, + // Block 0x96, offset 0x2580 + 0x2581: 0x000a, 0x2582: 0x000a, 0x2583: 0x0004, 0x2584: 0x0004, 0x2585: 0x0004, + 0x2586: 0x000a, 0x2587: 0x000a, 0x2588: 0x003a, 0x2589: 0x002a, 0x258a: 0x000a, 0x258b: 0x0003, + 0x258c: 0x0006, 0x258d: 0x0003, 0x258e: 0x0006, 0x258f: 0x0006, 0x2590: 0x0002, 0x2591: 0x0002, + 0x2592: 0x0002, 0x2593: 0x0002, 0x2594: 0x0002, 0x2595: 0x0002, 0x2596: 0x0002, 0x2597: 0x0002, + 0x2598: 0x0002, 0x2599: 0x0002, 0x259a: 0x0006, 0x259b: 0x000a, 0x259c: 0x000a, 0x259d: 0x000a, + 0x259e: 0x000a, 0x259f: 0x000a, 0x25a0: 0x000a, + 0x25bb: 0x005a, + 0x25bc: 0x000a, 0x25bd: 0x004a, 0x25be: 0x000a, 0x25bf: 0x000a, + // Block 0x97, offset 0x25c0 + 0x25c0: 0x000a, + 0x25db: 0x005a, 0x25dc: 0x000a, 0x25dd: 0x004a, + 0x25de: 0x000a, 0x25df: 0x00fa, 0x25e0: 0x00ea, 0x25e1: 0x000a, 0x25e2: 0x003a, 0x25e3: 0x002a, + 0x25e4: 0x000a, 0x25e5: 0x000a, + // Block 0x98, offset 0x2600 + 0x2620: 0x0004, 0x2621: 0x0004, 0x2622: 0x000a, 0x2623: 0x000a, + 0x2624: 0x000a, 0x2625: 0x0004, 0x2626: 0x0004, 0x2628: 0x000a, 0x2629: 0x000a, + 0x262a: 0x000a, 0x262b: 0x000a, 0x262c: 0x000a, 0x262d: 0x000a, 0x262e: 0x000a, + 0x2630: 0x000b, 0x2631: 0x000b, 0x2632: 0x000b, 0x2633: 0x000b, 0x2634: 0x000b, 0x2635: 0x000b, + 0x2636: 0x000b, 0x2637: 0x000b, 0x2638: 0x000b, 0x2639: 0x000a, 0x263a: 0x000a, 0x263b: 0x000a, + 0x263c: 0x000a, 0x263d: 0x000a, 0x263e: 0x000b, 0x263f: 0x000b, + // Block 0x99, offset 0x2640 + 0x2641: 0x000a, + // Block 0x9a, offset 0x2680 + 0x2680: 0x000a, 0x2681: 0x000a, 0x2682: 0x000a, 0x2683: 0x000a, 0x2684: 0x000a, 0x2685: 0x000a, + 0x2686: 0x000a, 0x2687: 0x000a, 0x2688: 0x000a, 0x2689: 0x000a, 0x268a: 0x000a, 0x268b: 0x000a, + 0x268c: 0x000a, 0x2690: 0x000a, 0x2691: 0x000a, + 0x2692: 0x000a, 0x2693: 0x000a, 0x2694: 0x000a, 0x2695: 0x000a, 0x2696: 0x000a, 0x2697: 0x000a, + 0x2698: 0x000a, 0x2699: 0x000a, 0x269a: 0x000a, 0x269b: 0x000a, 0x269c: 0x000a, + 0x26a0: 0x000a, + // Block 0x9b, offset 0x26c0 + 0x26fd: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2720: 0x000c, 0x2721: 0x0002, 0x2722: 0x0002, 0x2723: 0x0002, + 0x2724: 0x0002, 0x2725: 0x0002, 0x2726: 0x0002, 0x2727: 0x0002, 0x2728: 0x0002, 0x2729: 0x0002, + 0x272a: 0x0002, 0x272b: 0x0002, 0x272c: 0x0002, 0x272d: 0x0002, 0x272e: 0x0002, 0x272f: 0x0002, + 0x2730: 0x0002, 0x2731: 0x0002, 0x2732: 0x0002, 0x2733: 0x0002, 0x2734: 0x0002, 0x2735: 0x0002, + 0x2736: 0x0002, 0x2737: 0x0002, 0x2738: 0x0002, 0x2739: 0x0002, 0x273a: 0x0002, 0x273b: 0x0002, + // Block 0x9d, offset 0x2740 + 0x2776: 0x000c, 0x2777: 0x000c, 0x2778: 0x000c, 0x2779: 0x000c, 0x277a: 0x000c, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001, + 0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x000a, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x000c, 0x2802: 0x000c, 0x2803: 0x000c, 0x2804: 0x0001, 0x2805: 0x000c, + 0x2806: 0x000c, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x000c, 0x280d: 0x000c, 0x280e: 0x000c, 0x280f: 0x000c, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x000c, 0x2839: 0x000c, 0x283a: 0x000c, 0x283b: 0x0001, + 0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x000c, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001, + 0x2864: 0x0001, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001, + 0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001, + 0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001, + 0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x0001, 0x287a: 0x0001, 0x287b: 0x0001, + 0x287c: 0x0001, 0x287d: 0x0001, 0x287e: 0x0001, 0x287f: 0x0001, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0001, 0x28a1: 0x0001, 0x28a2: 0x0001, 0x28a3: 0x0001, + 0x28a4: 0x0001, 0x28a5: 0x0001, 0x28a6: 0x0001, 0x28a7: 0x0001, 0x28a8: 0x0001, 0x28a9: 0x0001, + 0x28aa: 0x0001, 0x28ab: 0x0001, 0x28ac: 0x0001, 0x28ad: 0x0001, 0x28ae: 0x0001, 0x28af: 0x0001, + 0x28b0: 0x0001, 0x28b1: 0x0001, 0x28b2: 0x0001, 0x28b3: 0x0001, 0x28b4: 0x0001, 0x28b5: 0x0001, + 0x28b6: 0x0001, 0x28b7: 0x0001, 0x28b8: 0x0001, 0x28b9: 0x000a, 0x28ba: 0x000a, 0x28bb: 0x000a, + 0x28bc: 0x000a, 0x28bd: 0x000a, 0x28be: 0x000a, 0x28bf: 0x000a, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x000d, 0x28c1: 0x000d, 0x28c2: 0x000d, 0x28c3: 0x000d, 0x28c4: 0x000d, 0x28c5: 0x000d, + 0x28c6: 0x000d, 0x28c7: 0x000d, 0x28c8: 0x000d, 0x28c9: 0x000d, 0x28ca: 0x000d, 0x28cb: 0x000d, + 0x28cc: 0x000d, 0x28cd: 0x000d, 0x28ce: 0x000d, 0x28cf: 0x000d, 0x28d0: 0x000d, 0x28d1: 0x000d, + 0x28d2: 0x000d, 0x28d3: 0x000d, 0x28d4: 0x000d, 0x28d5: 0x000d, 0x28d6: 0x000d, 0x28d7: 0x000d, + 0x28d8: 0x000d, 0x28d9: 0x000d, 0x28da: 0x000d, 0x28db: 0x000d, 0x28dc: 0x000d, 0x28dd: 0x000d, + 0x28de: 0x000d, 0x28df: 0x000d, 0x28e0: 0x000d, 0x28e1: 0x000d, 0x28e2: 0x000d, 0x28e3: 0x000d, + 0x28e4: 0x000c, 0x28e5: 0x000c, 0x28e6: 0x000c, 0x28e7: 0x000c, 0x28e8: 0x0001, 0x28e9: 0x0001, + 0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001, + 0x28f0: 0x0005, 0x28f1: 0x0005, 0x28f2: 0x0005, 0x28f3: 0x0005, 0x28f4: 0x0005, 0x28f5: 0x0005, + 0x28f6: 0x0005, 0x28f7: 0x0005, 0x28f8: 0x0005, 0x28f9: 0x0005, 0x28fa: 0x0001, 0x28fb: 0x0001, + 0x28fc: 0x0001, 0x28fd: 0x0001, 0x28fe: 0x0001, 0x28ff: 0x0001, + // Block 0xa4, offset 0x2900 + 0x2900: 0x0001, 0x2901: 0x0001, 0x2902: 0x0001, 0x2903: 0x0001, 0x2904: 0x0001, 0x2905: 0x0001, + 0x2906: 0x0001, 0x2907: 0x0001, 0x2908: 0x0001, 0x2909: 0x0001, 0x290a: 0x0001, 0x290b: 0x0001, + 0x290c: 0x0001, 0x290d: 0x0001, 0x290e: 0x0001, 0x290f: 0x0001, 0x2910: 0x0001, 0x2911: 0x0001, + 0x2912: 0x0001, 0x2913: 0x0001, 0x2914: 0x0001, 0x2915: 0x0001, 0x2916: 0x0001, 0x2917: 0x0001, + 0x2918: 0x0001, 0x2919: 0x0001, 0x291a: 0x0001, 0x291b: 0x0001, 0x291c: 0x0001, 0x291d: 0x0001, + 0x291e: 0x0001, 0x291f: 0x0001, 0x2920: 0x0005, 0x2921: 0x0005, 0x2922: 0x0005, 0x2923: 0x0005, + 0x2924: 0x0005, 0x2925: 0x0005, 0x2926: 0x0005, 0x2927: 0x0005, 0x2928: 0x0005, 0x2929: 0x0005, + 0x292a: 0x0005, 0x292b: 0x0005, 0x292c: 0x0005, 0x292d: 0x0005, 0x292e: 0x0005, 0x292f: 0x0005, + 0x2930: 0x0005, 0x2931: 0x0005, 0x2932: 0x0005, 0x2933: 0x0005, 0x2934: 0x0005, 0x2935: 0x0005, + 0x2936: 0x0005, 0x2937: 0x0005, 0x2938: 0x0005, 0x2939: 0x0005, 0x293a: 0x0005, 0x293b: 0x0005, + 0x293c: 0x0005, 0x293d: 0x0005, 0x293e: 0x0005, 0x293f: 0x0001, + // Block 0xa5, offset 0x2940 + 0x2940: 0x0001, 0x2941: 0x0001, 0x2942: 0x0001, 0x2943: 0x0001, 0x2944: 0x0001, 0x2945: 0x0001, + 0x2946: 0x0001, 0x2947: 0x0001, 0x2948: 0x0001, 0x2949: 0x0001, 0x294a: 0x0001, 0x294b: 0x0001, + 0x294c: 0x0001, 0x294d: 0x0001, 0x294e: 0x0001, 0x294f: 0x0001, 0x2950: 0x0001, 0x2951: 0x0001, + 0x2952: 0x0001, 0x2953: 0x0001, 0x2954: 0x0001, 0x2955: 0x0001, 0x2956: 0x0001, 0x2957: 0x0001, + 0x2958: 0x0001, 0x2959: 0x0001, 0x295a: 0x0001, 0x295b: 0x0001, 0x295c: 0x0001, 0x295d: 0x0001, + 0x295e: 0x0001, 0x295f: 0x0001, 0x2960: 0x0001, 0x2961: 0x0001, 0x2962: 0x0001, 0x2963: 0x0001, + 0x2964: 0x0001, 0x2965: 0x0001, 0x2966: 0x0001, 0x2967: 0x0001, 0x2968: 0x0001, 0x2969: 0x0001, + 0x296a: 0x0001, 0x296b: 0x000c, 0x296c: 0x000c, 0x296d: 0x0001, 0x296e: 0x0001, 0x296f: 0x0001, + 0x2970: 0x0001, 0x2971: 0x0001, 0x2972: 0x0001, 0x2973: 0x0001, 0x2974: 0x0001, 0x2975: 0x0001, + 0x2976: 0x0001, 0x2977: 0x0001, 0x2978: 0x0001, 0x2979: 0x0001, 0x297a: 0x0001, 0x297b: 0x0001, + 0x297c: 0x0001, 0x297d: 0x0001, 0x297e: 0x0001, 0x297f: 0x0001, + // Block 0xa6, offset 0x2980 + 0x2980: 0x0001, 0x2981: 0x0001, 0x2982: 0x0001, 0x2983: 0x0001, 0x2984: 0x0001, 0x2985: 0x0001, + 0x2986: 0x0001, 0x2987: 0x0001, 0x2988: 0x0001, 0x2989: 0x0001, 0x298a: 0x0001, 0x298b: 0x0001, + 0x298c: 0x0001, 0x298d: 0x0001, 0x298e: 0x0001, 0x298f: 0x0001, 0x2990: 0x0001, 0x2991: 0x0001, + 0x2992: 0x0001, 0x2993: 0x0001, 0x2994: 0x0001, 0x2995: 0x0001, 0x2996: 0x0001, 0x2997: 0x0001, + 0x2998: 0x0001, 0x2999: 0x0001, 0x299a: 0x0001, 0x299b: 0x0001, 0x299c: 0x0001, 0x299d: 0x0001, + 0x299e: 0x0001, 0x299f: 0x0001, 0x29a0: 0x0001, 0x29a1: 0x0001, 0x29a2: 0x0001, 0x29a3: 0x0001, + 0x29a4: 0x0001, 0x29a5: 0x0001, 0x29a6: 0x0001, 0x29a7: 0x0001, 0x29a8: 0x0001, 0x29a9: 0x0001, + 0x29aa: 0x0001, 0x29ab: 0x0001, 0x29ac: 0x0001, 0x29ad: 0x0001, 0x29ae: 0x0001, 0x29af: 0x0001, + 0x29b0: 0x0001, 0x29b1: 0x0001, 0x29b2: 0x0001, 0x29b3: 0x0001, 0x29b4: 0x0001, 0x29b5: 0x0001, + 0x29b6: 0x0001, 0x29b7: 0x0001, 0x29b8: 0x0001, 0x29b9: 0x0001, 0x29ba: 0x0001, 0x29bb: 0x0001, + 0x29bc: 0x0001, 0x29bd: 0x000c, 0x29be: 0x000c, 0x29bf: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x0001, 0x29c1: 0x0001, 0x29c2: 0x0001, 0x29c3: 0x0001, 0x29c4: 0x0001, 0x29c5: 0x0001, + 0x29c6: 0x0001, 0x29c7: 0x0001, 0x29c8: 0x0001, 0x29c9: 0x0001, 0x29ca: 0x0001, 0x29cb: 0x0001, + 0x29cc: 0x0001, 0x29cd: 0x0001, 0x29ce: 0x0001, 0x29cf: 0x0001, 0x29d0: 0x0001, 0x29d1: 0x0001, + 0x29d2: 0x0001, 0x29d3: 0x0001, 0x29d4: 0x0001, 0x29d5: 0x0001, 0x29d6: 0x0001, 0x29d7: 0x0001, + 0x29d8: 0x0001, 0x29d9: 0x0001, 0x29da: 0x0001, 0x29db: 0x0001, 0x29dc: 0x0001, 0x29dd: 0x0001, + 0x29de: 0x0001, 0x29df: 0x0001, 0x29e0: 0x0001, 0x29e1: 0x0001, 0x29e2: 0x0001, 0x29e3: 0x0001, + 0x29e4: 0x0001, 0x29e5: 0x0001, 0x29e6: 0x0001, 0x29e7: 0x0001, 0x29e8: 0x0001, 0x29e9: 0x0001, + 0x29ea: 0x0001, 0x29eb: 0x0001, 0x29ec: 0x0001, 0x29ed: 0x0001, 0x29ee: 0x0001, 0x29ef: 0x0001, + 0x29f0: 0x000d, 0x29f1: 0x000d, 0x29f2: 0x000d, 0x29f3: 0x000d, 0x29f4: 0x000d, 0x29f5: 0x000d, + 0x29f6: 0x000d, 0x29f7: 0x000d, 0x29f8: 0x000d, 0x29f9: 0x000d, 0x29fa: 0x000d, 0x29fb: 0x000d, + 0x29fc: 0x000d, 0x29fd: 0x000d, 0x29fe: 0x000d, 0x29ff: 0x000d, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000d, 0x2a01: 0x000d, 0x2a02: 0x000d, 0x2a03: 0x000d, 0x2a04: 0x000d, 0x2a05: 0x000d, + 0x2a06: 0x000c, 0x2a07: 0x000c, 0x2a08: 0x000c, 0x2a09: 0x000c, 0x2a0a: 0x000c, 0x2a0b: 0x000c, + 0x2a0c: 0x000c, 0x2a0d: 0x000c, 0x2a0e: 0x000c, 0x2a0f: 0x000c, 0x2a10: 0x000c, 0x2a11: 0x000d, + 0x2a12: 0x000d, 0x2a13: 0x000d, 0x2a14: 0x000d, 0x2a15: 0x000d, 0x2a16: 0x000d, 0x2a17: 0x000d, + 0x2a18: 0x000d, 0x2a19: 0x000d, 0x2a1a: 0x0001, 0x2a1b: 0x0001, 0x2a1c: 0x0001, 0x2a1d: 0x0001, + 0x2a1e: 0x0001, 0x2a1f: 0x0001, 0x2a20: 0x0001, 0x2a21: 0x0001, 0x2a22: 0x0001, 0x2a23: 0x0001, + 0x2a24: 0x0001, 0x2a25: 0x0001, 0x2a26: 0x0001, 0x2a27: 0x0001, 0x2a28: 0x0001, 0x2a29: 0x0001, + 0x2a2a: 0x0001, 0x2a2b: 0x0001, 0x2a2c: 0x0001, 0x2a2d: 0x0001, 0x2a2e: 0x0001, 0x2a2f: 0x0001, + 0x2a30: 0x0001, 0x2a31: 0x0001, 0x2a32: 0x0001, 0x2a33: 0x0001, 0x2a34: 0x0001, 0x2a35: 0x0001, + 0x2a36: 0x0001, 0x2a37: 0x0001, 0x2a38: 0x0001, 0x2a39: 0x0001, 0x2a3a: 0x0001, 0x2a3b: 0x0001, + 0x2a3c: 0x0001, 0x2a3d: 0x0001, 0x2a3e: 0x0001, 0x2a3f: 0x0001, + // Block 0xa9, offset 0x2a40 + 0x2a40: 0x0001, 0x2a41: 0x0001, 0x2a42: 0x000c, 0x2a43: 0x000c, 0x2a44: 0x000c, 0x2a45: 0x000c, + 0x2a46: 0x0001, 0x2a47: 0x0001, 0x2a48: 0x0001, 0x2a49: 0x0001, 0x2a4a: 0x0001, 0x2a4b: 0x0001, + 0x2a4c: 0x0001, 0x2a4d: 0x0001, 0x2a4e: 0x0001, 0x2a4f: 0x0001, 0x2a50: 0x0001, 0x2a51: 0x0001, + 0x2a52: 0x0001, 0x2a53: 0x0001, 0x2a54: 0x0001, 0x2a55: 0x0001, 0x2a56: 0x0001, 0x2a57: 0x0001, + 0x2a58: 0x0001, 0x2a59: 0x0001, 0x2a5a: 0x0001, 0x2a5b: 0x0001, 0x2a5c: 0x0001, 0x2a5d: 0x0001, + 0x2a5e: 0x0001, 0x2a5f: 0x0001, 0x2a60: 0x0001, 0x2a61: 0x0001, 0x2a62: 0x0001, 0x2a63: 0x0001, + 0x2a64: 0x0001, 0x2a65: 0x0001, 0x2a66: 0x0001, 0x2a67: 0x0001, 0x2a68: 0x0001, 0x2a69: 0x0001, + 0x2a6a: 0x0001, 0x2a6b: 0x0001, 0x2a6c: 0x0001, 0x2a6d: 0x0001, 0x2a6e: 0x0001, 0x2a6f: 0x0001, + 0x2a70: 0x0001, 0x2a71: 0x0001, 0x2a72: 0x0001, 0x2a73: 0x0001, 0x2a74: 0x0001, 0x2a75: 0x0001, + 0x2a76: 0x0001, 0x2a77: 0x0001, 0x2a78: 0x0001, 0x2a79: 0x0001, 0x2a7a: 0x0001, 0x2a7b: 0x0001, + 0x2a7c: 0x0001, 0x2a7d: 0x0001, 0x2a7e: 0x0001, 0x2a7f: 0x0001, + // Block 0xaa, offset 0x2a80 + 0x2a81: 0x000c, + 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c, + 0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c, 0x2abf: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x000c, 0x2ac1: 0x000c, 0x2ac2: 0x000c, 0x2ac3: 0x000c, 0x2ac4: 0x000c, 0x2ac5: 0x000c, + 0x2ac6: 0x000c, + 0x2ad2: 0x000a, 0x2ad3: 0x000a, 0x2ad4: 0x000a, 0x2ad5: 0x000a, 0x2ad6: 0x000a, 0x2ad7: 0x000a, + 0x2ad8: 0x000a, 0x2ad9: 0x000a, 0x2ada: 0x000a, 0x2adb: 0x000a, 0x2adc: 0x000a, 0x2add: 0x000a, + 0x2ade: 0x000a, 0x2adf: 0x000a, 0x2ae0: 0x000a, 0x2ae1: 0x000a, 0x2ae2: 0x000a, 0x2ae3: 0x000a, + 0x2ae4: 0x000a, 0x2ae5: 0x000a, + 0x2af0: 0x000c, 0x2af3: 0x000c, 0x2af4: 0x000c, + 0x2aff: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, 0x2b01: 0x000c, + 0x2b33: 0x000c, 0x2b34: 0x000c, 0x2b35: 0x000c, + 0x2b36: 0x000c, 0x2b39: 0x000c, 0x2b3a: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x000c, 0x2b41: 0x000c, 0x2b42: 0x000c, + 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6d: 0x000c, 0x2b6e: 0x000c, 0x2b6f: 0x000c, + 0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2bb3: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bc0: 0x000c, 0x2bc1: 0x000c, + 0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c, + 0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c09: 0x000c, 0x2c0a: 0x000c, 0x2c0b: 0x000c, + 0x2c0c: 0x000c, 0x2c0f: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c6f: 0x000c, + 0x2c70: 0x000c, 0x2c71: 0x000c, 0x2c74: 0x000c, + 0x2c76: 0x000c, 0x2c77: 0x000c, + 0x2c7e: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c9f: 0x000c, 0x2ca3: 0x000c, + 0x2ca4: 0x000c, 0x2ca5: 0x000c, 0x2ca6: 0x000c, 0x2ca7: 0x000c, 0x2ca8: 0x000c, 0x2ca9: 0x000c, + 0x2caa: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x000c, + 0x2ce6: 0x000c, 0x2ce7: 0x000c, 0x2ce8: 0x000c, 0x2ce9: 0x000c, + 0x2cea: 0x000c, 0x2ceb: 0x000c, 0x2cec: 0x000c, + 0x2cf0: 0x000c, 0x2cf1: 0x000c, 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, 0x2d3b: 0x000c, + 0x2d3c: 0x000c, 0x2d3d: 0x000c, 0x2d3e: 0x000c, 0x2d3f: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d42: 0x000c, 0x2d43: 0x000c, 0x2d44: 0x000c, + 0x2d46: 0x000c, + 0x2d5e: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c, + 0x2db6: 0x000c, 0x2db7: 0x000c, 0x2db8: 0x000c, 0x2dba: 0x000c, + 0x2dbf: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2dc0: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c, + 0x2e3c: 0x000c, 0x2e3d: 0x000c, 0x2e3f: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e40: 0x000c, + 0x2e5c: 0x000c, 0x2e5d: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c, + 0x2ebd: 0x000c, 0x2ebf: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ec0: 0x000c, + 0x2ee0: 0x000a, 0x2ee1: 0x000a, 0x2ee2: 0x000a, 0x2ee3: 0x000a, + 0x2ee4: 0x000a, 0x2ee5: 0x000a, 0x2ee6: 0x000a, 0x2ee7: 0x000a, 0x2ee8: 0x000a, 0x2ee9: 0x000a, + 0x2eea: 0x000a, 0x2eeb: 0x000a, 0x2eec: 0x000a, + // Block 0xbc, offset 0x2f00 + 0x2f2b: 0x000c, 0x2f2d: 0x000c, + 0x2f30: 0x000c, 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c, + 0x2f37: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f5d: 0x000c, + 0x2f5e: 0x000c, 0x2f5f: 0x000c, 0x2f62: 0x000c, 0x2f63: 0x000c, + 0x2f64: 0x000c, 0x2f65: 0x000c, 0x2f67: 0x000c, 0x2f68: 0x000c, 0x2f69: 0x000c, + 0x2f6a: 0x000c, 0x2f6b: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2faf: 0x000c, + 0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, 0x2fb5: 0x000c, + 0x2fb6: 0x000c, 0x2fb7: 0x000c, 0x2fb9: 0x000c, 0x2fba: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ffb: 0x000c, + 0x2ffc: 0x000c, 0x2ffe: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3003: 0x000c, + // Block 0xc1, offset 0x3040 + 0x3054: 0x000c, 0x3055: 0x000c, 0x3056: 0x000c, 0x3057: 0x000c, + 0x305a: 0x000c, 0x305b: 0x000c, + 0x3060: 0x000c, + // Block 0xc2, offset 0x3080 + 0x3081: 0x000c, 0x3082: 0x000c, 0x3083: 0x000c, 0x3084: 0x000c, 0x3085: 0x000c, + 0x3086: 0x000c, 0x3089: 0x000c, 0x308a: 0x000c, + 0x30b3: 0x000c, 0x30b4: 0x000c, 0x30b5: 0x000c, + 0x30b6: 0x000c, 0x30b7: 0x000c, 0x30b8: 0x000c, 0x30bb: 0x000c, + 0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30c7: 0x000c, + 0x30d1: 0x000c, + 0x30d2: 0x000c, 0x30d3: 0x000c, 0x30d4: 0x000c, 0x30d5: 0x000c, 0x30d6: 0x000c, + 0x30d9: 0x000c, 0x30da: 0x000c, 0x30db: 0x000c, + // Block 0xc4, offset 0x3100 + 0x310a: 0x000c, 0x310b: 0x000c, + 0x310c: 0x000c, 0x310d: 0x000c, 0x310e: 0x000c, 0x310f: 0x000c, 0x3110: 0x000c, 0x3111: 0x000c, + 0x3112: 0x000c, 0x3113: 0x000c, 0x3114: 0x000c, 0x3115: 0x000c, 0x3116: 0x000c, + 0x3118: 0x000c, 0x3119: 0x000c, + // Block 0xc5, offset 0x3140 + 0x3170: 0x000c, 0x3171: 0x000c, 0x3172: 0x000c, 0x3173: 0x000c, 0x3174: 0x000c, 0x3175: 0x000c, + 0x3176: 0x000c, 0x3178: 0x000c, 0x3179: 0x000c, 0x317a: 0x000c, 0x317b: 0x000c, + 0x317c: 0x000c, 0x317d: 0x000c, + // Block 0xc6, offset 0x3180 + 0x3192: 0x000c, 0x3193: 0x000c, 0x3194: 0x000c, 0x3195: 0x000c, 0x3196: 0x000c, 0x3197: 0x000c, + 0x3198: 0x000c, 0x3199: 0x000c, 0x319a: 0x000c, 0x319b: 0x000c, 0x319c: 0x000c, 0x319d: 0x000c, + 0x319e: 0x000c, 0x319f: 0x000c, 0x31a0: 0x000c, 0x31a1: 0x000c, 0x31a2: 0x000c, 0x31a3: 0x000c, + 0x31a4: 0x000c, 0x31a5: 0x000c, 0x31a6: 0x000c, 0x31a7: 0x000c, + 0x31aa: 0x000c, 0x31ab: 0x000c, 0x31ac: 0x000c, 0x31ad: 0x000c, 0x31ae: 0x000c, 0x31af: 0x000c, + 0x31b0: 0x000c, 0x31b2: 0x000c, 0x31b3: 0x000c, 0x31b5: 0x000c, + 0x31b6: 0x000c, + // Block 0xc7, offset 0x31c0 + 0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c, + 0x31f6: 0x000c, 0x31fa: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c, + 0x3207: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3250: 0x000c, 0x3251: 0x000c, + 0x3255: 0x000c, 0x3257: 0x000c, + // Block 0xca, offset 0x3280 + 0x32b3: 0x000c, 0x32b4: 0x000c, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x000c, 0x32c1: 0x000c, + 0x32f6: 0x000c, 0x32f7: 0x000c, 0x32f8: 0x000c, 0x32f9: 0x000c, 0x32fa: 0x000c, + // Block 0xcc, offset 0x3300 + 0x3300: 0x000c, 0x3302: 0x000c, + // Block 0xcd, offset 0x3340 + 0x3355: 0x000a, 0x3356: 0x000a, 0x3357: 0x000a, + 0x3358: 0x000a, 0x3359: 0x000a, 0x335a: 0x000a, 0x335b: 0x000a, 0x335c: 0x000a, 0x335d: 0x0004, + 0x335e: 0x0004, 0x335f: 0x0004, 0x3360: 0x0004, 0x3361: 0x000a, 0x3362: 0x000a, 0x3363: 0x000a, + 0x3364: 0x000a, 0x3365: 0x000a, 0x3366: 0x000a, 0x3367: 0x000a, 0x3368: 0x000a, 0x3369: 0x000a, + 0x336a: 0x000a, 0x336b: 0x000a, 0x336c: 0x000a, 0x336d: 0x000a, 0x336e: 0x000a, 0x336f: 0x000a, + 0x3370: 0x000a, 0x3371: 0x000a, + // Block 0xce, offset 0x3380 + 0x3380: 0x000c, + 0x3387: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c, + 0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c, + 0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c, + // Block 0xcf, offset 0x33c0 + 0x33f0: 0x000c, 0x33f1: 0x000c, 0x33f2: 0x000c, 0x33f3: 0x000c, 0x33f4: 0x000c, + // Block 0xd0, offset 0x3400 + 0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c, + 0x3436: 0x000c, + // Block 0xd1, offset 0x3440 + 0x344f: 0x000c, + // Block 0xd2, offset 0x3480 + 0x348f: 0x000c, 0x3490: 0x000c, 0x3491: 0x000c, + 0x3492: 0x000c, + // Block 0xd3, offset 0x34c0 + 0x34e2: 0x000a, + 0x34e4: 0x000c, + // Block 0xd4, offset 0x3500 + 0x351d: 0x000c, + 0x351e: 0x000c, 0x3520: 0x000b, 0x3521: 0x000b, 0x3522: 0x000b, 0x3523: 0x000b, + // Block 0xd5, offset 0x3540 + 0x3540: 0x000c, 0x3541: 0x000c, 0x3542: 0x000c, 0x3543: 0x000c, 0x3544: 0x000c, 0x3545: 0x000c, + 0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x000c, + 0x354c: 0x000c, 0x354d: 0x000c, 0x354e: 0x000c, 0x354f: 0x000c, 0x3550: 0x000c, 0x3551: 0x000c, + 0x3552: 0x000c, 0x3553: 0x000c, 0x3554: 0x000c, 0x3555: 0x000c, 0x3556: 0x000c, 0x3557: 0x000c, + 0x3558: 0x000c, 0x3559: 0x000c, 0x355a: 0x000c, 0x355b: 0x000c, 0x355c: 0x000c, 0x355d: 0x000c, + 0x355e: 0x000c, 0x355f: 0x000c, 0x3560: 0x000c, 0x3561: 0x000c, 0x3562: 0x000c, 0x3563: 0x000c, + 0x3564: 0x000c, 0x3565: 0x000c, 0x3566: 0x000c, 0x3567: 0x000c, 0x3568: 0x000c, 0x3569: 0x000c, + 0x356a: 0x000c, 0x356b: 0x000c, 0x356c: 0x000c, 0x356d: 0x000c, + 0x3570: 0x000c, 0x3571: 0x000c, 0x3572: 0x000c, 0x3573: 0x000c, 0x3574: 0x000c, 0x3575: 0x000c, + 0x3576: 0x000c, 0x3577: 0x000c, 0x3578: 0x000c, 0x3579: 0x000c, 0x357a: 0x000c, 0x357b: 0x000c, + 0x357c: 0x000c, 0x357d: 0x000c, 0x357e: 0x000c, 0x357f: 0x000c, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000c, 0x3581: 0x000c, 0x3582: 0x000c, 0x3583: 0x000c, 0x3584: 0x000c, 0x3585: 0x000c, + 0x3586: 0x000c, + // Block 0xd7, offset 0x35c0 + 0x35e7: 0x000c, 0x35e8: 0x000c, 0x35e9: 0x000c, + 0x35f3: 0x000b, 0x35f4: 0x000b, 0x35f5: 0x000b, + 0x35f6: 0x000b, 0x35f7: 0x000b, 0x35f8: 0x000b, 0x35f9: 0x000b, 0x35fa: 0x000b, 0x35fb: 0x000c, + 0x35fc: 0x000c, 0x35fd: 0x000c, 0x35fe: 0x000c, 0x35ff: 0x000c, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000c, 0x3601: 0x000c, 0x3602: 0x000c, 0x3605: 0x000c, + 0x3606: 0x000c, 0x3607: 0x000c, 0x3608: 0x000c, 0x3609: 0x000c, 0x360a: 0x000c, 0x360b: 0x000c, + 0x362a: 0x000c, 0x362b: 0x000c, 0x362c: 0x000c, 0x362d: 0x000c, + // Block 0xd9, offset 0x3640 + 0x3669: 0x000a, + 0x366a: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000c, 0x3683: 0x000c, 0x3684: 0x000c, 0x3685: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a, + 0x36c6: 0x000a, 0x36c7: 0x000a, 0x36c8: 0x000a, 0x36c9: 0x000a, 0x36ca: 0x000a, 0x36cb: 0x000a, + 0x36cc: 0x000a, 0x36cd: 0x000a, 0x36ce: 0x000a, 0x36cf: 0x000a, 0x36d0: 0x000a, 0x36d1: 0x000a, + 0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a, + // Block 0xdc, offset 0x3700 + 0x371b: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3755: 0x000a, + // Block 0xde, offset 0x3780 + 0x378f: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c9: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3803: 0x000a, + 0x380e: 0x0002, 0x380f: 0x0002, 0x3810: 0x0002, 0x3811: 0x0002, + 0x3812: 0x0002, 0x3813: 0x0002, 0x3814: 0x0002, 0x3815: 0x0002, 0x3816: 0x0002, 0x3817: 0x0002, + 0x3818: 0x0002, 0x3819: 0x0002, 0x381a: 0x0002, 0x381b: 0x0002, 0x381c: 0x0002, 0x381d: 0x0002, + 0x381e: 0x0002, 0x381f: 0x0002, 0x3820: 0x0002, 0x3821: 0x0002, 0x3822: 0x0002, 0x3823: 0x0002, + 0x3824: 0x0002, 0x3825: 0x0002, 0x3826: 0x0002, 0x3827: 0x0002, 0x3828: 0x0002, 0x3829: 0x0002, + 0x382a: 0x0002, 0x382b: 0x0002, 0x382c: 0x0002, 0x382d: 0x0002, 0x382e: 0x0002, 0x382f: 0x0002, + 0x3830: 0x0002, 0x3831: 0x0002, 0x3832: 0x0002, 0x3833: 0x0002, 0x3834: 0x0002, 0x3835: 0x0002, + 0x3836: 0x0002, 0x3837: 0x0002, 0x3838: 0x0002, 0x3839: 0x0002, 0x383a: 0x0002, 0x383b: 0x0002, + 0x383c: 0x0002, 0x383d: 0x0002, 0x383e: 0x0002, 0x383f: 0x0002, + // Block 0xe1, offset 0x3840 + 0x3840: 0x000c, 0x3841: 0x000c, 0x3842: 0x000c, 0x3843: 0x000c, 0x3844: 0x000c, 0x3845: 0x000c, + 0x3846: 0x000c, 0x3847: 0x000c, 0x3848: 0x000c, 0x3849: 0x000c, 0x384a: 0x000c, 0x384b: 0x000c, + 0x384c: 0x000c, 0x384d: 0x000c, 0x384e: 0x000c, 0x384f: 0x000c, 0x3850: 0x000c, 0x3851: 0x000c, + 0x3852: 0x000c, 0x3853: 0x000c, 0x3854: 0x000c, 0x3855: 0x000c, 0x3856: 0x000c, 0x3857: 0x000c, + 0x3858: 0x000c, 0x3859: 0x000c, 0x385a: 0x000c, 0x385b: 0x000c, 0x385c: 0x000c, 0x385d: 0x000c, + 0x385e: 0x000c, 0x385f: 0x000c, 0x3860: 0x000c, 0x3861: 0x000c, 0x3862: 0x000c, 0x3863: 0x000c, + 0x3864: 0x000c, 0x3865: 0x000c, 0x3866: 0x000c, 0x3867: 0x000c, 0x3868: 0x000c, 0x3869: 0x000c, + 0x386a: 0x000c, 0x386b: 0x000c, 0x386c: 0x000c, 0x386d: 0x000c, 0x386e: 0x000c, 0x386f: 0x000c, + 0x3870: 0x000c, 0x3871: 0x000c, 0x3872: 0x000c, 0x3873: 0x000c, 0x3874: 0x000c, 0x3875: 0x000c, + 0x3876: 0x000c, 0x387b: 0x000c, + 0x387c: 0x000c, 0x387d: 0x000c, 0x387e: 0x000c, 0x387f: 0x000c, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000c, 0x3881: 0x000c, 0x3882: 0x000c, 0x3883: 0x000c, 0x3884: 0x000c, 0x3885: 0x000c, + 0x3886: 0x000c, 0x3887: 0x000c, 0x3888: 0x000c, 0x3889: 0x000c, 0x388a: 0x000c, 0x388b: 0x000c, + 0x388c: 0x000c, 0x388d: 0x000c, 0x388e: 0x000c, 0x388f: 0x000c, 0x3890: 0x000c, 0x3891: 0x000c, + 0x3892: 0x000c, 0x3893: 0x000c, 0x3894: 0x000c, 0x3895: 0x000c, 0x3896: 0x000c, 0x3897: 0x000c, + 0x3898: 0x000c, 0x3899: 0x000c, 0x389a: 0x000c, 0x389b: 0x000c, 0x389c: 0x000c, 0x389d: 0x000c, + 0x389e: 0x000c, 0x389f: 0x000c, 0x38a0: 0x000c, 0x38a1: 0x000c, 0x38a2: 0x000c, 0x38a3: 0x000c, + 0x38a4: 0x000c, 0x38a5: 0x000c, 0x38a6: 0x000c, 0x38a7: 0x000c, 0x38a8: 0x000c, 0x38a9: 0x000c, + 0x38aa: 0x000c, 0x38ab: 0x000c, 0x38ac: 0x000c, + 0x38b5: 0x000c, + // Block 0xe3, offset 0x38c0 + 0x38c4: 0x000c, + 0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c, + 0x38de: 0x000c, 0x38df: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c, + 0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c, + 0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c, + // Block 0xe4, offset 0x3900 + 0x3900: 0x000c, 0x3901: 0x000c, 0x3902: 0x000c, 0x3903: 0x000c, 0x3904: 0x000c, 0x3905: 0x000c, + 0x3906: 0x000c, 0x3908: 0x000c, 0x3909: 0x000c, 0x390a: 0x000c, 0x390b: 0x000c, + 0x390c: 0x000c, 0x390d: 0x000c, 0x390e: 0x000c, 0x390f: 0x000c, 0x3910: 0x000c, 0x3911: 0x000c, + 0x3912: 0x000c, 0x3913: 0x000c, 0x3914: 0x000c, 0x3915: 0x000c, 0x3916: 0x000c, 0x3917: 0x000c, + 0x3918: 0x000c, 0x391b: 0x000c, 0x391c: 0x000c, 0x391d: 0x000c, + 0x391e: 0x000c, 0x391f: 0x000c, 0x3920: 0x000c, 0x3921: 0x000c, 0x3923: 0x000c, + 0x3924: 0x000c, 0x3926: 0x000c, 0x3927: 0x000c, 0x3928: 0x000c, 0x3929: 0x000c, + 0x392a: 0x000c, + // Block 0xe5, offset 0x3940 + 0x396e: 0x000c, + // Block 0xe6, offset 0x3980 + 0x39ac: 0x000c, 0x39ad: 0x000c, 0x39ae: 0x000c, 0x39af: 0x000c, + 0x39bf: 0x0004, + // Block 0xe7, offset 0x39c0 + 0x39ec: 0x000c, 0x39ed: 0x000c, 0x39ee: 0x000c, 0x39ef: 0x000c, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x0001, 0x3a01: 0x0001, 0x3a02: 0x0001, 0x3a03: 0x0001, 0x3a04: 0x0001, 0x3a05: 0x0001, + 0x3a06: 0x0001, 0x3a07: 0x0001, 0x3a08: 0x0001, 0x3a09: 0x0001, 0x3a0a: 0x0001, 0x3a0b: 0x0001, + 0x3a0c: 0x0001, 0x3a0d: 0x0001, 0x3a0e: 0x0001, 0x3a0f: 0x0001, 0x3a10: 0x000c, 0x3a11: 0x000c, + 0x3a12: 0x000c, 0x3a13: 0x000c, 0x3a14: 0x000c, 0x3a15: 0x000c, 0x3a16: 0x000c, 0x3a17: 0x0001, + 0x3a18: 0x0001, 0x3a19: 0x0001, 0x3a1a: 0x0001, 0x3a1b: 0x0001, 0x3a1c: 0x0001, 0x3a1d: 0x0001, + 0x3a1e: 0x0001, 0x3a1f: 0x0001, 0x3a20: 0x0001, 0x3a21: 0x0001, 0x3a22: 0x0001, 0x3a23: 0x0001, + 0x3a24: 0x0001, 0x3a25: 0x0001, 0x3a26: 0x0001, 0x3a27: 0x0001, 0x3a28: 0x0001, 0x3a29: 0x0001, + 0x3a2a: 0x0001, 0x3a2b: 0x0001, 0x3a2c: 0x0001, 0x3a2d: 0x0001, 0x3a2e: 0x0001, 0x3a2f: 0x0001, + 0x3a30: 0x0001, 0x3a31: 0x0001, 0x3a32: 0x0001, 0x3a33: 0x0001, 0x3a34: 0x0001, 0x3a35: 0x0001, + 0x3a36: 0x0001, 0x3a37: 0x0001, 0x3a38: 0x0001, 0x3a39: 0x0001, 0x3a3a: 0x0001, 0x3a3b: 0x0001, + 0x3a3c: 0x0001, 0x3a3d: 0x0001, 0x3a3e: 0x0001, 0x3a3f: 0x0001, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x0001, 0x3a41: 0x0001, 0x3a42: 0x0001, 0x3a43: 0x0001, 0x3a44: 0x000c, 0x3a45: 0x000c, + 0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x0001, + 0x3a4c: 0x0001, 0x3a4d: 0x0001, 0x3a4e: 0x0001, 0x3a4f: 0x0001, 0x3a50: 0x0001, 0x3a51: 0x0001, + 0x3a52: 0x0001, 0x3a53: 0x0001, 0x3a54: 0x0001, 0x3a55: 0x0001, 0x3a56: 0x0001, 0x3a57: 0x0001, + 0x3a58: 0x0001, 0x3a59: 0x0001, 0x3a5a: 0x0001, 0x3a5b: 0x0001, 0x3a5c: 0x0001, 0x3a5d: 0x0001, + 0x3a5e: 0x0001, 0x3a5f: 0x0001, 0x3a60: 0x0001, 0x3a61: 0x0001, 0x3a62: 0x0001, 0x3a63: 0x0001, + 0x3a64: 0x0001, 0x3a65: 0x0001, 0x3a66: 0x0001, 0x3a67: 0x0001, 0x3a68: 0x0001, 0x3a69: 0x0001, + 0x3a6a: 0x0001, 0x3a6b: 0x0001, 0x3a6c: 0x0001, 0x3a6d: 0x0001, 0x3a6e: 0x0001, 0x3a6f: 0x0001, + 0x3a70: 0x0001, 0x3a71: 0x0001, 0x3a72: 0x0001, 0x3a73: 0x0001, 0x3a74: 0x0001, 0x3a75: 0x0001, + 0x3a76: 0x0001, 0x3a77: 0x0001, 0x3a78: 0x0001, 0x3a79: 0x0001, 0x3a7a: 0x0001, 0x3a7b: 0x0001, + 0x3a7c: 0x0001, 0x3a7d: 0x0001, 0x3a7e: 0x0001, 0x3a7f: 0x0001, + // Block 0xea, offset 0x3a80 + 0x3a80: 0x0001, 0x3a81: 0x0001, 0x3a82: 0x0001, 0x3a83: 0x0001, 0x3a84: 0x0001, 0x3a85: 0x0001, + 0x3a86: 0x0001, 0x3a87: 0x0001, 0x3a88: 0x0001, 0x3a89: 0x0001, 0x3a8a: 0x0001, 0x3a8b: 0x0001, + 0x3a8c: 0x0001, 0x3a8d: 0x0001, 0x3a8e: 0x0001, 0x3a8f: 0x0001, 0x3a90: 0x0001, 0x3a91: 0x0001, + 0x3a92: 0x0001, 0x3a93: 0x0001, 0x3a94: 0x0001, 0x3a95: 0x0001, 0x3a96: 0x0001, 0x3a97: 0x0001, + 0x3a98: 0x0001, 0x3a99: 0x0001, 0x3a9a: 0x0001, 0x3a9b: 0x0001, 0x3a9c: 0x0001, 0x3a9d: 0x0001, + 0x3a9e: 0x0001, 0x3a9f: 0x0001, 0x3aa0: 0x0001, 0x3aa1: 0x0001, 0x3aa2: 0x0001, 0x3aa3: 0x0001, + 0x3aa4: 0x0001, 0x3aa5: 0x0001, 0x3aa6: 0x0001, 0x3aa7: 0x0001, 0x3aa8: 0x0001, 0x3aa9: 0x0001, + 0x3aaa: 0x0001, 0x3aab: 0x0001, 0x3aac: 0x0001, 0x3aad: 0x0001, 0x3aae: 0x0001, 0x3aaf: 0x0001, + 0x3ab0: 0x0001, 0x3ab1: 0x000d, 0x3ab2: 0x000d, 0x3ab3: 0x000d, 0x3ab4: 0x000d, 0x3ab5: 0x000d, + 0x3ab6: 0x000d, 0x3ab7: 0x000d, 0x3ab8: 0x000d, 0x3ab9: 0x000d, 0x3aba: 0x000d, 0x3abb: 0x000d, + 0x3abc: 0x000d, 0x3abd: 0x000d, 0x3abe: 0x000d, 0x3abf: 0x000d, + // Block 0xeb, offset 0x3ac0 + 0x3ac0: 0x000d, 0x3ac1: 0x000d, 0x3ac2: 0x000d, 0x3ac3: 0x000d, 0x3ac4: 0x000d, 0x3ac5: 0x000d, + 0x3ac6: 0x000d, 0x3ac7: 0x000d, 0x3ac8: 0x000d, 0x3ac9: 0x000d, 0x3aca: 0x000d, 0x3acb: 0x000d, + 0x3acc: 0x000d, 0x3acd: 0x000d, 0x3ace: 0x000d, 0x3acf: 0x000d, 0x3ad0: 0x000d, 0x3ad1: 0x000d, + 0x3ad2: 0x000d, 0x3ad3: 0x000d, 0x3ad4: 0x000d, 0x3ad5: 0x000d, 0x3ad6: 0x000d, 0x3ad7: 0x000d, + 0x3ad8: 0x000d, 0x3ad9: 0x000d, 0x3ada: 0x000d, 0x3adb: 0x000d, 0x3adc: 0x000d, 0x3add: 0x000d, + 0x3ade: 0x000d, 0x3adf: 0x000d, 0x3ae0: 0x000d, 0x3ae1: 0x000d, 0x3ae2: 0x000d, 0x3ae3: 0x000d, + 0x3ae4: 0x000d, 0x3ae5: 0x000d, 0x3ae6: 0x000d, 0x3ae7: 0x000d, 0x3ae8: 0x000d, 0x3ae9: 0x000d, + 0x3aea: 0x000d, 0x3aeb: 0x000d, 0x3aec: 0x000d, 0x3aed: 0x000d, 0x3aee: 0x000d, 0x3aef: 0x000d, + 0x3af0: 0x000d, 0x3af1: 0x000d, 0x3af2: 0x000d, 0x3af3: 0x000d, 0x3af4: 0x000d, 0x3af5: 0x0001, + 0x3af6: 0x0001, 0x3af7: 0x0001, 0x3af8: 0x0001, 0x3af9: 0x0001, 0x3afa: 0x0001, 0x3afb: 0x0001, + 0x3afc: 0x0001, 0x3afd: 0x0001, 0x3afe: 0x0001, 0x3aff: 0x0001, + // Block 0xec, offset 0x3b00 + 0x3b00: 0x0001, 0x3b01: 0x000d, 0x3b02: 0x000d, 0x3b03: 0x000d, 0x3b04: 0x000d, 0x3b05: 0x000d, + 0x3b06: 0x000d, 0x3b07: 0x000d, 0x3b08: 0x000d, 0x3b09: 0x000d, 0x3b0a: 0x000d, 0x3b0b: 0x000d, + 0x3b0c: 0x000d, 0x3b0d: 0x000d, 0x3b0e: 0x000d, 0x3b0f: 0x000d, 0x3b10: 0x000d, 0x3b11: 0x000d, + 0x3b12: 0x000d, 0x3b13: 0x000d, 0x3b14: 0x000d, 0x3b15: 0x000d, 0x3b16: 0x000d, 0x3b17: 0x000d, + 0x3b18: 0x000d, 0x3b19: 0x000d, 0x3b1a: 0x000d, 0x3b1b: 0x000d, 0x3b1c: 0x000d, 0x3b1d: 0x000d, + 0x3b1e: 0x000d, 0x3b1f: 0x000d, 0x3b20: 0x000d, 0x3b21: 0x000d, 0x3b22: 0x000d, 0x3b23: 0x000d, + 0x3b24: 0x000d, 0x3b25: 0x000d, 0x3b26: 0x000d, 0x3b27: 0x000d, 0x3b28: 0x000d, 0x3b29: 0x000d, + 0x3b2a: 0x000d, 0x3b2b: 0x000d, 0x3b2c: 0x000d, 0x3b2d: 0x000d, 0x3b2e: 0x000d, 0x3b2f: 0x000d, + 0x3b30: 0x000d, 0x3b31: 0x000d, 0x3b32: 0x000d, 0x3b33: 0x000d, 0x3b34: 0x000d, 0x3b35: 0x000d, + 0x3b36: 0x000d, 0x3b37: 0x000d, 0x3b38: 0x000d, 0x3b39: 0x000d, 0x3b3a: 0x000d, 0x3b3b: 0x000d, + 0x3b3c: 0x000d, 0x3b3d: 0x000d, 0x3b3e: 0x0001, 0x3b3f: 0x0001, + // Block 0xed, offset 0x3b40 + 0x3b40: 0x000d, 0x3b41: 0x000d, 0x3b42: 0x000d, 0x3b43: 0x000d, 0x3b44: 0x000d, 0x3b45: 0x000d, + 0x3b46: 0x000d, 0x3b47: 0x000d, 0x3b48: 0x000d, 0x3b49: 0x000d, 0x3b4a: 0x000d, 0x3b4b: 0x000d, + 0x3b4c: 0x000d, 0x3b4d: 0x000d, 0x3b4e: 0x000d, 0x3b4f: 0x000d, 0x3b50: 0x000d, 0x3b51: 0x000d, + 0x3b52: 0x000d, 0x3b53: 0x000d, 0x3b54: 0x000d, 0x3b55: 0x000d, 0x3b56: 0x000d, 0x3b57: 0x000d, + 0x3b58: 0x000d, 0x3b59: 0x000d, 0x3b5a: 0x000d, 0x3b5b: 0x000d, 0x3b5c: 0x000d, 0x3b5d: 0x000d, + 0x3b5e: 0x000d, 0x3b5f: 0x000d, 0x3b60: 0x000d, 0x3b61: 0x000d, 0x3b62: 0x000d, 0x3b63: 0x000d, + 0x3b64: 0x000d, 0x3b65: 0x000d, 0x3b66: 0x000d, 0x3b67: 0x000d, 0x3b68: 0x000d, 0x3b69: 0x000d, + 0x3b6a: 0x000d, 0x3b6b: 0x000d, 0x3b6c: 0x000d, 0x3b6d: 0x000d, 0x3b6e: 0x000d, 0x3b6f: 0x000d, + 0x3b70: 0x000a, 0x3b71: 0x000a, 0x3b72: 0x000d, 0x3b73: 0x000d, 0x3b74: 0x000d, 0x3b75: 0x000d, + 0x3b76: 0x000d, 0x3b77: 0x000d, 0x3b78: 0x000d, 0x3b79: 0x000d, 0x3b7a: 0x000d, 0x3b7b: 0x000d, + 0x3b7c: 0x000d, 0x3b7d: 0x000d, 0x3b7e: 0x000d, 0x3b7f: 0x000d, + // Block 0xee, offset 0x3b80 + 0x3b80: 0x000a, 0x3b81: 0x000a, 0x3b82: 0x000a, 0x3b83: 0x000a, 0x3b84: 0x000a, 0x3b85: 0x000a, + 0x3b86: 0x000a, 0x3b87: 0x000a, 0x3b88: 0x000a, 0x3b89: 0x000a, 0x3b8a: 0x000a, 0x3b8b: 0x000a, + 0x3b8c: 0x000a, 0x3b8d: 0x000a, 0x3b8e: 0x000a, 0x3b8f: 0x000a, 0x3b90: 0x000a, 0x3b91: 0x000a, + 0x3b92: 0x000a, 0x3b93: 0x000a, 0x3b94: 0x000a, 0x3b95: 0x000a, 0x3b96: 0x000a, 0x3b97: 0x000a, + 0x3b98: 0x000a, 0x3b99: 0x000a, 0x3b9a: 0x000a, 0x3b9b: 0x000a, 0x3b9c: 0x000a, 0x3b9d: 0x000a, + 0x3b9e: 0x000a, 0x3b9f: 0x000a, 0x3ba0: 0x000a, 0x3ba1: 0x000a, 0x3ba2: 0x000a, 0x3ba3: 0x000a, + 0x3ba4: 0x000a, 0x3ba5: 0x000a, 0x3ba6: 0x000a, 0x3ba7: 0x000a, 0x3ba8: 0x000a, 0x3ba9: 0x000a, + 0x3baa: 0x000a, 0x3bab: 0x000a, + 0x3bb0: 0x000a, 0x3bb1: 0x000a, 0x3bb2: 0x000a, 0x3bb3: 0x000a, 0x3bb4: 0x000a, 0x3bb5: 0x000a, + 0x3bb6: 0x000a, 0x3bb7: 0x000a, 0x3bb8: 0x000a, 0x3bb9: 0x000a, 0x3bba: 0x000a, 0x3bbb: 0x000a, + 0x3bbc: 0x000a, 0x3bbd: 0x000a, 0x3bbe: 0x000a, 0x3bbf: 0x000a, + // Block 0xef, offset 0x3bc0 + 0x3bc0: 0x000a, 0x3bc1: 0x000a, 0x3bc2: 0x000a, 0x3bc3: 0x000a, 0x3bc4: 0x000a, 0x3bc5: 0x000a, + 0x3bc6: 0x000a, 0x3bc7: 0x000a, 0x3bc8: 0x000a, 0x3bc9: 0x000a, 0x3bca: 0x000a, 0x3bcb: 0x000a, + 0x3bcc: 0x000a, 0x3bcd: 0x000a, 0x3bce: 0x000a, 0x3bcf: 0x000a, 0x3bd0: 0x000a, 0x3bd1: 0x000a, + 0x3bd2: 0x000a, 0x3bd3: 0x000a, + 0x3be0: 0x000a, 0x3be1: 0x000a, 0x3be2: 0x000a, 0x3be3: 0x000a, + 0x3be4: 0x000a, 0x3be5: 0x000a, 0x3be6: 0x000a, 0x3be7: 0x000a, 0x3be8: 0x000a, 0x3be9: 0x000a, + 0x3bea: 0x000a, 0x3beb: 0x000a, 0x3bec: 0x000a, 0x3bed: 0x000a, 0x3bee: 0x000a, + 0x3bf1: 0x000a, 0x3bf2: 0x000a, 0x3bf3: 0x000a, 0x3bf4: 0x000a, 0x3bf5: 0x000a, + 0x3bf6: 0x000a, 0x3bf7: 0x000a, 0x3bf8: 0x000a, 0x3bf9: 0x000a, 0x3bfa: 0x000a, 0x3bfb: 0x000a, + 0x3bfc: 0x000a, 0x3bfd: 0x000a, 0x3bfe: 0x000a, 0x3bff: 0x000a, + // Block 0xf0, offset 0x3c00 + 0x3c01: 0x000a, 0x3c02: 0x000a, 0x3c03: 0x000a, 0x3c04: 0x000a, 0x3c05: 0x000a, + 0x3c06: 0x000a, 0x3c07: 0x000a, 0x3c08: 0x000a, 0x3c09: 0x000a, 0x3c0a: 0x000a, 0x3c0b: 0x000a, + 0x3c0c: 0x000a, 0x3c0d: 0x000a, 0x3c0e: 0x000a, 0x3c0f: 0x000a, 0x3c11: 0x000a, + 0x3c12: 0x000a, 0x3c13: 0x000a, 0x3c14: 0x000a, 0x3c15: 0x000a, 0x3c16: 0x000a, 0x3c17: 0x000a, + 0x3c18: 0x000a, 0x3c19: 0x000a, 0x3c1a: 0x000a, 0x3c1b: 0x000a, 0x3c1c: 0x000a, 0x3c1d: 0x000a, + 0x3c1e: 0x000a, 0x3c1f: 0x000a, 0x3c20: 0x000a, 0x3c21: 0x000a, 0x3c22: 0x000a, 0x3c23: 0x000a, + 0x3c24: 0x000a, 0x3c25: 0x000a, 0x3c26: 0x000a, 0x3c27: 0x000a, 0x3c28: 0x000a, 0x3c29: 0x000a, + 0x3c2a: 0x000a, 0x3c2b: 0x000a, 0x3c2c: 0x000a, 0x3c2d: 0x000a, 0x3c2e: 0x000a, 0x3c2f: 0x000a, + 0x3c30: 0x000a, 0x3c31: 0x000a, 0x3c32: 0x000a, 0x3c33: 0x000a, 0x3c34: 0x000a, 0x3c35: 0x000a, + // Block 0xf1, offset 0x3c40 + 0x3c40: 0x0002, 0x3c41: 0x0002, 0x3c42: 0x0002, 0x3c43: 0x0002, 0x3c44: 0x0002, 0x3c45: 0x0002, + 0x3c46: 0x0002, 0x3c47: 0x0002, 0x3c48: 0x0002, 0x3c49: 0x0002, 0x3c4a: 0x0002, 0x3c4b: 0x000a, + 0x3c4c: 0x000a, 0x3c4d: 0x000a, 0x3c4e: 0x000a, 0x3c4f: 0x000a, + 0x3c6f: 0x000a, + // Block 0xf2, offset 0x3c80 + 0x3caa: 0x000a, 0x3cab: 0x000a, 0x3cac: 0x000a, 0x3cad: 0x000a, 0x3cae: 0x000a, 0x3caf: 0x000a, + // Block 0xf3, offset 0x3cc0 + 0x3ced: 0x000a, + // Block 0xf4, offset 0x3d00 + 0x3d20: 0x000a, 0x3d21: 0x000a, 0x3d22: 0x000a, 0x3d23: 0x000a, + 0x3d24: 0x000a, 0x3d25: 0x000a, + // Block 0xf5, offset 0x3d40 + 0x3d40: 0x000a, 0x3d41: 0x000a, 0x3d42: 0x000a, 0x3d43: 0x000a, 0x3d44: 0x000a, 0x3d45: 0x000a, + 0x3d46: 0x000a, 0x3d47: 0x000a, 0x3d48: 0x000a, 0x3d49: 0x000a, 0x3d4a: 0x000a, 0x3d4b: 0x000a, + 0x3d4c: 0x000a, 0x3d4d: 0x000a, 0x3d4e: 0x000a, 0x3d4f: 0x000a, 0x3d50: 0x000a, 0x3d51: 0x000a, + 0x3d52: 0x000a, 0x3d53: 0x000a, 0x3d54: 0x000a, 0x3d55: 0x000a, 0x3d56: 0x000a, 0x3d57: 0x000a, + 0x3d5c: 0x000a, 0x3d5d: 0x000a, + 0x3d5e: 0x000a, 0x3d5f: 0x000a, 0x3d60: 0x000a, 0x3d61: 0x000a, 0x3d62: 0x000a, 0x3d63: 0x000a, + 0x3d64: 0x000a, 0x3d65: 0x000a, 0x3d66: 0x000a, 0x3d67: 0x000a, 0x3d68: 0x000a, 0x3d69: 0x000a, + 0x3d6a: 0x000a, 0x3d6b: 0x000a, 0x3d6c: 0x000a, + 0x3d70: 0x000a, 0x3d71: 0x000a, 0x3d72: 0x000a, 0x3d73: 0x000a, 0x3d74: 0x000a, 0x3d75: 0x000a, + 0x3d76: 0x000a, 0x3d77: 0x000a, 0x3d78: 0x000a, 0x3d79: 0x000a, 0x3d7a: 0x000a, 0x3d7b: 0x000a, + 0x3d7c: 0x000a, + // Block 0xf6, offset 0x3d80 + 0x3d80: 0x000a, 0x3d81: 0x000a, 0x3d82: 0x000a, 0x3d83: 0x000a, 0x3d84: 0x000a, 0x3d85: 0x000a, + 0x3d86: 0x000a, 0x3d87: 0x000a, 0x3d88: 0x000a, 0x3d89: 0x000a, 0x3d8a: 0x000a, 0x3d8b: 0x000a, + 0x3d8c: 0x000a, 0x3d8d: 0x000a, 0x3d8e: 0x000a, 0x3d8f: 0x000a, 0x3d90: 0x000a, 0x3d91: 0x000a, + 0x3d92: 0x000a, 0x3d93: 0x000a, 0x3d94: 0x000a, 0x3d95: 0x000a, 0x3d96: 0x000a, 0x3d97: 0x000a, + 0x3d98: 0x000a, 0x3d99: 0x000a, 0x3d9a: 0x000a, 0x3d9b: 0x000a, 0x3d9c: 0x000a, 0x3d9d: 0x000a, + 0x3d9e: 0x000a, 0x3d9f: 0x000a, 0x3da0: 0x000a, 0x3da1: 0x000a, 0x3da2: 0x000a, 0x3da3: 0x000a, + 0x3da4: 0x000a, 0x3da5: 0x000a, 0x3da6: 0x000a, 0x3da7: 0x000a, 0x3da8: 0x000a, 0x3da9: 0x000a, + 0x3daa: 0x000a, 0x3dab: 0x000a, 0x3dac: 0x000a, 0x3dad: 0x000a, 0x3dae: 0x000a, 0x3daf: 0x000a, + 0x3db0: 0x000a, 0x3db1: 0x000a, 0x3db2: 0x000a, 0x3db3: 0x000a, 0x3db4: 0x000a, 0x3db5: 0x000a, + 0x3db6: 0x000a, 0x3dbb: 0x000a, + 0x3dbc: 0x000a, 0x3dbd: 0x000a, 0x3dbe: 0x000a, 0x3dbf: 0x000a, + // Block 0xf7, offset 0x3dc0 + 0x3dc0: 0x000a, 0x3dc1: 0x000a, 0x3dc2: 0x000a, 0x3dc3: 0x000a, 0x3dc4: 0x000a, 0x3dc5: 0x000a, + 0x3dc6: 0x000a, 0x3dc7: 0x000a, 0x3dc8: 0x000a, 0x3dc9: 0x000a, 0x3dca: 0x000a, 0x3dcb: 0x000a, + 0x3dcc: 0x000a, 0x3dcd: 0x000a, 0x3dce: 0x000a, 0x3dcf: 0x000a, 0x3dd0: 0x000a, 0x3dd1: 0x000a, + 0x3dd2: 0x000a, 0x3dd3: 0x000a, 0x3dd4: 0x000a, 0x3dd5: 0x000a, 0x3dd6: 0x000a, 0x3dd7: 0x000a, + 0x3dd8: 0x000a, 0x3dd9: 0x000a, + 0x3de0: 0x000a, 0x3de1: 0x000a, 0x3de2: 0x000a, 0x3de3: 0x000a, + 0x3de4: 0x000a, 0x3de5: 0x000a, 0x3de6: 0x000a, 0x3de7: 0x000a, 0x3de8: 0x000a, 0x3de9: 0x000a, + 0x3dea: 0x000a, 0x3deb: 0x000a, + 0x3df0: 0x000a, + // Block 0xf8, offset 0x3e00 + 0x3e00: 0x000a, 0x3e01: 0x000a, 0x3e02: 0x000a, 0x3e03: 0x000a, 0x3e04: 0x000a, 0x3e05: 0x000a, + 0x3e06: 0x000a, 0x3e07: 0x000a, 0x3e08: 0x000a, 0x3e09: 0x000a, 0x3e0a: 0x000a, 0x3e0b: 0x000a, + 0x3e10: 0x000a, 0x3e11: 0x000a, + 0x3e12: 0x000a, 0x3e13: 0x000a, 0x3e14: 0x000a, 0x3e15: 0x000a, 0x3e16: 0x000a, 0x3e17: 0x000a, + 0x3e18: 0x000a, 0x3e19: 0x000a, 0x3e1a: 0x000a, 0x3e1b: 0x000a, 0x3e1c: 0x000a, 0x3e1d: 0x000a, + 0x3e1e: 0x000a, 0x3e1f: 0x000a, 0x3e20: 0x000a, 0x3e21: 0x000a, 0x3e22: 0x000a, 0x3e23: 0x000a, + 0x3e24: 0x000a, 0x3e25: 0x000a, 0x3e26: 0x000a, 0x3e27: 0x000a, 0x3e28: 0x000a, 0x3e29: 0x000a, + 0x3e2a: 0x000a, 0x3e2b: 0x000a, 0x3e2c: 0x000a, 0x3e2d: 0x000a, 0x3e2e: 0x000a, 0x3e2f: 0x000a, + 0x3e30: 0x000a, 0x3e31: 0x000a, 0x3e32: 0x000a, 0x3e33: 0x000a, 0x3e34: 0x000a, 0x3e35: 0x000a, + 0x3e36: 0x000a, 0x3e37: 0x000a, 0x3e38: 0x000a, 0x3e39: 0x000a, 0x3e3a: 0x000a, 0x3e3b: 0x000a, + 0x3e3c: 0x000a, 0x3e3d: 0x000a, 0x3e3e: 0x000a, 0x3e3f: 0x000a, + // Block 0xf9, offset 0x3e40 + 0x3e40: 0x000a, 0x3e41: 0x000a, 0x3e42: 0x000a, 0x3e43: 0x000a, 0x3e44: 0x000a, 0x3e45: 0x000a, + 0x3e46: 0x000a, 0x3e47: 0x000a, + 0x3e50: 0x000a, 0x3e51: 0x000a, + 0x3e52: 0x000a, 0x3e53: 0x000a, 0x3e54: 0x000a, 0x3e55: 0x000a, 0x3e56: 0x000a, 0x3e57: 0x000a, + 0x3e58: 0x000a, 0x3e59: 0x000a, + 0x3e60: 0x000a, 0x3e61: 0x000a, 0x3e62: 0x000a, 0x3e63: 0x000a, + 0x3e64: 0x000a, 0x3e65: 0x000a, 0x3e66: 0x000a, 0x3e67: 0x000a, 0x3e68: 0x000a, 0x3e69: 0x000a, + 0x3e6a: 0x000a, 0x3e6b: 0x000a, 0x3e6c: 0x000a, 0x3e6d: 0x000a, 0x3e6e: 0x000a, 0x3e6f: 0x000a, + 0x3e70: 0x000a, 0x3e71: 0x000a, 0x3e72: 0x000a, 0x3e73: 0x000a, 0x3e74: 0x000a, 0x3e75: 0x000a, + 0x3e76: 0x000a, 0x3e77: 0x000a, 0x3e78: 0x000a, 0x3e79: 0x000a, 0x3e7a: 0x000a, 0x3e7b: 0x000a, + 0x3e7c: 0x000a, 0x3e7d: 0x000a, 0x3e7e: 0x000a, 0x3e7f: 0x000a, + // Block 0xfa, offset 0x3e80 + 0x3e80: 0x000a, 0x3e81: 0x000a, 0x3e82: 0x000a, 0x3e83: 0x000a, 0x3e84: 0x000a, 0x3e85: 0x000a, + 0x3e86: 0x000a, 0x3e87: 0x000a, + 0x3e90: 0x000a, 0x3e91: 0x000a, + 0x3e92: 0x000a, 0x3e93: 0x000a, 0x3e94: 0x000a, 0x3e95: 0x000a, 0x3e96: 0x000a, 0x3e97: 0x000a, + 0x3e98: 0x000a, 0x3e99: 0x000a, 0x3e9a: 0x000a, 0x3e9b: 0x000a, 0x3e9c: 0x000a, 0x3e9d: 0x000a, + 0x3e9e: 0x000a, 0x3e9f: 0x000a, 0x3ea0: 0x000a, 0x3ea1: 0x000a, 0x3ea2: 0x000a, 0x3ea3: 0x000a, + 0x3ea4: 0x000a, 0x3ea5: 0x000a, 0x3ea6: 0x000a, 0x3ea7: 0x000a, 0x3ea8: 0x000a, 0x3ea9: 0x000a, + 0x3eaa: 0x000a, 0x3eab: 0x000a, 0x3eac: 0x000a, 0x3ead: 0x000a, + 0x3eb0: 0x000a, 0x3eb1: 0x000a, + // Block 0xfb, offset 0x3ec0 + 0x3ec0: 0x000a, 0x3ec1: 0x000a, 0x3ec2: 0x000a, 0x3ec3: 0x000a, 0x3ec4: 0x000a, 0x3ec5: 0x000a, + 0x3ec6: 0x000a, 0x3ec7: 0x000a, 0x3ec8: 0x000a, 0x3ec9: 0x000a, 0x3eca: 0x000a, 0x3ecb: 0x000a, + 0x3ecc: 0x000a, 0x3ecd: 0x000a, 0x3ece: 0x000a, 0x3ecf: 0x000a, 0x3ed0: 0x000a, 0x3ed1: 0x000a, + 0x3ed2: 0x000a, 0x3ed3: 0x000a, + 0x3ee0: 0x000a, 0x3ee1: 0x000a, 0x3ee2: 0x000a, 0x3ee3: 0x000a, + 0x3ee4: 0x000a, 0x3ee5: 0x000a, 0x3ee6: 0x000a, 0x3ee7: 0x000a, 0x3ee8: 0x000a, 0x3ee9: 0x000a, + 0x3eea: 0x000a, 0x3eeb: 0x000a, 0x3eec: 0x000a, 0x3eed: 0x000a, + 0x3ef0: 0x000a, 0x3ef1: 0x000a, 0x3ef2: 0x000a, 0x3ef3: 0x000a, 0x3ef4: 0x000a, 0x3ef5: 0x000a, + 0x3ef6: 0x000a, 0x3ef7: 0x000a, 0x3ef8: 0x000a, 0x3ef9: 0x000a, 0x3efa: 0x000a, 0x3efb: 0x000a, + 0x3efc: 0x000a, + // Block 0xfc, offset 0x3f00 + 0x3f00: 0x000a, 0x3f01: 0x000a, 0x3f02: 0x000a, 0x3f03: 0x000a, 0x3f04: 0x000a, 0x3f05: 0x000a, + 0x3f06: 0x000a, 0x3f07: 0x000a, 0x3f08: 0x000a, + 0x3f10: 0x000a, 0x3f11: 0x000a, + 0x3f12: 0x000a, 0x3f13: 0x000a, 0x3f14: 0x000a, 0x3f15: 0x000a, 0x3f16: 0x000a, 0x3f17: 0x000a, + 0x3f18: 0x000a, 0x3f19: 0x000a, 0x3f1a: 0x000a, 0x3f1b: 0x000a, 0x3f1c: 0x000a, 0x3f1d: 0x000a, + 0x3f1e: 0x000a, 0x3f1f: 0x000a, 0x3f20: 0x000a, 0x3f21: 0x000a, 0x3f22: 0x000a, 0x3f23: 0x000a, + 0x3f24: 0x000a, 0x3f25: 0x000a, 0x3f26: 0x000a, 0x3f27: 0x000a, 0x3f28: 0x000a, 0x3f29: 0x000a, + 0x3f2a: 0x000a, 0x3f2b: 0x000a, 0x3f2c: 0x000a, 0x3f2d: 0x000a, 0x3f2e: 0x000a, 0x3f2f: 0x000a, + 0x3f30: 0x000a, 0x3f31: 0x000a, 0x3f32: 0x000a, 0x3f33: 0x000a, 0x3f34: 0x000a, 0x3f35: 0x000a, + 0x3f36: 0x000a, 0x3f37: 0x000a, 0x3f38: 0x000a, 0x3f39: 0x000a, 0x3f3a: 0x000a, 0x3f3b: 0x000a, + 0x3f3c: 0x000a, 0x3f3d: 0x000a, 0x3f3f: 0x000a, + // Block 0xfd, offset 0x3f40 + 0x3f40: 0x000a, 0x3f41: 0x000a, 0x3f42: 0x000a, 0x3f43: 0x000a, 0x3f44: 0x000a, 0x3f45: 0x000a, + 0x3f4e: 0x000a, 0x3f4f: 0x000a, 0x3f50: 0x000a, 0x3f51: 0x000a, + 0x3f52: 0x000a, 0x3f53: 0x000a, 0x3f54: 0x000a, 0x3f55: 0x000a, 0x3f56: 0x000a, 0x3f57: 0x000a, + 0x3f58: 0x000a, 0x3f59: 0x000a, 0x3f5a: 0x000a, 0x3f5b: 0x000a, + 0x3f60: 0x000a, 0x3f61: 0x000a, 0x3f62: 0x000a, 0x3f63: 0x000a, + 0x3f64: 0x000a, 0x3f65: 0x000a, 0x3f66: 0x000a, 0x3f67: 0x000a, 0x3f68: 0x000a, + 0x3f70: 0x000a, 0x3f71: 0x000a, 0x3f72: 0x000a, 0x3f73: 0x000a, 0x3f74: 0x000a, 0x3f75: 0x000a, + 0x3f76: 0x000a, 0x3f77: 0x000a, 0x3f78: 0x000a, + // Block 0xfe, offset 0x3f80 + 0x3f80: 0x000a, 0x3f81: 0x000a, 0x3f82: 0x000a, 0x3f83: 0x000a, 0x3f84: 0x000a, 0x3f85: 0x000a, + 0x3f86: 0x000a, 0x3f87: 0x000a, 0x3f88: 0x000a, 0x3f89: 0x000a, 0x3f8a: 0x000a, 0x3f8b: 0x000a, + 0x3f8c: 0x000a, 0x3f8d: 0x000a, 0x3f8e: 0x000a, 0x3f8f: 0x000a, 0x3f90: 0x000a, 0x3f91: 0x000a, + 0x3f92: 0x000a, 0x3f94: 0x000a, 0x3f95: 0x000a, 0x3f96: 0x000a, 0x3f97: 0x000a, + 0x3f98: 0x000a, 0x3f99: 0x000a, 0x3f9a: 0x000a, 0x3f9b: 0x000a, 0x3f9c: 0x000a, 0x3f9d: 0x000a, + 0x3f9e: 0x000a, 0x3f9f: 0x000a, 0x3fa0: 0x000a, 0x3fa1: 0x000a, 0x3fa2: 0x000a, 0x3fa3: 0x000a, + 0x3fa4: 0x000a, 0x3fa5: 0x000a, 0x3fa6: 0x000a, 0x3fa7: 0x000a, 0x3fa8: 0x000a, 0x3fa9: 0x000a, + 0x3faa: 0x000a, 0x3fab: 0x000a, 0x3fac: 0x000a, 0x3fad: 0x000a, 0x3fae: 0x000a, 0x3faf: 0x000a, + 0x3fb0: 0x000a, 0x3fb1: 0x000a, 0x3fb2: 0x000a, 0x3fb3: 0x000a, 0x3fb4: 0x000a, 0x3fb5: 0x000a, + 0x3fb6: 0x000a, 0x3fb7: 0x000a, 0x3fb8: 0x000a, 0x3fb9: 0x000a, 0x3fba: 0x000a, 0x3fbb: 0x000a, + 0x3fbc: 0x000a, 0x3fbd: 0x000a, 0x3fbe: 0x000a, 0x3fbf: 0x000a, + // Block 0xff, offset 0x3fc0 + 0x3fc0: 0x000a, 0x3fc1: 0x000a, 0x3fc2: 0x000a, 0x3fc3: 0x000a, 0x3fc4: 0x000a, 0x3fc5: 0x000a, + 0x3fc6: 0x000a, 0x3fc7: 0x000a, 0x3fc8: 0x000a, 0x3fc9: 0x000a, 0x3fca: 0x000a, + 0x3ff0: 0x0002, 0x3ff1: 0x0002, 0x3ff2: 0x0002, 0x3ff3: 0x0002, 0x3ff4: 0x0002, 0x3ff5: 0x0002, + 0x3ff6: 0x0002, 0x3ff7: 0x0002, 0x3ff8: 0x0002, 0x3ff9: 0x0002, + // Block 0x100, offset 0x4000 + 0x403e: 0x000b, 0x403f: 0x000b, + // Block 0x101, offset 0x4040 + 0x4040: 0x000b, 0x4041: 0x000b, 0x4042: 0x000b, 0x4043: 0x000b, 0x4044: 0x000b, 0x4045: 0x000b, + 0x4046: 0x000b, 0x4047: 0x000b, 0x4048: 0x000b, 0x4049: 0x000b, 0x404a: 0x000b, 0x404b: 0x000b, + 0x404c: 0x000b, 0x404d: 0x000b, 0x404e: 0x000b, 0x404f: 0x000b, 0x4050: 0x000b, 0x4051: 0x000b, + 0x4052: 0x000b, 0x4053: 0x000b, 0x4054: 0x000b, 0x4055: 0x000b, 0x4056: 0x000b, 0x4057: 0x000b, + 0x4058: 0x000b, 0x4059: 0x000b, 0x405a: 0x000b, 0x405b: 0x000b, 0x405c: 0x000b, 0x405d: 0x000b, + 0x405e: 0x000b, 0x405f: 0x000b, 0x4060: 0x000b, 0x4061: 0x000b, 0x4062: 0x000b, 0x4063: 0x000b, + 0x4064: 0x000b, 0x4065: 0x000b, 0x4066: 0x000b, 0x4067: 0x000b, 0x4068: 0x000b, 0x4069: 0x000b, + 0x406a: 0x000b, 0x406b: 0x000b, 0x406c: 0x000b, 0x406d: 0x000b, 0x406e: 0x000b, 0x406f: 0x000b, + 0x4070: 0x000b, 0x4071: 0x000b, 0x4072: 0x000b, 0x4073: 0x000b, 0x4074: 0x000b, 0x4075: 0x000b, + 0x4076: 0x000b, 0x4077: 0x000b, 0x4078: 0x000b, 0x4079: 0x000b, 0x407a: 0x000b, 0x407b: 0x000b, + 0x407c: 0x000b, 0x407d: 0x000b, 0x407e: 0x000b, 0x407f: 0x000b, + // Block 0x102, offset 0x4080 + 0x4080: 0x000c, 0x4081: 0x000c, 0x4082: 0x000c, 0x4083: 0x000c, 0x4084: 0x000c, 0x4085: 0x000c, + 0x4086: 0x000c, 0x4087: 0x000c, 0x4088: 0x000c, 0x4089: 0x000c, 0x408a: 0x000c, 0x408b: 0x000c, + 0x408c: 0x000c, 0x408d: 0x000c, 0x408e: 0x000c, 0x408f: 0x000c, 0x4090: 0x000c, 0x4091: 0x000c, + 0x4092: 0x000c, 0x4093: 0x000c, 0x4094: 0x000c, 0x4095: 0x000c, 0x4096: 0x000c, 0x4097: 0x000c, + 0x4098: 0x000c, 0x4099: 0x000c, 0x409a: 0x000c, 0x409b: 0x000c, 0x409c: 0x000c, 0x409d: 0x000c, + 0x409e: 0x000c, 0x409f: 0x000c, 0x40a0: 0x000c, 0x40a1: 0x000c, 0x40a2: 0x000c, 0x40a3: 0x000c, + 0x40a4: 0x000c, 0x40a5: 0x000c, 0x40a6: 0x000c, 0x40a7: 0x000c, 0x40a8: 0x000c, 0x40a9: 0x000c, + 0x40aa: 0x000c, 0x40ab: 0x000c, 0x40ac: 0x000c, 0x40ad: 0x000c, 0x40ae: 0x000c, 0x40af: 0x000c, + 0x40b0: 0x000b, 0x40b1: 0x000b, 0x40b2: 0x000b, 0x40b3: 0x000b, 0x40b4: 0x000b, 0x40b5: 0x000b, + 0x40b6: 0x000b, 0x40b7: 0x000b, 0x40b8: 0x000b, 0x40b9: 0x000b, 0x40ba: 0x000b, 0x40bb: 0x000b, + 0x40bc: 0x000b, 0x40bd: 0x000b, 0x40be: 0x000b, 0x40bf: 0x000b, +} + +// bidiIndex: 26 blocks, 1664 entries, 3328 bytes +// Block 0 is the zero block. +var bidiIndex = [1664]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x13, 0xf1: 0x14, 0xf2: 0x14, 0xf3: 0x16, 0xf4: 0x17, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x136: 0x28, 0x137: 0x29, + 0x138: 0x2a, 0x139: 0x2b, 0x13a: 0x2c, 0x13b: 0x2d, 0x13c: 0x2e, 0x13d: 0x2f, 0x13e: 0x30, 0x13f: 0x31, + // Block 0x5, offset 0x140 + 0x140: 0x32, 0x141: 0x33, 0x142: 0x34, + 0x14d: 0x35, 0x14e: 0x36, + 0x150: 0x37, + 0x15a: 0x38, 0x15c: 0x39, 0x15d: 0x3a, 0x15e: 0x3b, 0x15f: 0x3c, + 0x160: 0x3d, 0x162: 0x3e, 0x164: 0x3f, 0x165: 0x40, 0x167: 0x41, + 0x168: 0x42, 0x169: 0x43, 0x16a: 0x44, 0x16b: 0x45, 0x16c: 0x46, 0x16d: 0x47, 0x16e: 0x48, 0x16f: 0x49, + 0x170: 0x4a, 0x173: 0x4b, 0x177: 0x05, + 0x17e: 0x4c, 0x17f: 0x4d, + // Block 0x6, offset 0x180 + 0x180: 0x4e, 0x181: 0x4f, 0x182: 0x50, 0x183: 0x51, 0x184: 0x52, 0x185: 0x53, 0x186: 0x54, 0x187: 0x55, + 0x188: 0x56, 0x189: 0x55, 0x18a: 0x55, 0x18b: 0x55, 0x18c: 0x57, 0x18d: 0x58, 0x18e: 0x59, 0x18f: 0x55, + 0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x55, 0x195: 0x55, 0x196: 0x55, 0x197: 0x55, + 0x198: 0x55, 0x199: 0x55, 0x19a: 0x5e, 0x19b: 0x55, 0x19c: 0x55, 0x19d: 0x5f, 0x19e: 0x55, 0x19f: 0x60, + 0x1a4: 0x55, 0x1a5: 0x55, 0x1a6: 0x61, 0x1a7: 0x62, + 0x1a8: 0x55, 0x1a9: 0x55, 0x1aa: 0x55, 0x1ab: 0x55, 0x1ac: 0x55, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x55, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x55, 0x1bd: 0x55, 0x1be: 0x55, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x55, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26d: 0x8a, 0x26f: 0x8b, + // Block 0xa, offset 0x280 + 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x8f, 0x2b6: 0x0e, 0x2b7: 0x90, + 0x2b8: 0x91, 0x2b9: 0x92, 0x2ba: 0x0e, 0x2bb: 0x93, 0x2bc: 0x94, 0x2bd: 0x95, 0x2bf: 0x96, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x97, 0x2c5: 0x55, 0x2c6: 0x98, 0x2c7: 0x99, + 0x2cb: 0x9a, 0x2cd: 0x9b, + 0x2e0: 0x9c, 0x2e1: 0x9c, 0x2e2: 0x9c, 0x2e3: 0x9c, 0x2e4: 0x9d, 0x2e5: 0x9c, 0x2e6: 0x9c, 0x2e7: 0x9c, + 0x2e8: 0x9e, 0x2e9: 0x9c, 0x2ea: 0x9c, 0x2eb: 0x9f, 0x2ec: 0xa0, 0x2ed: 0x9c, 0x2ee: 0x9c, 0x2ef: 0x9c, + 0x2f0: 0x9c, 0x2f1: 0x9c, 0x2f2: 0x9c, 0x2f3: 0x9c, 0x2f4: 0xa1, 0x2f5: 0x9c, 0x2f6: 0x9c, 0x2f7: 0x9c, + 0x2f8: 0x9c, 0x2f9: 0xa2, 0x2fa: 0xa3, 0x2fb: 0xa4, 0x2fc: 0xa5, 0x2fd: 0xa6, 0x2fe: 0xa7, 0x2ff: 0x9c, + // Block 0xc, offset 0x300 + 0x300: 0xa8, 0x301: 0xa9, 0x302: 0xaa, 0x303: 0x21, 0x304: 0xab, 0x305: 0xac, 0x306: 0xad, 0x307: 0xae, + 0x308: 0xaf, 0x309: 0x28, 0x30b: 0xb0, 0x30c: 0x26, 0x30d: 0xb1, + 0x310: 0xb2, 0x311: 0xb3, 0x312: 0xb4, 0x313: 0xb5, 0x316: 0xb6, 0x317: 0xb7, + 0x318: 0xb8, 0x319: 0xb9, 0x31a: 0xba, 0x31c: 0xbb, + 0x320: 0xbc, 0x324: 0xbd, 0x325: 0xbe, 0x327: 0xbf, + 0x328: 0xc0, 0x329: 0xc1, 0x32a: 0xc2, + 0x330: 0xc3, 0x332: 0xc4, 0x334: 0xc5, 0x335: 0xc6, 0x336: 0xc7, + 0x33b: 0xc8, 0x33c: 0xc9, 0x33d: 0xca, 0x33f: 0xcb, + // Block 0xd, offset 0x340 + 0x351: 0xcc, + // Block 0xe, offset 0x380 + 0x3ab: 0xcd, 0x3ac: 0xce, + 0x3bd: 0xcf, 0x3be: 0xd0, 0x3bf: 0xd1, + // Block 0xf, offset 0x3c0 + 0x3f2: 0xd2, + // Block 0x10, offset 0x400 + 0x43c: 0xd3, 0x43d: 0xd4, + // Block 0x11, offset 0x440 + 0x445: 0xd5, 0x446: 0xd6, 0x447: 0xd7, + 0x448: 0x55, 0x449: 0xd8, 0x44c: 0x55, 0x44d: 0xd9, + 0x45b: 0xda, 0x45c: 0xdb, 0x45d: 0xdc, 0x45e: 0xdd, 0x45f: 0xde, + 0x468: 0xdf, 0x469: 0xe0, 0x46a: 0xe1, + // Block 0x12, offset 0x480 + 0x480: 0xe2, 0x482: 0xcf, 0x484: 0xce, + 0x48a: 0xe3, 0x48b: 0xe4, + 0x493: 0xe5, + 0x4a0: 0x9c, 0x4a1: 0x9c, 0x4a2: 0x9c, 0x4a3: 0xe6, 0x4a4: 0x9c, 0x4a5: 0xe7, 0x4a6: 0x9c, 0x4a7: 0x9c, + 0x4a8: 0x9c, 0x4a9: 0x9c, 0x4aa: 0x9c, 0x4ab: 0x9c, 0x4ac: 0x9c, 0x4ad: 0x9c, 0x4ae: 0x9c, 0x4af: 0x9c, + 0x4b0: 0x9c, 0x4b1: 0xe8, 0x4b2: 0xe9, 0x4b3: 0x9c, 0x4b4: 0xea, 0x4b5: 0x9c, 0x4b6: 0x9c, 0x4b7: 0x9c, + 0x4b8: 0x0e, 0x4b9: 0x0e, 0x4ba: 0x0e, 0x4bb: 0xeb, 0x4bc: 0x9c, 0x4bd: 0x9c, 0x4be: 0x9c, 0x4bf: 0x9c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0xec, 0x4c1: 0x55, 0x4c2: 0xed, 0x4c3: 0xee, 0x4c4: 0xef, 0x4c5: 0xf0, 0x4c6: 0xf1, + 0x4c9: 0xf2, 0x4cc: 0x55, 0x4cd: 0x55, 0x4ce: 0x55, 0x4cf: 0x55, + 0x4d0: 0x55, 0x4d1: 0x55, 0x4d2: 0x55, 0x4d3: 0x55, 0x4d4: 0x55, 0x4d5: 0x55, 0x4d6: 0x55, 0x4d7: 0x55, + 0x4d8: 0x55, 0x4d9: 0x55, 0x4da: 0x55, 0x4db: 0xf3, 0x4dc: 0x55, 0x4dd: 0xf4, 0x4de: 0x55, 0x4df: 0xf5, + 0x4e0: 0xf6, 0x4e1: 0xf7, 0x4e2: 0xf8, 0x4e4: 0x55, 0x4e5: 0x55, 0x4e6: 0x55, 0x4e7: 0x55, + 0x4e8: 0x55, 0x4e9: 0xf9, 0x4ea: 0xfa, 0x4eb: 0xfb, 0x4ec: 0x55, 0x4ed: 0x55, 0x4ee: 0xfc, 0x4ef: 0xfd, + 0x4ff: 0xfe, + // Block 0x14, offset 0x500 + 0x53f: 0xfe, + // Block 0x15, offset 0x540 + 0x550: 0x09, 0x551: 0x0a, 0x553: 0x0b, 0x556: 0x0c, + 0x55b: 0x0d, 0x55c: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, + 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x58f: 0x12, + 0x59f: 0x12, + 0x5af: 0x12, + 0x5bf: 0x12, + // Block 0x17, offset 0x5c0 + 0x5c0: 0xff, 0x5c1: 0xff, 0x5c2: 0xff, 0x5c3: 0xff, 0x5c4: 0x05, 0x5c5: 0x05, 0x5c6: 0x05, 0x5c7: 0x100, + 0x5c8: 0xff, 0x5c9: 0xff, 0x5ca: 0xff, 0x5cb: 0xff, 0x5cc: 0xff, 0x5cd: 0xff, 0x5ce: 0xff, 0x5cf: 0xff, + 0x5d0: 0xff, 0x5d1: 0xff, 0x5d2: 0xff, 0x5d3: 0xff, 0x5d4: 0xff, 0x5d5: 0xff, 0x5d6: 0xff, 0x5d7: 0xff, + 0x5d8: 0xff, 0x5d9: 0xff, 0x5da: 0xff, 0x5db: 0xff, 0x5dc: 0xff, 0x5dd: 0xff, 0x5de: 0xff, 0x5df: 0xff, + 0x5e0: 0xff, 0x5e1: 0xff, 0x5e2: 0xff, 0x5e3: 0xff, 0x5e4: 0xff, 0x5e5: 0xff, 0x5e6: 0xff, 0x5e7: 0xff, + 0x5e8: 0xff, 0x5e9: 0xff, 0x5ea: 0xff, 0x5eb: 0xff, 0x5ec: 0xff, 0x5ed: 0xff, 0x5ee: 0xff, 0x5ef: 0xff, + 0x5f0: 0xff, 0x5f1: 0xff, 0x5f2: 0xff, 0x5f3: 0xff, 0x5f4: 0xff, 0x5f5: 0xff, 0x5f6: 0xff, 0x5f7: 0xff, + 0x5f8: 0xff, 0x5f9: 0xff, 0x5fa: 0xff, 0x5fb: 0xff, 0x5fc: 0xff, 0x5fd: 0xff, 0x5fe: 0xff, 0x5ff: 0xff, + // Block 0x18, offset 0x600 + 0x60f: 0x12, + 0x61f: 0x12, + 0x620: 0x15, + 0x62f: 0x12, + 0x63f: 0x12, + // Block 0x19, offset 0x640 + 0x64f: 0x12, +} + +// Total table size 19960 bytes (19KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 9115ef257e..f65785e8ac 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go new file mode 100644 index 0000000000..e1858b879d --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go @@ -0,0 +1,7908 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "15.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [56]uint8{ + 0, 1, 6, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16, 17, 18, 19, + 20, 21, 22, 23, 24, 25, 26, 27, + 28, 29, 30, 31, 32, 33, 34, 35, + 36, 84, 91, 103, 107, 118, 122, 129, + 130, 132, 202, 214, 216, 218, 220, 222, + 224, 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x199A + firstCCC = 0x2DD5 + endMulti = 0x30A1 + firstLeadingCCC = 0x4AEF + firstCCCZeroExcept = 0x4BB9 + firstStarterWithNLead = 0x4BE0 + lastDecomp = 0x4BE2 + maxDecomp = 0x8000 +) + +// decomps: 19426 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, + 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, + 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, + 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, + 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, + 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, + // Bytes 100 - 13f + 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, + 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, + 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, + 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, + 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, + 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, + 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, + 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, + 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, + 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, + 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, + 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, + // Bytes 180 - 1bf + 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, + 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, + 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, + 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, + 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, + 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, + // Bytes 1c0 - 1ff + 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, + 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, + 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, + 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, + 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, + 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, + 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, + 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, + // Bytes 200 - 23f + 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, + 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, + 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, + 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, + 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, + 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, + 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, + 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, + // Bytes 240 - 27f + 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, + 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, + 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, + 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, + 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, + 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, + 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, + 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, + // Bytes 280 - 2bf + 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, + 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, + 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, + 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, + 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, + 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, + 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, + 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, + // Bytes 2c0 - 2ff + 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, + 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, + 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, + 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, + 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, + 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, + 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, + 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, + // Bytes 300 - 33f + 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, + 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, + 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, + 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, + 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, + 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, + 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, + 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, + // Bytes 340 - 37f + 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, + 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, + 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, + 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, + 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, + 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, + 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, + 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, + // Bytes 380 - 3bf + 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, + 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, + 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, + 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, + 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, + 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, + 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, + 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, + // Bytes 3c0 - 3ff + 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, + 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, + 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, + 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, + 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, + 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, + 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, + 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, + // Bytes 400 - 43f + 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, + 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, + 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, + 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, + 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, + 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, + 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, + 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, + // Bytes 440 - 47f + 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, + 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, + 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, + 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, + 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, + 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, + 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, + 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, + // Bytes 480 - 4bf + 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, + 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, + 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, + 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, + 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, + 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, + 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, + 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, + // Bytes 4c0 - 4ff + 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, + 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, + 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, + 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, + 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, + 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, + 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, + 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, + // Bytes 500 - 53f + 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, + 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, + 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, + 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, + 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, + 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, + 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, + 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, + // Bytes 540 - 57f + 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, + 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, + 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, + 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, + 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, + 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, + 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, + 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, + // Bytes 580 - 5bf + 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, + 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, + 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, + 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, + 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, + 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, + 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, + 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, + // Bytes 5c0 - 5ff + 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, + 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, + 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, + 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, + 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, + 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, + 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, + 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, + // Bytes 600 - 63f + 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, + 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, + 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, + 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, + 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, + 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, + 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, + 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, + // Bytes 640 - 67f + 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, + 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, + 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, + 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, + 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, + 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, + 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, + 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, + // Bytes 680 - 6bf + 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, + 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, + 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, + 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, + 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, + 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, + 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, + 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, + // Bytes 6c0 - 6ff + 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, + 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, + 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, + 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, + 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, + 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, + 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, + 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, + // Bytes 700 - 73f + 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, + 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, + 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, + 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, + 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, + 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, + 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, + 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, + // Bytes 740 - 77f + 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, + 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, + 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, + 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, + 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, + 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, + 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, + 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, + // Bytes 780 - 7bf + 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, + 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, + 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, + 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, + 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, + 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, + 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, + 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, + // Bytes 7c0 - 7ff + 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, + 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, + 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, + 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, + 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, + 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, + 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, + 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, + // Bytes 800 - 83f + 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, + 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, + 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, + 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, + 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, + 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, + 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, + 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, + // Bytes 840 - 87f + 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, + 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, + 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, + 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, + 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, + 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, + 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, + 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, + // Bytes 880 - 8bf + 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, + 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, + 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, + 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, + 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, + 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, + 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, + 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, + // Bytes 8c0 - 8ff + 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, + 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, + 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, + 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, + 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, + 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, + 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, + 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, + // Bytes 900 - 93f + 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, + 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, + 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, + 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, + 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, + 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, + 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, + 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, + // Bytes 940 - 97f + 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, + 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, + 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, + 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, + 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, + 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, + 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, + 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, + // Bytes 980 - 9bf + 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, + 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, + 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, + 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, + 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, + 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, + 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, + 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, + // Bytes 9c0 - 9ff + 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, + 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, + 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, + 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, + 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, + 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, + 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, + 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, + // Bytes a00 - a3f + 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, + 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, + 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, + 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, + 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, + 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, + 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, + 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, + // Bytes a40 - a7f + 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, + 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, + 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, + 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, + 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, + 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, + 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, + 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, + // Bytes a80 - abf + 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, + 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, + 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, + 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, + 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, + 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, + 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, + 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, + // Bytes ac0 - aff + 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, + 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, + 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, + 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, + 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, + 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, + 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, + 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, + // Bytes b00 - b3f + 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, + 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, + 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, + 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, + 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, + 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, + 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, + 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, + // Bytes b40 - b7f + 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, + 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, + 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, + 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, + 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, + 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, + 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, + 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, + // Bytes b80 - bbf + 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, + 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, + 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, + 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, + 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, + 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, + 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, + 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, + // Bytes bc0 - bff + 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, + 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, + 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, + 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, + 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, + 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, + 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, + 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, + // Bytes c00 - c3f + 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, + 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, + 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, + 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, + 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, + 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, + 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, + 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, + // Bytes c40 - c7f + 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, + 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, + 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, + 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, + 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, + 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, + 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, + 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, + // Bytes c80 - cbf + 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, + 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, + 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, + 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, + 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, + 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, + 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, + 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, + // Bytes cc0 - cff + 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, + 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, + 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, + 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, + 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, + 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, + 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, + 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, + // Bytes d00 - d3f + 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, + 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, + 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, + 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, + 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, + 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, + 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, + 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, + // Bytes d40 - d7f + 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, + 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, + 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, + 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, + 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, + 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, + 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, + 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, + // Bytes d80 - dbf + 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, + 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, + 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, + 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, + 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, + 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, + 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, + 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, + // Bytes dc0 - dff + 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, + 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, + 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, + 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, + 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, + 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, + 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, + 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, + // Bytes e00 - e3f + 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, + 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, + 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, + 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, + 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, + 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, + 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, + 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, + // Bytes e40 - e7f + 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, + 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, + 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, + 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, + 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, + 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, + 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, + 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, + // Bytes e80 - ebf + 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, + 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, + 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, + 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, + 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, + 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, + 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, + 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, + // Bytes ec0 - eff + 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, + 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, + 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, + 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, + 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, + 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, + 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, + 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, + // Bytes f00 - f3f + 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, + 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, + 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, + 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, + 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, + 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, + 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, + 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, + // Bytes f40 - f7f + 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, + 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, + 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, + 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, + 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, + 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, + 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, + 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, + // Bytes f80 - fbf + 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, + 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, + 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, + 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, + 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, + 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, + 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, + 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, + // Bytes fc0 - fff + 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, + 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, + 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, + 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, + 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, + 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, + 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, + 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, + // Bytes 1000 - 103f + 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, + 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, + 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, + 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, + 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, + 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, + 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, + 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, + // Bytes 1040 - 107f + 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, + 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, + 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, + 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, + 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, + 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, + 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, + 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, + // Bytes 1080 - 10bf + 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, + 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, + 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, + 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, + 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, + 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, + 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, + 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, + // Bytes 10c0 - 10ff + 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, + 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, + 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, + 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, + 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, + 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, + 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, + 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, + // Bytes 1100 - 113f + 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, + 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, + 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, + 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, + 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, + 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, + 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, + 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, + // Bytes 1140 - 117f + 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, + 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, + 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, + 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, + 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, + 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, + 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, + 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, + // Bytes 1180 - 11bf + 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, + 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, + 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, + 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, + 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, + 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, + 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, + 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, + // Bytes 11c0 - 11ff + 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, + 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, + 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, + 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, + 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, + 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, + 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, + 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, + // Bytes 1200 - 123f + 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, + 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, + 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, + 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, + 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, + 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, + 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, + 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, + // Bytes 1240 - 127f + 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, + 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, + 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, + 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, + 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, + 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, + 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, + 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, + // Bytes 1280 - 12bf + 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, + 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, + 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, + 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, + 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, + 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, + 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, + 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, + // Bytes 12c0 - 12ff + 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, + 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, + 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, + 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, + 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, + 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, + 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, + 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, + // Bytes 1300 - 133f + 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, + 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, + 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, + 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, + 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, + 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, + 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, + 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, + // Bytes 1340 - 137f + 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, + 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, + 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, + 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, + 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, + 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, + 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, + 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, + // Bytes 1380 - 13bf + 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, + 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, + 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, + 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, + 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, + 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, + 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, + 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, + // Bytes 13c0 - 13ff + 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, + 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, + 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, + 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, + 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, + 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, + 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, + 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, + // Bytes 1400 - 143f + 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, + 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, + 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, + 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, + 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, + 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, + 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, + 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, + // Bytes 1440 - 147f + 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, + 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, + 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, + 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, + 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, + 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, + 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, + 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, + // Bytes 1480 - 14bf + 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, + 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, + 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, + 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, + 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, + 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, + 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, + 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, + // Bytes 14c0 - 14ff + 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, + 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, + 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, + 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, + 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, + 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, + 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, + 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, + // Bytes 1500 - 153f + 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, + 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, + 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, + 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, + 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, + 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, + 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, + 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, + // Bytes 1540 - 157f + 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, + 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, + 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, + 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, + 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, + 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, + 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, + 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, + // Bytes 1580 - 15bf + 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, + 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, + 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, + 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, + 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, + 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, + 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, + 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, + // Bytes 15c0 - 15ff + 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, + 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, + 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, + 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, + 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, + 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, + 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, + 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, + // Bytes 1600 - 163f + 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, + 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, + 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, + 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, + 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, + 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, + 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, + 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, + // Bytes 1640 - 167f + 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, + 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, + 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, + 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, + 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, + 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, + 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, + 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, + // Bytes 1680 - 16bf + 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, + 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, + 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, + 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, + 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, + 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, + 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, + 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, + // Bytes 16c0 - 16ff + 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, + 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, + 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, + 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, + 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, + 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, + 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, + 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, + // Bytes 1700 - 173f + 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, + 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, + 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, + 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, + 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, + 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, + 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, + 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, + // Bytes 1740 - 177f + 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, + 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, + 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, + 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, + 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, + 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, + 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, + 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, + // Bytes 1780 - 17bf + 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, + 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, + 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, + 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, + 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, + 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, + 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, + 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, + // Bytes 17c0 - 17ff + 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, + 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, + 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, + 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, + 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, + 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, + 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, + 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, + // Bytes 1800 - 183f + 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, + 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, + 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, + 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, + 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, + 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, + 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, + 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, + // Bytes 1840 - 187f + 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, + 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, + 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, + 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, + 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, + 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, + 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, + 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, + // Bytes 1880 - 18bf + 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, + 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, + 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, + 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, + 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, + 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, + 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, + 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, + // Bytes 18c0 - 18ff + 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, + 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, + 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, + 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, + 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, + 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, + 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, + 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, + // Bytes 1900 - 193f + 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, + 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, + 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, + 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, + 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, + 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, + 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, + 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, + // Bytes 1940 - 197f + 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, + 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, + 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, + 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, + 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, + 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, + 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, + 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, + // Bytes 1980 - 19bf + 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, + 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, + 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, + 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, + 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, + 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, + 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, + 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, + // Bytes 19c0 - 19ff + 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, + 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, + 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, + 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, + 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, + 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, + 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, + 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, + // Bytes 1a00 - 1a3f + 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, + 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, + 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, + 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, + 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, + 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, + 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, + 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, + // Bytes 1a40 - 1a7f + 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, + 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, + 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, + 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, + 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, + 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, + 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, + 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, + // Bytes 1a80 - 1abf + 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, + 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, + 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, + 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, + 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, + 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, + 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + // Bytes 1ac0 - 1aff + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + // Bytes 1b00 - 1b3f + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + // Bytes 1b40 - 1b7f + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + // Bytes 1b80 - 1bbf + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + // Bytes 1bc0 - 1bff + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + // Bytes 1c00 - 1c3f + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + // Bytes 1c40 - 1c7f + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + // Bytes 1c80 - 1cbf + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + // Bytes 1cc0 - 1cff + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + // Bytes 1d00 - 1d3f + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + // Bytes 1d40 - 1d7f + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + // Bytes 1d80 - 1dbf + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + // Bytes 1dc0 - 1dff + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + // Bytes 1e00 - 1e3f + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + // Bytes 1e40 - 1e7f + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + // Bytes 1e80 - 1ebf + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + // Bytes 1ec0 - 1eff + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + // Bytes 1f00 - 1f3f + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + // Bytes 1f40 - 1f7f + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + // Bytes 1f80 - 1fbf + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + // Bytes 1fc0 - 1fff + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + // Bytes 2000 - 203f + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + // Bytes 2040 - 207f + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + // Bytes 2080 - 20bf + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + // Bytes 20c0 - 20ff + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + // Bytes 2100 - 213f + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + // Bytes 2140 - 217f + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + // Bytes 2180 - 21bf + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + // Bytes 21c0 - 21ff + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + // Bytes 2200 - 223f + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + // Bytes 2240 - 227f + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + // Bytes 2280 - 22bf + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + // Bytes 22c0 - 22ff + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2300 - 233f + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + // Bytes 2340 - 237f + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + // Bytes 2380 - 23bf + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + // Bytes 23c0 - 23ff + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + // Bytes 2400 - 243f + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + // Bytes 2440 - 247f + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2480 - 24bf + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + // Bytes 24c0 - 24ff + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + // Bytes 2500 - 253f + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + // Bytes 2540 - 257f + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + // Bytes 2580 - 25bf + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + // Bytes 25c0 - 25ff + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + // Bytes 2600 - 263f + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + // Bytes 2640 - 267f + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + // Bytes 2680 - 26bf + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + // Bytes 26c0 - 26ff + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + // Bytes 2700 - 273f + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + // Bytes 2740 - 277f + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + // Bytes 2780 - 27bf + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + // Bytes 27c0 - 27ff + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + // Bytes 2800 - 283f + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, + 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, + 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, + // Bytes 2840 - 287f + 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, + 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, + 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, + 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + // Bytes 2880 - 28bf + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, + // Bytes 28c0 - 28ff + 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, + 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, + 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, + 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, + // Bytes 2900 - 293f + 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, + 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, + 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, + 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, + 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, + 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, + // Bytes 2940 - 297f + 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, + 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, + 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, + // Bytes 2980 - 29bf + 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, + 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 29c0 - 29ff + 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, + 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, + 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, + 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, + 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, + // Bytes 2a00 - 2a3f + 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, + 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, + 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, + 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, + 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, + // Bytes 2a40 - 2a7f + 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, + 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, + 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, + 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, + // Bytes 2a80 - 2abf + 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, + 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, + 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, + // Bytes 2ac0 - 2aff + 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, + 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, + 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + // Bytes 2b00 - 2b3f + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, + // Bytes 2b40 - 2b7f + 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, + // Bytes 2b80 - 2bbf + 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, + 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, + // Bytes 2bc0 - 2bff + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, + 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, + 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, + 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, + 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, + 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, + 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, + // Bytes 2c40 - 2c7f + 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, + // Bytes 2c80 - 2cbf + 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, + 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, + // Bytes 2cc0 - 2cff + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, + 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, + 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, + // Bytes 2d00 - 2d3f + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, + // Bytes 2d40 - 2d7f + 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, + 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, + 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, + 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, + // Bytes 2d80 - 2dbf + 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, + 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84, + 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, + // Bytes 2dc0 - 2dff + 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE, + // Bytes 2e00 - 2e3f + 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2, + 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5, + 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5, + // Bytes 2e40 - 2e7f + 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5, + 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7, + 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80, + 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC, + 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + // Bytes 2e80 - 2ebf + 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD, + 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91, + 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, + // Bytes 2ec0 - 2eff + 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, + 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, + 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, + 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, + 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, + 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, + 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, + 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, + // Bytes 2f00 - 2f3f + 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, + 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, + 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, + 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, + 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44, + 0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, + 0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, + // Bytes 2f40 - 2f7f + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, + // Bytes 2f80 - 2fbf + 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, + 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, + // Bytes 2fc0 - 2fff + 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, + 0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, + 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, + 0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, + 0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, + 0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, + 0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, + // Bytes 3000 - 303f + 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, + 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, + 0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, + 0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, + 0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, + // Bytes 3040 - 307f + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, + 0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, + // Bytes 3080 - 30bf + 0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, + 0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, + 0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, + 0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, + 0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, + // Bytes 30c0 - 30ff + 0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, + 0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, + 0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, + 0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, + 0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, + 0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, + 0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, + 0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, + // Bytes 3100 - 313f + 0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, + 0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, + 0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, + 0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, + 0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, + 0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, + 0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, + 0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, + // Bytes 3140 - 317f + 0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, + 0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, + 0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, + 0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, + 0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, + 0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, + 0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, + 0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, + // Bytes 3180 - 31bf + 0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, + 0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, + 0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, + 0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, + 0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, + 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, + 0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, + 0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, + // Bytes 31c0 - 31ff + 0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, + 0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, + 0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, + 0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, + 0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, + 0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, + 0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, + 0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, + // Bytes 3200 - 323f + 0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, + 0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, + 0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, + 0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, + 0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, + 0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, + 0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, + 0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, + // Bytes 3240 - 327f + 0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, + 0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, + 0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, + 0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, + 0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, + 0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, + 0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, + 0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, + // Bytes 3280 - 32bf + 0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, + 0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, + 0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, + 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, + 0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, + 0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, + 0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, + 0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, + // Bytes 32c0 - 32ff + 0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, + 0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, + 0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, + 0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, + 0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, + 0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, + 0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, + 0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, + // Bytes 3300 - 333f + 0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, + 0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, + 0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, + 0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, + 0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, + 0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, + 0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, + 0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, + // Bytes 3340 - 337f + 0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, + 0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, + 0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, + 0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, + 0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, + 0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, + 0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, + 0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, + // Bytes 3380 - 33bf + 0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, + 0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, + 0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, + 0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, + 0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, + 0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, + 0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, + 0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, + // Bytes 33c0 - 33ff + 0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, + 0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, + 0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, + 0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, + 0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, + 0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, + 0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, + 0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, + // Bytes 3400 - 343f + 0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, + 0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, + 0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, + 0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, + 0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, + 0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, + 0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, + 0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, + // Bytes 3440 - 347f + 0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, + 0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, + 0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, + 0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, + 0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, + 0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, + 0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, + 0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, + // Bytes 3480 - 34bf + 0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, + 0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, + 0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, + 0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, + 0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, + 0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, + 0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, + 0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, + // Bytes 34c0 - 34ff + 0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, + 0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, + 0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, + 0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, + 0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, + 0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, + 0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, + 0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, + // Bytes 3500 - 353f + 0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, + 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, + 0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, + 0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, + 0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, + 0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, + 0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, + 0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, + // Bytes 3540 - 357f + 0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, + 0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, + 0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, + 0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, + 0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, + 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, + 0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, + 0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, + // Bytes 3580 - 35bf + 0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, + 0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, + 0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, + 0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, + 0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, + 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, + 0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, + 0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, + // Bytes 35c0 - 35ff + 0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, + 0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, + 0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, + 0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, + 0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, + 0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, + 0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, + 0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, + // Bytes 3600 - 363f + 0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, + 0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, + 0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, + 0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, + 0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, + 0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, + 0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, + 0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, + // Bytes 3640 - 367f + 0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, + 0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, + 0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, + 0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, + 0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, + 0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, + 0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, + 0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, + // Bytes 3680 - 36bf + 0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, + 0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, + 0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, + 0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, + 0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, + 0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, + 0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, + 0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, + // Bytes 36c0 - 36ff + 0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, + 0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, + 0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, + 0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, + 0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, + 0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, + 0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, + 0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, + // Bytes 3700 - 373f + 0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, + 0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, + 0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, + 0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, + 0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, + // Bytes 3740 - 377f + 0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, + 0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + // Bytes 3780 - 37bf + 0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + 0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, + // Bytes 37c0 - 37ff + 0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, + 0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, + // Bytes 3800 - 383f + 0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, + 0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, + 0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, + 0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, + 0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, + // Bytes 3840 - 387f + 0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, + 0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, + // Bytes 3880 - 38bf + 0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, + 0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, + 0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, + 0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, + // Bytes 38c0 - 38ff + 0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, + 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + // Bytes 3900 - 393f + 0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, + 0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, + 0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, + 0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, + // Bytes 3940 - 397f + 0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, + 0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, + 0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, + 0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, + 0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, + 0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, + 0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, + // Bytes 3980 - 39bf + 0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, + 0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, + 0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, + 0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, + 0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, + 0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, + 0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + // Bytes 39c0 - 39ff + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, + 0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, + 0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, + 0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, + // Bytes 3a00 - 3a3f + 0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, + 0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, + 0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, + 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, + 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, + 0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, + // Bytes 3a40 - 3a7f + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, + 0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, + 0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, + 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, + 0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + // Bytes 3a80 - 3abf + 0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, + 0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, + 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, + 0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + 0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, + // Bytes 3ac0 - 3aff + 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + 0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, + 0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, + 0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, + 0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, + 0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, + 0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, + 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, + // Bytes 3b00 - 3b3f + 0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, + // Bytes 3b40 - 3b7f + 0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, + 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, + 0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + // Bytes 3b80 - 3bbf + 0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, + 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, + 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, + 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, + // Bytes 3bc0 - 3bff + 0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, + 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, + 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, + 0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, + 0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, + // Bytes 3c00 - 3c3f + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, + 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, + 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, + 0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, + 0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, + // Bytes 3c40 - 3c7f + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, + 0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, + 0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, + 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, + 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, + // Bytes 3c80 - 3cbf + 0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, + 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, + 0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, + 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + // Bytes 3cc0 - 3cff + 0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, + 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, + 0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, + 0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, + 0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, + 0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, + // Bytes 3d00 - 3d3f + 0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, + // Bytes 3d40 - 3d7f + 0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3d80 - 3dbf + 0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3dc0 - 3dff + 0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3e00 - 3e3f + 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, + 0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, + // Bytes 3e40 - 3e7f + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3e80 - 3ebf + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, + // Bytes 3ec0 - 3eff + 0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, + // Bytes 3f00 - 3f3f + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 3f40 - 3f7f + 0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3f80 - 3fbf + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, + // Bytes 3fc0 - 3fff + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, + // Bytes 4000 - 403f + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, + 0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, + // Bytes 4040 - 407f + 0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, + // Bytes 4080 - 40bf + 0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, + // Bytes 40c0 - 40ff + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, + // Bytes 4100 - 413f + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4140 - 417f + 0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, + // Bytes 4180 - 41bf + 0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + // Bytes 41c0 - 41ff + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4200 - 423f + 0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 4240 - 427f + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + // Bytes 4280 - 42bf + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, + // Bytes 42c0 - 42ff + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 4300 - 433f + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + // Bytes 4340 - 437f + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, + // Bytes 4380 - 43bf + 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, + 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, + 0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42, + 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, + 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, + 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, + 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, + 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, + // Bytes 43c0 - 43ff + 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, + 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, + 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, + 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, + 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, + 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, + 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, + 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, + // Bytes 4400 - 443f + 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, + 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, + 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, + 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, + 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, + 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, + 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, + // Bytes 4440 - 447f + 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, + 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, + 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, + // Bytes 4480 - 44bf + 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, + 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, + 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, + // Bytes 44c0 - 44ff + 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, + 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, + // Bytes 4500 - 453f + 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, + 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, + 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, + // Bytes 4540 - 457f + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, + 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, + 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, + 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, + 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, + 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, + 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, + // Bytes 4580 - 45bf + 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, + 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, + 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, + 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, + 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, + 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, + 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, + 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, + // Bytes 45c0 - 45ff + 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, + 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, + 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, + 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, + 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, + 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, + // Bytes 4600 - 463f + 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, + 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, + 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, + 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, + 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, + 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, + // Bytes 4640 - 467f + 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, + 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, + 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + // Bytes 4680 - 46bf + 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + // Bytes 46c0 - 46ff + 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, + // Bytes 4700 - 473f + 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83, + 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, + 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, + 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, + // Bytes 4740 - 477f + 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, + 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, + 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, + 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + // Bytes 4780 - 47bf + 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, + 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, + 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, + 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, + // Bytes 47c0 - 47ff + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, + 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, + 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, + 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, + 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, + 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, + 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, + 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, + // Bytes 4800 - 483f + 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, + 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, + 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, + 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, + 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, + 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, + 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, + 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, + // Bytes 4840 - 487f + 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, + 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, + 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, + 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, + 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, + 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, + 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, + 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, + // Bytes 4880 - 48bf + 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, + 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, + 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, + 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, + 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, + 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, + 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, + 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, + // Bytes 48c0 - 48ff + 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, + 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, + 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, + 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, + 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, + 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, + // Bytes 4900 - 493f + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, + // Bytes 4940 - 497f + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, + 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, + 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, + // Bytes 4980 - 49bf + 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, + 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, + 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, + 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, + // Bytes 49c0 - 49ff + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4a00 - 4a3f + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + // Bytes 4a40 - 4a7f + 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + // Bytes 4a80 - 4abf + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4ac0 - 4aff + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42, + 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, + 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, + // Bytes 4b00 - 4b3f + 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, + // Bytes 4b40 - 4b7f + 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, + // Bytes 4b80 - 4bbf + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, + 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, + // Bytes 4bc0 - 4bff + 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, + 0x00, 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, + // Block 0x5, offset 0x140 + 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x36e2, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c, + 0x2c6: 0xa000, 0x2c7: 0x384a, + 0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3874, 0x302: 0x38f8, + 0x310: 0x3850, 0x311: 0x38d4, + 0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe, + 0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910, + 0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e, + 0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946, + 0x338: 0x38c8, 0x339: 0x394c, + // Block 0xd, offset 0x340 + 0x351: 0x812e, + 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, + 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, + 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, + 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, + 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, + 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, + 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, + 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, + 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, + 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x812e, + 0x3b0: 0x811f, + // Block 0xf, offset 0x3c0 + 0x3ca: 0x8133, 0x3cb: 0x8133, + 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, + 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, + 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, + 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, + 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, + 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, + 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000, + 0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000, + 0x412: 0x2e85, + 0x434: 0x8103, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2e8d, + 0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, + 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, + 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, + 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, + 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, + 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, + 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, + 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, + 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, + 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, + 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, + // Block 0x12, offset 0x480 + 0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3, + 0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411, + 0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420, + 0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6, + 0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4, + 0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d, + 0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1, + 0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb, + 0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f, + 0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538, + 0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b, + 0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f, + 0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a, + 0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6, + 0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67, + 0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2, + 0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c, + 0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605, + 0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650, + 0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a, + 0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a, + // Block 0x14, offset 0x500 + 0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673, + 0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682, + 0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3, + 0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7, + 0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712, + 0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0, + 0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56, + 0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64, + 0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b, + 0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d, + 0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa, + // Block 0x15, offset 0x540 + 0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1, + 0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2, + 0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0, + 0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7, + 0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36, + 0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52, + 0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4, + 0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb, + 0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9, + 0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b, + // Block 0x16, offset 0x580 + 0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f, + 0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7, + 0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d, + 0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11, + 0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41, + 0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7, + 0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909, + 0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27, + 0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79, + 0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71, + 0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1, + 0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99, + 0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab, + 0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9, + 0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1, + 0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7, + 0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933, + 0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57, + 0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b, + 0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d, + 0x5fc: 0x49b1, 0x5fd: 0x4483, + // Block 0x18, offset 0x600 + 0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed, + 0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f, + 0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31, + 0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333, + 0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275, + 0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b, + 0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9, + 0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb, + 0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9, + 0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f, + 0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21, + 0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b, + 0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0, + 0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51, + 0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5, + 0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d, + 0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c, + 0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081, + 0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9, + 0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459, + 0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000, + 0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c, + 0x68d: 0xa000, + 0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab, + 0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000, + 0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000, + 0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000, + 0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1, + 0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9, + 0x72f: 0xa000, + 0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000, + 0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000, + 0x73c: 0x4101, 0x73d: 0x4109, + // Block 0x1d, offset 0x740 + 0x754: 0x4041, + 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x4111, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000, + 0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000, + 0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000, + 0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181, + 0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191, + 0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1, + 0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1, + 0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119, + 0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201, + 0x7bd: 0xa000, 0x7be: 0x4209, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, + 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, + 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, + 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, + 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, + 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, + 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, + 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, + 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, + 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, + 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, + // Block 0x20, offset 0x800 + 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, + 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, + 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, + 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, + 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, + 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, + 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, + 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, + 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, + 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, + 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, + // Block 0x21, offset 0x840 + 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, + 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, + 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, + 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, + 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, + 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, + 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, + 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, + 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, + 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, + 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, + // Block 0x22, offset 0x880 + 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, + 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, + 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, + 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, + 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, + 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, + 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, + 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, + 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, + 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, + 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, + 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, + 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, + 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, + 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, + 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, + 0x8e5: 0x1502, 0x8e6: 0x152e, + 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, + 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, + 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, + 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, + // Block 0x24, offset 0x900 + 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, + 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, + 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, + 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, + 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, + 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, + 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, + 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, + 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, + 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, + 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, + // Block 0x25, offset 0x940 + 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, + 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, + 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, + 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, + 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, + 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, + 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, + 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, + 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, + 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, + 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, + // Block 0x26, offset 0x980 + 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, + 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, + 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, + 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, + 0x998: 0x1712, 0x999: 0x1722, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, + 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, + 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, + 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, + 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, + 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, + 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, + 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, + 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, + 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, + 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, + // Block 0x28, offset 0xa00 + 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, + 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, + 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, + 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, + 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, + 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, + 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, + 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, + 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, + 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, + 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, + // Block 0x29, offset 0xa40 + 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, + 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, + 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, + 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, + 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, + 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, + 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, + 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, + 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, + 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, + 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, + 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, + 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, + 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, + 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, + 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, + 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, + 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, + 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, + 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, + 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, + 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, + 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, + 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, + 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, + 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, + 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, + 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, + 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, + 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, + 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, + // Block 0x2c, offset 0xb00 + 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, + 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, + 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, + 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, + 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, + 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, + 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, + 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, + 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, + 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, + 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, + // Block 0x2d, offset 0xb40 + 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, + 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, + 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, + 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, + 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, + 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, + 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, + 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, + 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, + 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, + 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, + // Block 0x2e, offset 0xb80 + 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, + 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, + 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, + 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, + 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, + 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, + 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, + 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, + 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, + 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, + 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, + 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, + 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, + 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, + 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, + 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, + 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, + 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, + // Block 0x5, offset 0x140 + 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, + 0x14d: 0x5d, + 0x15c: 0x5e, 0x15f: 0x5f, + 0x162: 0x60, 0x164: 0x61, + 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, + 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, + 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, + 0x1ab: 0x73, + 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, + 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, + // Block 0x8, offset 0x200 + 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, + 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, + 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, + 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, + 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, + // Block 0x9, offset 0x240 + 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, + 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, + 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, + 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, + 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, + 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, + 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, + 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, + // Block 0xa, offset 0x280 + 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, + 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, + 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, + 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, + 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, + 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, + 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, + 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, + 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, + 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, + 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, + 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, + 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, + // Block 0xd, offset 0x340 + 0x347: 0x9e, + 0x34b: 0x9f, 0x34d: 0xa0, + 0x368: 0xa1, 0x36b: 0xa2, + 0x374: 0xa3, + 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, + // Block 0xe, offset 0x380 + 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, + 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, + 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, + 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, + 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, + 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, + 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, + 0x3bd: 0xc0, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xc1, 0x3ec: 0xc2, + 0x3ff: 0xc3, + // Block 0x10, offset 0x400 + 0x432: 0xc4, + // Block 0x11, offset 0x440 + 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, + 0x449: 0xc8, + // Block 0x12, offset 0x480 + 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, + 0x48a: 0xcb, 0x48b: 0xcc, + 0x493: 0xcd, + 0x4a3: 0xce, 0x4a5: 0xcf, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xd0, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 163 entries, 326 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} + +// nfcSparseValues: 730 entries, 2920 bytes +var nfcSparseValues = [730]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4981, lo: 0x8a, hi: 0x8a}, + {value: 0x499f, lo: 0x8b, hi: 0x8b}, + {value: 0x3808, lo: 0x8c, hi: 0x8c}, + {value: 0x3820, lo: 0x8d, hi: 0x8d}, + {value: 0x49b7, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x383e, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0x10, offset 0x6e + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x76 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x7d + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x80 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x14, offset 0x88 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x8c + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x90 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x92 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x94 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xa1 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xa8 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xad + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xb0 + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xba + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xbd + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xc4 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xcc + {value: 0x0000, lo: 0x02}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xd1 + {value: 0x0000, lo: 0x02}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x24, offset 0xd4 + {value: 0x0000, lo: 0x01}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x04}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xdb + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xec + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0xf8 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0xfa + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x100 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x104 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x106 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x108 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x10c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x10f + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x114 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x117 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x11a + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x124 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x12b + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x134 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x136 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x139 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x13b + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x146 + {value: 0x0004, lo: 0x03}, + {value: 0x052a, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x14a + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x3f, offset 0x158 + {value: 0x43bc, lo: 0x02}, + {value: 0x023c, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x40, offset 0x15b + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x161 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x167 + {value: 0x62c7, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x172 + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x176 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x178 + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x46, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x47, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x48, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x180 + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xaf}, + // Block 0x4a, offset 0x186 + {value: 0x0000, lo: 0x03}, + {value: 0x4be0, lo: 0xb3, hi: 0xb3}, + {value: 0x4be0, lo: 0xb5, hi: 0xb6}, + {value: 0x4be0, lo: 0xba, hi: 0xbf}, + // Block 0x4b, offset 0x18a + {value: 0x0000, lo: 0x01}, + {value: 0x4be0, lo: 0x8f, hi: 0xa3}, + // Block 0x4c, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4d, offset 0x18e + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4e, offset 0x196 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4f, offset 0x19a + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x50, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x51, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x52, offset 0x1a1 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x53, offset 0x1a4 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x54, offset 0x1a7 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x55, offset 0x1a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x56, offset 0x1ab + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x57, offset 0x1ad + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x58, offset 0x1af + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x59, offset 0x1b5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x5a, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x5b, offset 0x1ba + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5c, offset 0x1c1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5f, offset 0x1d5 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x60, offset 0x1db + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x61, offset 0x1e1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x62, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x63, offset 0x1eb + {value: 0x0006, lo: 0x0d}, + {value: 0x44d1, lo: 0x9d, hi: 0x9d}, + {value: 0x8116, lo: 0x9e, hi: 0x9e}, + {value: 0x4543, lo: 0x9f, hi: 0x9f}, + {value: 0x4531, lo: 0xaa, hi: 0xab}, + {value: 0x4635, lo: 0xac, hi: 0xac}, + {value: 0x463d, lo: 0xad, hi: 0xad}, + {value: 0x4489, lo: 0xae, hi: 0xb1}, + {value: 0x44a7, lo: 0xb2, hi: 0xb4}, + {value: 0x44bf, lo: 0xb5, hi: 0xb6}, + {value: 0x44cb, lo: 0xb8, hi: 0xb8}, + {value: 0x44d7, lo: 0xb9, hi: 0xbb}, + {value: 0x44ef, lo: 0xbc, hi: 0xbc}, + {value: 0x44f5, lo: 0xbe, hi: 0xbe}, + // Block 0x64, offset 0x1f9 + {value: 0x0006, lo: 0x08}, + {value: 0x44fb, lo: 0x80, hi: 0x81}, + {value: 0x4507, lo: 0x83, hi: 0x84}, + {value: 0x4519, lo: 0x86, hi: 0x89}, + {value: 0x453d, lo: 0x8a, hi: 0x8a}, + {value: 0x44b9, lo: 0x8b, hi: 0x8b}, + {value: 0x44a1, lo: 0x8c, hi: 0x8c}, + {value: 0x44e9, lo: 0x8d, hi: 0x8d}, + {value: 0x4513, lo: 0x8e, hi: 0x8e}, + // Block 0x65, offset 0x202 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x66, offset 0x205 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x67, offset 0x208 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x68, offset 0x20a + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x69, offset 0x20d + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x6a, offset 0x20f + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0xa0, hi: 0xa6}, + {value: 0x812e, lo: 0xa7, hi: 0xad}, + {value: 0x8133, lo: 0xae, hi: 0xaf}, + // Block 0x6b, offset 0x213 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6c, offset 0x218 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6d, offset 0x21a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6e, offset 0x21c + {value: 0x0000, lo: 0x04}, + {value: 0x4be0, lo: 0x9e, hi: 0x9f}, + {value: 0x4be0, lo: 0xa3, hi: 0xa3}, + {value: 0x4be0, lo: 0xa5, hi: 0xa6}, + {value: 0x4be0, lo: 0xaa, hi: 0xaf}, + // Block 0x6f, offset 0x221 + {value: 0x0000, lo: 0x05}, + {value: 0x4be0, lo: 0x82, hi: 0x87}, + {value: 0x4be0, lo: 0x8a, hi: 0x8f}, + {value: 0x4be0, lo: 0x92, hi: 0x97}, + {value: 0x4be0, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x70, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x71, offset 0x229 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x72, offset 0x22b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x73, offset 0x22d + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x74, offset 0x233 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x75, offset 0x236 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x76, offset 0x238 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x77, offset 0x23a + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x78, offset 0x23c + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x79, offset 0x242 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x7a, offset 0x246 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x24a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x7c, offset 0x252 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x7d, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7e, offset 0x25c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7f, offset 0x25f + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x80, offset 0x261 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x81, offset 0x264 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x82, offset 0x26c + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x83, offset 0x270 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x85, offset 0x27a + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x86, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x87, offset 0x282 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x88, offset 0x285 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x89, offset 0x287 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x8a, offset 0x28a + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x8b, offset 0x28f + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x8c, offset 0x291 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8d, offset 0x293 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8e, offset 0x295 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8f, offset 0x297 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x90, offset 0x299 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x91, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x92, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x93, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x94, offset 0x2a2 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x95, offset 0x2a4 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x96, offset 0x2a6 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x97, offset 0x2a8 + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x98, offset 0x2b5 + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x2bf + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x9a, offset 0x2c1 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x9b, offset 0x2c3 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0x80, hi: 0x86}, + {value: 0x8133, lo: 0x88, hi: 0x98}, + {value: 0x8133, lo: 0x9b, hi: 0xa1}, + {value: 0x8133, lo: 0xa3, hi: 0xa4}, + {value: 0x8133, lo: 0xa6, hi: 0xaa}, + // Block 0x9c, offset 0x2c9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0x9d, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0x9e, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0x9f, offset 0x2cf + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xa0, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xa1, offset 0x2d5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xa2, offset 0x2d8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 95: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 95 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 97 blocks, 6208 entries, 12416 bytes +// The third block is the zero block. +var nfkcValues = [6208]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc, + // Block 0x5, offset 0x140 + 0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2f2f, 0x185: 0x2f35, + 0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, + 0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x43e6, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x439b, 0x285: 0x45bc, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f, + 0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254, + 0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c, + 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, + 0x2f9: 0x022a, + // Block 0xc, offset 0x300 + 0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c, + 0x306: 0xa000, 0x307: 0x384a, + 0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3874, 0x342: 0x38f8, + 0x350: 0x3850, 0x351: 0x38d4, + 0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe, + 0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910, + 0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e, + 0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946, + 0x378: 0x38c8, 0x379: 0x394c, + // Block 0xe, offset 0x380 + 0x387: 0x1e91, + 0x391: 0x812e, + 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, + 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, + 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, + 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, + 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, + 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, + 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, + 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x812e, + 0x3f0: 0x811f, 0x3f5: 0x1eb4, + 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, + // Block 0x10, offset 0x400 + 0x40a: 0x8133, 0x40b: 0x8133, + 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, + 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, + 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, + 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, + 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, + 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, + 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, + 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, + 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000, + 0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000, + 0x452: 0x2e85, + 0x474: 0x8103, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2e8d, + 0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, + 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, + 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, + 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, + 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, + 0x4aa: 0x0281, + 0x4b8: 0x02b4, + // Block 0x13, offset 0x4c0 + 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, + 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, + 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, + 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, + 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, + 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, + 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, + // Block 0x14, offset 0x500 + 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, + 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, + 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, + 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, + 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, + 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, + 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, + 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, + 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, + 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, + 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, + // Block 0x15, offset 0x540 + 0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3, + 0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411, + 0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420, + 0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6, + 0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4, + 0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d, + 0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1, + 0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb, + 0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f, + 0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538, + 0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d, + // Block 0x16, offset 0x580 + 0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b, + 0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f, + 0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a, + 0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6, + 0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67, + 0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2, + 0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c, + 0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605, + 0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650, + 0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a, + 0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673, + 0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682, + 0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3, + 0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7, + 0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418, + 0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0, + 0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56, + 0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64, + 0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b, + 0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d, + 0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa, + // Block 0x18, offset 0x600 + 0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1, + 0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2, + 0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0, + 0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7, + 0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36, + 0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52, + 0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4, + 0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb, + 0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9, + 0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b, + // Block 0x19, offset 0x640 + 0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f, + 0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7, + 0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d, + 0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11, + 0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41, + 0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7, + 0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909, + 0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27, + 0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79, + 0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71, + 0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81, + // Block 0x1a, offset 0x680 + 0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1, + 0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99, + 0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab, + 0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9, + 0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1, + 0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7, + 0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933, + 0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57, + 0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b, + 0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d, + 0x6bc: 0x49b1, 0x6bd: 0x4483, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed, + 0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f, + 0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31, + 0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333, + 0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275, + 0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b, + 0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9, + 0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb, + 0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9, + 0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f, + 0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8, + // Block 0x1c, offset 0x700 + 0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21, + 0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b, + 0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0, + 0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51, + 0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df, + 0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d, + 0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c, + 0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081, + 0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9, + 0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459, + 0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd, + // Block 0x1d, offset 0x740 + 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, + 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, + 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, + 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, + 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, + // Block 0x1e, offset 0x780 + 0x780: 0x055a, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x235e, 0x791: 0x236a, + 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, + 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, + 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, + 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, + 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, + 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000, + 0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c, + 0x7cd: 0xa000, + 0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab, + 0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, + 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, + 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, + 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, + 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, + // Block 0x22, offset 0x880 + 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, + 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, + 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, + 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, + 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, + 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, + 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, + 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, + 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, + 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, + 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, + 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, + 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, + 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, + 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, + 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, + 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, + 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, + 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, + // Block 0x24, offset 0x900 + 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, + 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, + 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, + 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, + 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, + 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, + 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, + 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, + 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, + 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, + 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, + // Block 0x25, offset 0x940 + 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, + 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, + 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, + 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, + 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, + 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, + 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, + 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, + 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, + 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, + 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000, + 0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000, + 0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000, + 0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1, + 0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9, + 0x9af: 0xa000, + 0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000, + 0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000, + 0x9bc: 0x4101, 0x9bd: 0x4109, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x4041, + 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000, + 0x9de: 0x4111, 0x9df: 0x27e4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000, + 0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000, + 0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000, + 0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181, + 0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191, + 0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1, + 0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1, + 0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119, + 0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201, + 0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9, + // Block 0x29, offset 0xa40 + 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, + 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, + 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, + 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, + 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, + 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, + 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, + 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, + 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, + 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, + 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, + // Block 0x2a, offset 0xa80 + 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, + 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, + 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, + 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, + 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, + 0xa9e: 0x0a8a, 0xa9f: 0x082a, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, + 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, + 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, + 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, + 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, + 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, + 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, + 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, + 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, + 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, + 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, + // Block 0x2c, offset 0xb00 + 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, + 0xb06: 0x0da2, 0xb07: 0x11c2, + 0xb10: 0x1cf4, 0xb11: 0x19d6, + 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, + 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, + 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, + 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, + 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61, + 0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91, + 0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9, + 0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99, + // Block 0x2d, offset 0xb40 + 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, + 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, + 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, + 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, + 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, + 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, + 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, + 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, + 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, + 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, + 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, + 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, + 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, + 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, + 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, + 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, + 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, + 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, + 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, + 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, + 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1, + 0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, + 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d, + 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, + 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, + 0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11, + 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, + 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, + 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, + 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047, + 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, + // Block 0x30, offset 0xc00 + 0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, + 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1, + 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, + 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, + 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, + 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, + 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, + 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, + 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, + 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, + 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, + // Block 0x31, offset 0xc40 + 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, + 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, + 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, + 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, + 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, + 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, + 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, + 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, + 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, + 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, + 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, + // Block 0x32, offset 0xc80 + 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, + 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, + 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, + 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, + 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, + 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, + 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, + 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, + 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, + 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, + 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, + 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, + 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, + 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, + 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, + 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, + 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, + 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, + 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, + 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, + 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, + // Block 0x34, offset 0xd00 + 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, + 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, + 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, + 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, + 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, + 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, + 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, + 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, + 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, + 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, + 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, + // Block 0x35, offset 0xd40 + 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, + 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, + 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, + 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, + 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, + 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, + 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, + 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, + 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, + 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, + 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, + // Block 0x36, offset 0xd80 + 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, + 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, + 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, + 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, + 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, + 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, + 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, + 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, + 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, + 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, + 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, + 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, + 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, + 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, + 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, + 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, + 0xde5: 0x1502, 0xde6: 0x152e, + 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, + 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, + 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, + 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, + // Block 0x38, offset 0xe00 + 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, + 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, + 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, + 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, + 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, + 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, + 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, + 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, + 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, + 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, + 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, + 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, + 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, + 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, + 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, + 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, + 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, + 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, + 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, + 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, + 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, + 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, + 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, + 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, + 0xe98: 0x1712, 0xe99: 0x1722, + // Block 0x3b, offset 0xec0 + 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, + 0xec6: 0x1b8f, + 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, + 0xedd: 0x44d1, + 0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, + 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, + 0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f, + 0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf, + 0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3, + 0xefc: 0x44ef, 0xefe: 0x44f5, + // Block 0x3c, offset 0xf00 + 0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d, + 0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9, + 0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, + 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, + 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, + 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, + 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, + 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, + 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, + 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, + 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, + // Block 0x3d, offset 0xf40 + 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, + 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, + 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, + 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, + 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, + 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, + 0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, + 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, + 0xf70: 0x45a9, 0xf71: 0x45a9, + // Block 0x3e, offset 0xf80 + 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, + 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, + 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, + 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, + 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, + 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, + 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, + 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, + 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, + 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, + 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, + 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, + 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, + 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, + 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, + 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, + 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, + 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, + // Block 0x40, offset 0x1000 + 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, + 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, + 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, + 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, + 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d, + 0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617, + 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, + 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, + 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, + 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, + 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, + // Block 0x41, offset 0x1040 + 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, + 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, + 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157, + 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, + 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, + 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, + 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, + 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, + 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, + 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, + 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, + // Block 0x42, offset 0x1080 + 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, + 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, + 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, + 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, + 0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, + 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, + 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, + 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, + 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021, + 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, + 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, + 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, + 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, + 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, + 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, + 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, + 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, + 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, + 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, + 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, + 0x10fc: 0x4549, 0x10fd: 0x4549, + // Block 0x44, offset 0x1100 + 0x1110: 0x2441, 0x1111: 0x2456, + 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, + 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, + 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, + 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, + 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, + 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, + 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, + 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, + // Block 0x45, offset 0x1140 + 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, + 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, + 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, + 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, + 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, + 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, + 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, + 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, + 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, + 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, + 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, + // Block 0x46, offset 0x1180 + 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, + 0x1186: 0x24f0, 0x1187: 0x2686, + 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, + 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, + 0x11bc: 0x2908, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x057e, + 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, + 0x11d8: 0x05be, 0x11d9: 0x1c8c, + 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, + 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, + 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, + 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, + 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, + // Block 0x48, offset 0x1200 + 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa, + 0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, + 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5, + 0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f, + 0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b, + // Block 0x49, offset 0x1240 + 0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597, + 0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3, + 0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, + 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, + 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, + 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, + 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, + 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, + 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, + 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, + 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, + 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, + 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, + 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, + 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, + 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, + 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, + 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, + 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41, + 0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2, + 0x12bc: 0x20b2, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, + 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, + 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, + 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, + 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, + 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, + 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, + 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, + 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, + 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, + 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, + 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, + 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, + 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, + 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, + 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, + // Block 0x4d, offset 0x1340 + 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, + 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, + 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, + 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, + 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, + 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, + // Block 0x4e, offset 0x1380 + 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, + 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, + 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, + 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, + 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, + 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, + 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, + 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, + 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, + 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, + 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, + 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, + 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, + 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, + 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, + 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, + 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, + 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, + 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, + 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, + // Block 0x50, offset 0x1400 + 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, + 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, + 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, + 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, + 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, + 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, + 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, + 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, + 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, + 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, + 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, + // Block 0x51, offset 0x1440 + 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, + 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, + 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, + 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, + 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, + 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, + 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, + 0x146a: 0x8133, + 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, + 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, + 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, + // Block 0x52, offset 0x1480 + 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, + 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, + 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, + 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, + 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, + 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, + 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, + 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, + 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, + 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, + 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, + 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, + 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, + 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, + 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, + 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, + 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, + // Block 0x54, offset 0x1500 + 0x1502: 0x033b, + 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, + 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, + 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, + 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, + 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, + 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, + 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, + 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, + 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, + 0x153c: 0x0386, 0x153e: 0x03bf, + // Block 0x55, offset 0x1540 + 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, + 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, + 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, + 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, + 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, + 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, + 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, + 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, + 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, + 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, + // Block 0x56, offset 0x1580 + 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, + 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, + 0x1590: 0x1bbc, 0x1591: 0x1bc0, + 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, + 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, + 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, + 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, + 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, + 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, + 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, + 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, + 0x15d0: 0x0d0a, 0x15d1: 0x0b42, + 0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, + 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, + 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, + 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, + 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, + 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, + 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, + // Block 0x58, offset 0x1600 + 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, + 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, + 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, + 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, + 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, + 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, + 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, + 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, + 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, + 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, + 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, + // Block 0x59, offset 0x1640 + 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, + 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, + 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, + 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, + 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, + 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, + 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, + 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, + 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, + 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, + 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, + 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, + 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, + 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, + 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, + 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, + 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, + 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, + 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, + 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, + 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, + 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, + 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, + 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, + 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, + 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, + 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, + 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, + 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, + 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, + 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, + 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, + 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, + 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, + 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, + 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, + 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, + 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, + 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, + 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, + 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, + // Block 0x5d, offset 0x1740 + 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, + 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, + 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, + 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, + 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, + 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, + 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, + 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, + 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, + 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, + 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, + // Block 0x5e, offset 0x1780 + 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, + 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, + 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, + 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, + 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, + 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, + 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, + 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, + 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, + 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, + 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, + 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, + 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, + 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, + 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, + 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, + 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, + 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, + 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, + 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, + 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, + // Block 0x60, offset 0x1800 + 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, + 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, + 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, + 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, + 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, +} + +// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, + 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, + 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, + 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, + 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, + // Block 0x5, offset 0x140 + 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, + 0x14d: 0x8e, + 0x15c: 0x8f, 0x15f: 0x90, + 0x162: 0x91, 0x164: 0x92, + 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, + 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, + 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, + 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, + 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, + 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, + 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, + 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, + 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, + 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, + // Block 0x9, offset 0x240 + 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, + 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, + 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, + 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, + 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, + 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, + 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, + 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, + // Block 0xa, offset 0x280 + 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, + 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, + 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, + 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, + 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, + 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, + 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, + 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, + 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, + 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, + 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xcb, + 0x34b: 0xcc, 0x34d: 0xcd, + 0x35e: 0x4c, + 0x368: 0xce, 0x36b: 0xcf, + 0x374: 0xd0, + 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, + // Block 0xe, offset 0x380 + 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, + 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, + 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, + 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, + 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, + 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, + 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, + 0x3bd: 0xee, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xef, 0x3ec: 0xf0, + 0x3ff: 0xf1, + // Block 0x10, offset 0x400 + 0x432: 0xf2, + // Block 0x11, offset 0x440 + 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, + 0x449: 0xf6, + 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, + 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, + // Block 0x12, offset 0x480 + 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, + 0x48a: 0x106, 0x48b: 0x107, + 0x493: 0x108, + 0x4a3: 0x109, 0x4a5: 0x10a, + 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c8: 0x55, 0x4c9: 0x10d, + 0x4ef: 0x10e, + // Block 0x14, offset 0x500 + 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, + 0x528: 0x5e, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 176 entries, 352 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} + +// nfkcSparseValues: 919 entries, 3676 bytes +var nfkcSparseValues = [919]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x43b9, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x43a5, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x439b, lo: 0xb4, hi: 0xb4}, + {value: 0x0260, lo: 0xb5, hi: 0xb5}, + {value: 0x43d2, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x234c, lo: 0xbc, hi: 0xbc}, + {value: 0x2340, lo: 0xbd, hi: 0xbd}, + {value: 0x23e2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0004, lo: 0x09}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0140, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0179, lo: 0xb4, hi: 0xb4}, + {value: 0x017f, lo: 0xb5, hi: 0xb5}, + {value: 0x018b, lo: 0xb6, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb8}, + // Block 0x3, offset 0x1c + {value: 0x000a, lo: 0x09}, + {value: 0x43af, lo: 0x98, hi: 0x98}, + {value: 0x43b4, lo: 0x99, hi: 0x9a}, + {value: 0x43d7, lo: 0x9b, hi: 0x9b}, + {value: 0x43a0, lo: 0x9c, hi: 0x9c}, + {value: 0x43c3, lo: 0x9d, hi: 0x9d}, + {value: 0x0137, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x01b8, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x26 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x36 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x38 + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3d + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x48 + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x57 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x64 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6c + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x71 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x76 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x78 + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0xf, offset 0x7c + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x84 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x8b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x8e + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x96 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x9a + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x9e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xa0 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xa2 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xab + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xaf + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xb6 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xbb + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xbe + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xcb + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xd2 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xda + {value: 0x0000, lo: 0x03}, + {value: 0x2751, lo: 0xb3, hi: 0xb3}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xe0 + {value: 0x0000, lo: 0x03}, + {value: 0x2766, lo: 0xb3, hi: 0xb3}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x23, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + {value: 0x2758, lo: 0x9c, hi: 0x9c}, + {value: 0x275f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x05}, + {value: 0x03fe, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xee + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x4735, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x4740, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xff + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x10b + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x0402, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x11b + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x11d + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x11f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x124 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x129 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x12c + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x12f + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x133 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x139 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x140 + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x149 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x14b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x14e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x150 + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x15b + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00ec, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00fe, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x166 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x0532, lo: 0x91, hi: 0x91}, + {value: 0x43dc, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x19a0, lo: 0xa5, hi: 0xa5}, + {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x27c1, lo: 0xb3, hi: 0xb3}, + {value: 0x2935, lo: 0xb4, hi: 0xb4}, + {value: 0x27c8, lo: 0xb6, hi: 0xb6}, + {value: 0x293f, lo: 0xb7, hi: 0xb7}, + {value: 0x199a, lo: 0xbc, hi: 0xbc}, + {value: 0x43aa, lo: 0xbe, hi: 0xbe}, + // Block 0x3f, offset 0x174 + {value: 0x0002, lo: 0x0d}, + {value: 0x1a60, lo: 0x87, hi: 0x87}, + {value: 0x1a5d, lo: 0x88, hi: 0x88}, + {value: 0x199d, lo: 0x89, hi: 0x89}, + {value: 0x2ac5, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x055e, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x40, offset 0x182 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x055e, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x011f, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, + // Block 0x41, offset 0x192 + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x42, offset 0x1a0 + {value: 0x0007, lo: 0x06}, + {value: 0x22b0, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x43, offset 0x1a7 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x44, offset 0x1ad + {value: 0x017a, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0x27cf, lo: 0xac, hi: 0xad}, + {value: 0x27d6, lo: 0xaf, hi: 0xaf}, + {value: 0x2953, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x45, offset 0x1bc + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x46, offset 0x1c0 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x47, offset 0x1c2 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x48, offset 0x1c6 + {value: 0x0000, lo: 0x01}, + {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, + // Block 0x49, offset 0x1c8 + {value: 0x0266, lo: 0x02}, + {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, + {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, + // Block 0x4a, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x4b, offset 0x1cd + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4c, offset 0x1d0 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x4d, offset 0x1d2 + {value: 0x0000, lo: 0x02}, + {value: 0x057a, lo: 0xaf, hi: 0xaf}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x1d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x4f, offset 0x1d7 + {value: 0x0000, lo: 0x01}, + {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, + // Block 0x50, offset 0x1d9 + {value: 0x0000, lo: 0x01}, + {value: 0x172a, lo: 0xb3, hi: 0xb3}, + // Block 0x51, offset 0x1db + {value: 0x0004, lo: 0x0b}, + {value: 0x1692, lo: 0x80, hi: 0x82}, + {value: 0x16aa, lo: 0x83, hi: 0x83}, + {value: 0x16c2, lo: 0x84, hi: 0x85}, + {value: 0x16d2, lo: 0x86, hi: 0x89}, + {value: 0x16e6, lo: 0x8a, hi: 0x8c}, + {value: 0x16fa, lo: 0x8d, hi: 0x8d}, + {value: 0x1702, lo: 0x8e, hi: 0x8e}, + {value: 0x170a, lo: 0x8f, hi: 0x90}, + {value: 0x1716, lo: 0x91, hi: 0x93}, + {value: 0x1726, lo: 0x94, hi: 0x94}, + {value: 0x172e, lo: 0x95, hi: 0x95}, + // Block 0x52, offset 0x1e7 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xae}, + {value: 0x8130, lo: 0xaf, hi: 0xaf}, + {value: 0x05ae, lo: 0xb6, hi: 0xb6}, + {value: 0x0982, lo: 0xb8, hi: 0xba}, + // Block 0x53, offset 0x1f1 + {value: 0x0006, lo: 0x09}, + {value: 0x0406, lo: 0xb1, hi: 0xb1}, + {value: 0x040a, lo: 0xb2, hi: 0xb2}, + {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, + {value: 0x040e, lo: 0xb4, hi: 0xb4}, + {value: 0x4b82, lo: 0xb5, hi: 0xb6}, + {value: 0x0412, lo: 0xb7, hi: 0xb7}, + {value: 0x0416, lo: 0xb8, hi: 0xb8}, + {value: 0x041a, lo: 0xb9, hi: 0xb9}, + {value: 0x4b8e, lo: 0xba, hi: 0xbf}, + // Block 0x54, offset 0x1fb + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x55, offset 0x1fe + {value: 0x0000, lo: 0x03}, + {value: 0x02d8, lo: 0x9c, hi: 0x9c}, + {value: 0x02de, lo: 0x9d, hi: 0x9d}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x56, offset 0x202 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x57, offset 0x204 + {value: 0x0000, lo: 0x01}, + {value: 0x173e, lo: 0xb0, hi: 0xb0}, + // Block 0x58, offset 0x206 + {value: 0x0006, lo: 0x04}, + {value: 0x0047, lo: 0xb2, hi: 0xb3}, + {value: 0x0063, lo: 0xb4, hi: 0xb4}, + {value: 0x00dd, lo: 0xb8, hi: 0xb8}, + {value: 0x00e9, lo: 0xb9, hi: 0xb9}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x5b, offset 0x211 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x5c, offset 0x213 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x5d, offset 0x215 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x5e, offset 0x217 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x5f, offset 0x219 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x60, offset 0x21f + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x61, offset 0x222 + {value: 0x000c, lo: 0x04}, + {value: 0x173a, lo: 0x9c, hi: 0x9d}, + {value: 0x014f, lo: 0x9e, hi: 0x9e}, + {value: 0x174a, lo: 0x9f, hi: 0x9f}, + {value: 0x01a6, lo: 0xa9, hi: 0xa9}, + // Block 0x62, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x63, offset 0x229 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x64, offset 0x230 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x65, offset 0x236 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x66, offset 0x23c + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x67, offset 0x244 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x68, offset 0x24a + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x69, offset 0x250 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x6a, offset 0x256 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6b, offset 0x25a + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6c, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x6d, offset 0x25e + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x6e, offset 0x260 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x6f, offset 0x262 + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x70, offset 0x268 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x71, offset 0x26b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x72, offset 0x26d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x73, offset 0x26f + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x271 + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x277 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x76, offset 0x27b + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x77, offset 0x27f + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x78, offset 0x287 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x79, offset 0x28e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7a, offset 0x291 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7b, offset 0x294 + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x7c, offset 0x296 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x7e, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x7f, offset 0x2a5 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x80, offset 0x2ac + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x81, offset 0x2af + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x2b5 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x83, offset 0x2b7 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x84, offset 0x2b9 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x85, offset 0x2bc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x86, offset 0x2be + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x88, offset 0x2c6 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x89, offset 0x2c8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8a, offset 0x2ca + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8b, offset 0x2cc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8c, offset 0x2ce + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x8d, offset 0x2d0 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x8e, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x8f, offset 0x2d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x90, offset 0x2d7 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x91, offset 0x2d9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x92, offset 0x2db + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x93, offset 0x2dd + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x94, offset 0x2df + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x95, offset 0x2ec + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x96, offset 0x2f6 + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x97, offset 0x2f8 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x98, offset 0x2fa + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x99, offset 0x2fe + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x303 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x9b, offset 0x30f + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x314 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x9d, offset 0x31d + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x9e, offset 0x323 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x9f, offset 0x328 + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0xa0, offset 0x32c + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0xa1, offset 0x331 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0xa2, offset 0x335 + {value: 0x0003, lo: 0x0f}, + {value: 0x023c, lo: 0x80, hi: 0x80}, + {value: 0x0556, lo: 0x81, hi: 0x81}, + {value: 0x023f, lo: 0x82, hi: 0x9a}, + {value: 0x0552, lo: 0x9b, hi: 0x9b}, + {value: 0x024b, lo: 0x9c, hi: 0x9c}, + {value: 0x0254, lo: 0x9d, hi: 0x9d}, + {value: 0x025a, lo: 0x9e, hi: 0x9e}, + {value: 0x027e, lo: 0x9f, hi: 0x9f}, + {value: 0x026f, lo: 0xa0, hi: 0xa0}, + {value: 0x026c, lo: 0xa1, hi: 0xa1}, + {value: 0x01f7, lo: 0xa2, hi: 0xb2}, + {value: 0x020c, lo: 0xb3, hi: 0xb3}, + {value: 0x022a, lo: 0xb4, hi: 0xba}, + {value: 0x0556, lo: 0xbb, hi: 0xbb}, + {value: 0x023f, lo: 0xbc, hi: 0xbf}, + // Block 0xa3, offset 0x345 + {value: 0x0003, lo: 0x0d}, + {value: 0x024b, lo: 0x80, hi: 0x94}, + {value: 0x0552, lo: 0x95, hi: 0x95}, + {value: 0x024b, lo: 0x96, hi: 0x96}, + {value: 0x0254, lo: 0x97, hi: 0x97}, + {value: 0x025a, lo: 0x98, hi: 0x98}, + {value: 0x027e, lo: 0x99, hi: 0x99}, + {value: 0x026f, lo: 0x9a, hi: 0x9a}, + {value: 0x026c, lo: 0x9b, hi: 0x9b}, + {value: 0x01f7, lo: 0x9c, hi: 0xac}, + {value: 0x020c, lo: 0xad, hi: 0xad}, + {value: 0x022a, lo: 0xae, hi: 0xb4}, + {value: 0x0556, lo: 0xb5, hi: 0xb5}, + {value: 0x023f, lo: 0xb6, hi: 0xbf}, + // Block 0xa4, offset 0x353 + {value: 0x0003, lo: 0x0d}, + {value: 0x025d, lo: 0x80, hi: 0x8e}, + {value: 0x0552, lo: 0x8f, hi: 0x8f}, + {value: 0x024b, lo: 0x90, hi: 0x90}, + {value: 0x0254, lo: 0x91, hi: 0x91}, + {value: 0x025a, lo: 0x92, hi: 0x92}, + {value: 0x027e, lo: 0x93, hi: 0x93}, + {value: 0x026f, lo: 0x94, hi: 0x94}, + {value: 0x026c, lo: 0x95, hi: 0x95}, + {value: 0x01f7, lo: 0x96, hi: 0xa6}, + {value: 0x020c, lo: 0xa7, hi: 0xa7}, + {value: 0x022a, lo: 0xa8, hi: 0xae}, + {value: 0x0556, lo: 0xaf, hi: 0xaf}, + {value: 0x023f, lo: 0xb0, hi: 0xbf}, + // Block 0xa5, offset 0x361 + {value: 0x0003, lo: 0x0d}, + {value: 0x026f, lo: 0x80, hi: 0x88}, + {value: 0x0552, lo: 0x89, hi: 0x89}, + {value: 0x024b, lo: 0x8a, hi: 0x8a}, + {value: 0x0254, lo: 0x8b, hi: 0x8b}, + {value: 0x025a, lo: 0x8c, hi: 0x8c}, + {value: 0x027e, lo: 0x8d, hi: 0x8d}, + {value: 0x026f, lo: 0x8e, hi: 0x8e}, + {value: 0x026c, lo: 0x8f, hi: 0x8f}, + {value: 0x01f7, lo: 0x90, hi: 0xa0}, + {value: 0x020c, lo: 0xa1, hi: 0xa1}, + {value: 0x022a, lo: 0xa2, hi: 0xa8}, + {value: 0x0556, lo: 0xa9, hi: 0xa9}, + {value: 0x023f, lo: 0xaa, hi: 0xbf}, + // Block 0xa6, offset 0x36f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0xa7, offset 0x371 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0xa8, offset 0x373 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0xa9, offset 0x375 + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xaa, offset 0x379 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xab, offset 0x37b + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xac, offset 0x37e + {value: 0x0002, lo: 0x0a}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, + {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, + {value: 0x1acc, lo: 0x8c, hi: 0x8c}, + {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, + {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, + {value: 0x1ade, lo: 0x8f, hi: 0x8f}, + {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, + {value: 0x1aab, lo: 0xab, hi: 0xab}, + {value: 0x1aae, lo: 0xac, hi: 0xac}, + // Block 0xad, offset 0x389 + {value: 0x0000, lo: 0x01}, + {value: 0x1a6c, lo: 0x90, hi: 0x90}, + // Block 0xae, offset 0x38b + {value: 0x0028, lo: 0x09}, + {value: 0x2999, lo: 0x80, hi: 0x80}, + {value: 0x295d, lo: 0x81, hi: 0x81}, + {value: 0x2967, lo: 0x82, hi: 0x82}, + {value: 0x297b, lo: 0x83, hi: 0x84}, + {value: 0x2985, lo: 0x85, hi: 0x86}, + {value: 0x2971, lo: 0x87, hi: 0x87}, + {value: 0x298f, lo: 0x88, hi: 0x88}, + {value: 0x0c6a, lo: 0x90, hi: 0x90}, + {value: 0x09e2, lo: 0x91, hi: 0x91}, + // Block 0xaf, offset 0x395 + {value: 0x0002, lo: 0x01}, + {value: 0x0021, lo: 0xb0, hi: 0xb9}, +} + +// recompMap: 7528 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 + "" + // Total size of tables: 56KB (57068 bytes) diff --git a/vendor/golang.org/x/text/width/tables13.0.0.go b/vendor/golang.org/x/text/width/tables13.0.0.go index ab258e3848..b1fcb522cb 100644 --- a/vendor/golang.org/x/text/width/tables13.0.0.go +++ b/vendor/golang.org/x/text/width/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package width diff --git a/vendor/golang.org/x/text/width/tables15.0.0.go b/vendor/golang.org/x/text/width/tables15.0.0.go new file mode 100644 index 0000000000..4b91e3384d --- /dev/null +++ b/vendor/golang.org/x/text/width/tables15.0.0.go @@ -0,0 +1,1368 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package width + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// widthTrie. Total size: 14912 bytes (14.56 KiB). Checksum: 4468b6cd178303d2. +type widthTrie struct{} + +func newWidthTrie(i int) *widthTrie { + return &widthTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *widthTrie) lookupValue(n uint32, b byte) uint16 { + switch { + default: + return uint16(widthValues[n<<6+uint32(b)]) + } +} + +// widthValues: 105 blocks, 6720 entries, 13440 bytes +// The third block is the zero block. +var widthValues = [6720]uint16{ + // Block 0x0, offset 0x0 + 0x20: 0x6001, 0x21: 0x6002, 0x22: 0x6002, 0x23: 0x6002, + 0x24: 0x6002, 0x25: 0x6002, 0x26: 0x6002, 0x27: 0x6002, 0x28: 0x6002, 0x29: 0x6002, + 0x2a: 0x6002, 0x2b: 0x6002, 0x2c: 0x6002, 0x2d: 0x6002, 0x2e: 0x6002, 0x2f: 0x6002, + 0x30: 0x6002, 0x31: 0x6002, 0x32: 0x6002, 0x33: 0x6002, 0x34: 0x6002, 0x35: 0x6002, + 0x36: 0x6002, 0x37: 0x6002, 0x38: 0x6002, 0x39: 0x6002, 0x3a: 0x6002, 0x3b: 0x6002, + 0x3c: 0x6002, 0x3d: 0x6002, 0x3e: 0x6002, 0x3f: 0x6002, + // Block 0x1, offset 0x40 + 0x40: 0x6003, 0x41: 0x6003, 0x42: 0x6003, 0x43: 0x6003, 0x44: 0x6003, 0x45: 0x6003, + 0x46: 0x6003, 0x47: 0x6003, 0x48: 0x6003, 0x49: 0x6003, 0x4a: 0x6003, 0x4b: 0x6003, + 0x4c: 0x6003, 0x4d: 0x6003, 0x4e: 0x6003, 0x4f: 0x6003, 0x50: 0x6003, 0x51: 0x6003, + 0x52: 0x6003, 0x53: 0x6003, 0x54: 0x6003, 0x55: 0x6003, 0x56: 0x6003, 0x57: 0x6003, + 0x58: 0x6003, 0x59: 0x6003, 0x5a: 0x6003, 0x5b: 0x6003, 0x5c: 0x6003, 0x5d: 0x6003, + 0x5e: 0x6003, 0x5f: 0x6003, 0x60: 0x6004, 0x61: 0x6004, 0x62: 0x6004, 0x63: 0x6004, + 0x64: 0x6004, 0x65: 0x6004, 0x66: 0x6004, 0x67: 0x6004, 0x68: 0x6004, 0x69: 0x6004, + 0x6a: 0x6004, 0x6b: 0x6004, 0x6c: 0x6004, 0x6d: 0x6004, 0x6e: 0x6004, 0x6f: 0x6004, + 0x70: 0x6004, 0x71: 0x6004, 0x72: 0x6004, 0x73: 0x6004, 0x74: 0x6004, 0x75: 0x6004, + 0x76: 0x6004, 0x77: 0x6004, 0x78: 0x6004, 0x79: 0x6004, 0x7a: 0x6004, 0x7b: 0x6004, + 0x7c: 0x6004, 0x7d: 0x6004, 0x7e: 0x6004, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xe1: 0x2000, 0xe2: 0x6005, 0xe3: 0x6005, + 0xe4: 0x2000, 0xe5: 0x6006, 0xe6: 0x6005, 0xe7: 0x2000, 0xe8: 0x2000, + 0xea: 0x2000, 0xec: 0x6007, 0xed: 0x2000, 0xee: 0x2000, 0xef: 0x6008, + 0xf0: 0x2000, 0xf1: 0x2000, 0xf2: 0x2000, 0xf3: 0x2000, 0xf4: 0x2000, + 0xf6: 0x2000, 0xf7: 0x2000, 0xf8: 0x2000, 0xf9: 0x2000, 0xfa: 0x2000, + 0xfc: 0x2000, 0xfd: 0x2000, 0xfe: 0x2000, 0xff: 0x2000, + // Block 0x4, offset 0x100 + 0x106: 0x2000, + 0x110: 0x2000, + 0x117: 0x2000, + 0x118: 0x2000, + 0x11e: 0x2000, 0x11f: 0x2000, 0x120: 0x2000, 0x121: 0x2000, + 0x126: 0x2000, 0x128: 0x2000, 0x129: 0x2000, + 0x12a: 0x2000, 0x12c: 0x2000, 0x12d: 0x2000, + 0x130: 0x2000, 0x132: 0x2000, 0x133: 0x2000, + 0x137: 0x2000, 0x138: 0x2000, 0x139: 0x2000, 0x13a: 0x2000, + 0x13c: 0x2000, 0x13e: 0x2000, + // Block 0x5, offset 0x140 + 0x141: 0x2000, + 0x151: 0x2000, + 0x153: 0x2000, + 0x15b: 0x2000, + 0x166: 0x2000, 0x167: 0x2000, + 0x16b: 0x2000, + 0x171: 0x2000, 0x172: 0x2000, 0x173: 0x2000, + 0x178: 0x2000, + 0x17f: 0x2000, + // Block 0x6, offset 0x180 + 0x180: 0x2000, 0x181: 0x2000, 0x182: 0x2000, 0x184: 0x2000, + 0x188: 0x2000, 0x189: 0x2000, 0x18a: 0x2000, 0x18b: 0x2000, + 0x18d: 0x2000, + 0x192: 0x2000, 0x193: 0x2000, + 0x1a6: 0x2000, 0x1a7: 0x2000, + 0x1ab: 0x2000, + // Block 0x7, offset 0x1c0 + 0x1ce: 0x2000, 0x1d0: 0x2000, + 0x1d2: 0x2000, 0x1d4: 0x2000, 0x1d6: 0x2000, + 0x1d8: 0x2000, 0x1da: 0x2000, 0x1dc: 0x2000, + // Block 0x8, offset 0x200 + 0x211: 0x2000, + 0x221: 0x2000, + // Block 0x9, offset 0x240 + 0x244: 0x2000, + 0x247: 0x2000, 0x249: 0x2000, 0x24a: 0x2000, 0x24b: 0x2000, + 0x24d: 0x2000, 0x250: 0x2000, + 0x258: 0x2000, 0x259: 0x2000, 0x25a: 0x2000, 0x25b: 0x2000, 0x25d: 0x2000, + 0x25f: 0x2000, + // Block 0xa, offset 0x280 + 0x280: 0x2000, 0x281: 0x2000, 0x282: 0x2000, 0x283: 0x2000, 0x284: 0x2000, 0x285: 0x2000, + 0x286: 0x2000, 0x287: 0x2000, 0x288: 0x2000, 0x289: 0x2000, 0x28a: 0x2000, 0x28b: 0x2000, + 0x28c: 0x2000, 0x28d: 0x2000, 0x28e: 0x2000, 0x28f: 0x2000, 0x290: 0x2000, 0x291: 0x2000, + 0x292: 0x2000, 0x293: 0x2000, 0x294: 0x2000, 0x295: 0x2000, 0x296: 0x2000, 0x297: 0x2000, + 0x298: 0x2000, 0x299: 0x2000, 0x29a: 0x2000, 0x29b: 0x2000, 0x29c: 0x2000, 0x29d: 0x2000, + 0x29e: 0x2000, 0x29f: 0x2000, 0x2a0: 0x2000, 0x2a1: 0x2000, 0x2a2: 0x2000, 0x2a3: 0x2000, + 0x2a4: 0x2000, 0x2a5: 0x2000, 0x2a6: 0x2000, 0x2a7: 0x2000, 0x2a8: 0x2000, 0x2a9: 0x2000, + 0x2aa: 0x2000, 0x2ab: 0x2000, 0x2ac: 0x2000, 0x2ad: 0x2000, 0x2ae: 0x2000, 0x2af: 0x2000, + 0x2b0: 0x2000, 0x2b1: 0x2000, 0x2b2: 0x2000, 0x2b3: 0x2000, 0x2b4: 0x2000, 0x2b5: 0x2000, + 0x2b6: 0x2000, 0x2b7: 0x2000, 0x2b8: 0x2000, 0x2b9: 0x2000, 0x2ba: 0x2000, 0x2bb: 0x2000, + 0x2bc: 0x2000, 0x2bd: 0x2000, 0x2be: 0x2000, 0x2bf: 0x2000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x2000, 0x2c1: 0x2000, 0x2c2: 0x2000, 0x2c3: 0x2000, 0x2c4: 0x2000, 0x2c5: 0x2000, + 0x2c6: 0x2000, 0x2c7: 0x2000, 0x2c8: 0x2000, 0x2c9: 0x2000, 0x2ca: 0x2000, 0x2cb: 0x2000, + 0x2cc: 0x2000, 0x2cd: 0x2000, 0x2ce: 0x2000, 0x2cf: 0x2000, 0x2d0: 0x2000, 0x2d1: 0x2000, + 0x2d2: 0x2000, 0x2d3: 0x2000, 0x2d4: 0x2000, 0x2d5: 0x2000, 0x2d6: 0x2000, 0x2d7: 0x2000, + 0x2d8: 0x2000, 0x2d9: 0x2000, 0x2da: 0x2000, 0x2db: 0x2000, 0x2dc: 0x2000, 0x2dd: 0x2000, + 0x2de: 0x2000, 0x2df: 0x2000, 0x2e0: 0x2000, 0x2e1: 0x2000, 0x2e2: 0x2000, 0x2e3: 0x2000, + 0x2e4: 0x2000, 0x2e5: 0x2000, 0x2e6: 0x2000, 0x2e7: 0x2000, 0x2e8: 0x2000, 0x2e9: 0x2000, + 0x2ea: 0x2000, 0x2eb: 0x2000, 0x2ec: 0x2000, 0x2ed: 0x2000, 0x2ee: 0x2000, 0x2ef: 0x2000, + // Block 0xc, offset 0x300 + 0x311: 0x2000, + 0x312: 0x2000, 0x313: 0x2000, 0x314: 0x2000, 0x315: 0x2000, 0x316: 0x2000, 0x317: 0x2000, + 0x318: 0x2000, 0x319: 0x2000, 0x31a: 0x2000, 0x31b: 0x2000, 0x31c: 0x2000, 0x31d: 0x2000, + 0x31e: 0x2000, 0x31f: 0x2000, 0x320: 0x2000, 0x321: 0x2000, 0x323: 0x2000, + 0x324: 0x2000, 0x325: 0x2000, 0x326: 0x2000, 0x327: 0x2000, 0x328: 0x2000, 0x329: 0x2000, + 0x331: 0x2000, 0x332: 0x2000, 0x333: 0x2000, 0x334: 0x2000, 0x335: 0x2000, + 0x336: 0x2000, 0x337: 0x2000, 0x338: 0x2000, 0x339: 0x2000, 0x33a: 0x2000, 0x33b: 0x2000, + 0x33c: 0x2000, 0x33d: 0x2000, 0x33e: 0x2000, 0x33f: 0x2000, + // Block 0xd, offset 0x340 + 0x340: 0x2000, 0x341: 0x2000, 0x343: 0x2000, 0x344: 0x2000, 0x345: 0x2000, + 0x346: 0x2000, 0x347: 0x2000, 0x348: 0x2000, 0x349: 0x2000, + // Block 0xe, offset 0x380 + 0x381: 0x2000, + 0x390: 0x2000, 0x391: 0x2000, + 0x392: 0x2000, 0x393: 0x2000, 0x394: 0x2000, 0x395: 0x2000, 0x396: 0x2000, 0x397: 0x2000, + 0x398: 0x2000, 0x399: 0x2000, 0x39a: 0x2000, 0x39b: 0x2000, 0x39c: 0x2000, 0x39d: 0x2000, + 0x39e: 0x2000, 0x39f: 0x2000, 0x3a0: 0x2000, 0x3a1: 0x2000, 0x3a2: 0x2000, 0x3a3: 0x2000, + 0x3a4: 0x2000, 0x3a5: 0x2000, 0x3a6: 0x2000, 0x3a7: 0x2000, 0x3a8: 0x2000, 0x3a9: 0x2000, + 0x3aa: 0x2000, 0x3ab: 0x2000, 0x3ac: 0x2000, 0x3ad: 0x2000, 0x3ae: 0x2000, 0x3af: 0x2000, + 0x3b0: 0x2000, 0x3b1: 0x2000, 0x3b2: 0x2000, 0x3b3: 0x2000, 0x3b4: 0x2000, 0x3b5: 0x2000, + 0x3b6: 0x2000, 0x3b7: 0x2000, 0x3b8: 0x2000, 0x3b9: 0x2000, 0x3ba: 0x2000, 0x3bb: 0x2000, + 0x3bc: 0x2000, 0x3bd: 0x2000, 0x3be: 0x2000, 0x3bf: 0x2000, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x2000, 0x3c1: 0x2000, 0x3c2: 0x2000, 0x3c3: 0x2000, 0x3c4: 0x2000, 0x3c5: 0x2000, + 0x3c6: 0x2000, 0x3c7: 0x2000, 0x3c8: 0x2000, 0x3c9: 0x2000, 0x3ca: 0x2000, 0x3cb: 0x2000, + 0x3cc: 0x2000, 0x3cd: 0x2000, 0x3ce: 0x2000, 0x3cf: 0x2000, 0x3d1: 0x2000, + // Block 0x10, offset 0x400 + 0x400: 0x4000, 0x401: 0x4000, 0x402: 0x4000, 0x403: 0x4000, 0x404: 0x4000, 0x405: 0x4000, + 0x406: 0x4000, 0x407: 0x4000, 0x408: 0x4000, 0x409: 0x4000, 0x40a: 0x4000, 0x40b: 0x4000, + 0x40c: 0x4000, 0x40d: 0x4000, 0x40e: 0x4000, 0x40f: 0x4000, 0x410: 0x4000, 0x411: 0x4000, + 0x412: 0x4000, 0x413: 0x4000, 0x414: 0x4000, 0x415: 0x4000, 0x416: 0x4000, 0x417: 0x4000, + 0x418: 0x4000, 0x419: 0x4000, 0x41a: 0x4000, 0x41b: 0x4000, 0x41c: 0x4000, 0x41d: 0x4000, + 0x41e: 0x4000, 0x41f: 0x4000, 0x420: 0x4000, 0x421: 0x4000, 0x422: 0x4000, 0x423: 0x4000, + 0x424: 0x4000, 0x425: 0x4000, 0x426: 0x4000, 0x427: 0x4000, 0x428: 0x4000, 0x429: 0x4000, + 0x42a: 0x4000, 0x42b: 0x4000, 0x42c: 0x4000, 0x42d: 0x4000, 0x42e: 0x4000, 0x42f: 0x4000, + 0x430: 0x4000, 0x431: 0x4000, 0x432: 0x4000, 0x433: 0x4000, 0x434: 0x4000, 0x435: 0x4000, + 0x436: 0x4000, 0x437: 0x4000, 0x438: 0x4000, 0x439: 0x4000, 0x43a: 0x4000, 0x43b: 0x4000, + 0x43c: 0x4000, 0x43d: 0x4000, 0x43e: 0x4000, 0x43f: 0x4000, + // Block 0x11, offset 0x440 + 0x440: 0x4000, 0x441: 0x4000, 0x442: 0x4000, 0x443: 0x4000, 0x444: 0x4000, 0x445: 0x4000, + 0x446: 0x4000, 0x447: 0x4000, 0x448: 0x4000, 0x449: 0x4000, 0x44a: 0x4000, 0x44b: 0x4000, + 0x44c: 0x4000, 0x44d: 0x4000, 0x44e: 0x4000, 0x44f: 0x4000, 0x450: 0x4000, 0x451: 0x4000, + 0x452: 0x4000, 0x453: 0x4000, 0x454: 0x4000, 0x455: 0x4000, 0x456: 0x4000, 0x457: 0x4000, + 0x458: 0x4000, 0x459: 0x4000, 0x45a: 0x4000, 0x45b: 0x4000, 0x45c: 0x4000, 0x45d: 0x4000, + 0x45e: 0x4000, 0x45f: 0x4000, + // Block 0x12, offset 0x480 + 0x490: 0x2000, + 0x493: 0x2000, 0x494: 0x2000, 0x495: 0x2000, 0x496: 0x2000, + 0x498: 0x2000, 0x499: 0x2000, 0x49c: 0x2000, 0x49d: 0x2000, + 0x4a0: 0x2000, 0x4a1: 0x2000, 0x4a2: 0x2000, + 0x4a4: 0x2000, 0x4a5: 0x2000, 0x4a6: 0x2000, 0x4a7: 0x2000, + 0x4b0: 0x2000, 0x4b2: 0x2000, 0x4b3: 0x2000, 0x4b5: 0x2000, + 0x4bb: 0x2000, + 0x4be: 0x2000, + // Block 0x13, offset 0x4c0 + 0x4f4: 0x2000, + 0x4ff: 0x2000, + // Block 0x14, offset 0x500 + 0x501: 0x2000, 0x502: 0x2000, 0x503: 0x2000, 0x504: 0x2000, + 0x529: 0xa009, + 0x52c: 0x2000, + // Block 0x15, offset 0x540 + 0x543: 0x2000, 0x545: 0x2000, + 0x549: 0x2000, + 0x553: 0x2000, 0x556: 0x2000, + 0x561: 0x2000, 0x562: 0x2000, + 0x566: 0x2000, + 0x56b: 0x2000, + // Block 0x16, offset 0x580 + 0x593: 0x2000, 0x594: 0x2000, + 0x59b: 0x2000, 0x59c: 0x2000, 0x59d: 0x2000, + 0x59e: 0x2000, 0x5a0: 0x2000, 0x5a1: 0x2000, 0x5a2: 0x2000, 0x5a3: 0x2000, + 0x5a4: 0x2000, 0x5a5: 0x2000, 0x5a6: 0x2000, 0x5a7: 0x2000, 0x5a8: 0x2000, 0x5a9: 0x2000, + 0x5aa: 0x2000, 0x5ab: 0x2000, + 0x5b0: 0x2000, 0x5b1: 0x2000, 0x5b2: 0x2000, 0x5b3: 0x2000, 0x5b4: 0x2000, 0x5b5: 0x2000, + 0x5b6: 0x2000, 0x5b7: 0x2000, 0x5b8: 0x2000, 0x5b9: 0x2000, + // Block 0x17, offset 0x5c0 + 0x5c9: 0x2000, + 0x5d0: 0x200a, 0x5d1: 0x200b, + 0x5d2: 0x200a, 0x5d3: 0x200c, 0x5d4: 0x2000, 0x5d5: 0x2000, 0x5d6: 0x2000, 0x5d7: 0x2000, + 0x5d8: 0x2000, 0x5d9: 0x2000, + 0x5f8: 0x2000, 0x5f9: 0x2000, + // Block 0x18, offset 0x600 + 0x612: 0x2000, 0x614: 0x2000, + 0x627: 0x2000, + // Block 0x19, offset 0x640 + 0x640: 0x2000, 0x642: 0x2000, 0x643: 0x2000, + 0x647: 0x2000, 0x648: 0x2000, 0x64b: 0x2000, + 0x64f: 0x2000, 0x651: 0x2000, + 0x655: 0x2000, + 0x65a: 0x2000, 0x65d: 0x2000, + 0x65e: 0x2000, 0x65f: 0x2000, 0x660: 0x2000, 0x663: 0x2000, + 0x665: 0x2000, 0x667: 0x2000, 0x668: 0x2000, 0x669: 0x2000, + 0x66a: 0x2000, 0x66b: 0x2000, 0x66c: 0x2000, 0x66e: 0x2000, + 0x674: 0x2000, 0x675: 0x2000, + 0x676: 0x2000, 0x677: 0x2000, + 0x67c: 0x2000, 0x67d: 0x2000, + // Block 0x1a, offset 0x680 + 0x688: 0x2000, + 0x68c: 0x2000, + 0x692: 0x2000, + 0x6a0: 0x2000, 0x6a1: 0x2000, + 0x6a4: 0x2000, 0x6a5: 0x2000, 0x6a6: 0x2000, 0x6a7: 0x2000, + 0x6aa: 0x2000, 0x6ab: 0x2000, 0x6ae: 0x2000, 0x6af: 0x2000, + // Block 0x1b, offset 0x6c0 + 0x6c2: 0x2000, 0x6c3: 0x2000, + 0x6c6: 0x2000, 0x6c7: 0x2000, + 0x6d5: 0x2000, + 0x6d9: 0x2000, + 0x6e5: 0x2000, + 0x6ff: 0x2000, + // Block 0x1c, offset 0x700 + 0x712: 0x2000, + 0x71a: 0x4000, 0x71b: 0x4000, + 0x729: 0x4000, + 0x72a: 0x4000, + // Block 0x1d, offset 0x740 + 0x769: 0x4000, + 0x76a: 0x4000, 0x76b: 0x4000, 0x76c: 0x4000, + 0x770: 0x4000, 0x773: 0x4000, + // Block 0x1e, offset 0x780 + 0x7a0: 0x2000, 0x7a1: 0x2000, 0x7a2: 0x2000, 0x7a3: 0x2000, + 0x7a4: 0x2000, 0x7a5: 0x2000, 0x7a6: 0x2000, 0x7a7: 0x2000, 0x7a8: 0x2000, 0x7a9: 0x2000, + 0x7aa: 0x2000, 0x7ab: 0x2000, 0x7ac: 0x2000, 0x7ad: 0x2000, 0x7ae: 0x2000, 0x7af: 0x2000, + 0x7b0: 0x2000, 0x7b1: 0x2000, 0x7b2: 0x2000, 0x7b3: 0x2000, 0x7b4: 0x2000, 0x7b5: 0x2000, + 0x7b6: 0x2000, 0x7b7: 0x2000, 0x7b8: 0x2000, 0x7b9: 0x2000, 0x7ba: 0x2000, 0x7bb: 0x2000, + 0x7bc: 0x2000, 0x7bd: 0x2000, 0x7be: 0x2000, 0x7bf: 0x2000, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x2000, 0x7c1: 0x2000, 0x7c2: 0x2000, 0x7c3: 0x2000, 0x7c4: 0x2000, 0x7c5: 0x2000, + 0x7c6: 0x2000, 0x7c7: 0x2000, 0x7c8: 0x2000, 0x7c9: 0x2000, 0x7ca: 0x2000, 0x7cb: 0x2000, + 0x7cc: 0x2000, 0x7cd: 0x2000, 0x7ce: 0x2000, 0x7cf: 0x2000, 0x7d0: 0x2000, 0x7d1: 0x2000, + 0x7d2: 0x2000, 0x7d3: 0x2000, 0x7d4: 0x2000, 0x7d5: 0x2000, 0x7d6: 0x2000, 0x7d7: 0x2000, + 0x7d8: 0x2000, 0x7d9: 0x2000, 0x7da: 0x2000, 0x7db: 0x2000, 0x7dc: 0x2000, 0x7dd: 0x2000, + 0x7de: 0x2000, 0x7df: 0x2000, 0x7e0: 0x2000, 0x7e1: 0x2000, 0x7e2: 0x2000, 0x7e3: 0x2000, + 0x7e4: 0x2000, 0x7e5: 0x2000, 0x7e6: 0x2000, 0x7e7: 0x2000, 0x7e8: 0x2000, 0x7e9: 0x2000, + 0x7eb: 0x2000, 0x7ec: 0x2000, 0x7ed: 0x2000, 0x7ee: 0x2000, 0x7ef: 0x2000, + 0x7f0: 0x2000, 0x7f1: 0x2000, 0x7f2: 0x2000, 0x7f3: 0x2000, 0x7f4: 0x2000, 0x7f5: 0x2000, + 0x7f6: 0x2000, 0x7f7: 0x2000, 0x7f8: 0x2000, 0x7f9: 0x2000, 0x7fa: 0x2000, 0x7fb: 0x2000, + 0x7fc: 0x2000, 0x7fd: 0x2000, 0x7fe: 0x2000, 0x7ff: 0x2000, + // Block 0x20, offset 0x800 + 0x800: 0x2000, 0x801: 0x2000, 0x802: 0x200d, 0x803: 0x2000, 0x804: 0x2000, 0x805: 0x2000, + 0x806: 0x2000, 0x807: 0x2000, 0x808: 0x2000, 0x809: 0x2000, 0x80a: 0x2000, 0x80b: 0x2000, + 0x80c: 0x2000, 0x80d: 0x2000, 0x80e: 0x2000, 0x80f: 0x2000, 0x810: 0x2000, 0x811: 0x2000, + 0x812: 0x2000, 0x813: 0x2000, 0x814: 0x2000, 0x815: 0x2000, 0x816: 0x2000, 0x817: 0x2000, + 0x818: 0x2000, 0x819: 0x2000, 0x81a: 0x2000, 0x81b: 0x2000, 0x81c: 0x2000, 0x81d: 0x2000, + 0x81e: 0x2000, 0x81f: 0x2000, 0x820: 0x2000, 0x821: 0x2000, 0x822: 0x2000, 0x823: 0x2000, + 0x824: 0x2000, 0x825: 0x2000, 0x826: 0x2000, 0x827: 0x2000, 0x828: 0x2000, 0x829: 0x2000, + 0x82a: 0x2000, 0x82b: 0x2000, 0x82c: 0x2000, 0x82d: 0x2000, 0x82e: 0x2000, 0x82f: 0x2000, + 0x830: 0x2000, 0x831: 0x2000, 0x832: 0x2000, 0x833: 0x2000, 0x834: 0x2000, 0x835: 0x2000, + 0x836: 0x2000, 0x837: 0x2000, 0x838: 0x2000, 0x839: 0x2000, 0x83a: 0x2000, 0x83b: 0x2000, + 0x83c: 0x2000, 0x83d: 0x2000, 0x83e: 0x2000, 0x83f: 0x2000, + // Block 0x21, offset 0x840 + 0x840: 0x2000, 0x841: 0x2000, 0x842: 0x2000, 0x843: 0x2000, 0x844: 0x2000, 0x845: 0x2000, + 0x846: 0x2000, 0x847: 0x2000, 0x848: 0x2000, 0x849: 0x2000, 0x84a: 0x2000, 0x84b: 0x2000, + 0x850: 0x2000, 0x851: 0x2000, + 0x852: 0x2000, 0x853: 0x2000, 0x854: 0x2000, 0x855: 0x2000, 0x856: 0x2000, 0x857: 0x2000, + 0x858: 0x2000, 0x859: 0x2000, 0x85a: 0x2000, 0x85b: 0x2000, 0x85c: 0x2000, 0x85d: 0x2000, + 0x85e: 0x2000, 0x85f: 0x2000, 0x860: 0x2000, 0x861: 0x2000, 0x862: 0x2000, 0x863: 0x2000, + 0x864: 0x2000, 0x865: 0x2000, 0x866: 0x2000, 0x867: 0x2000, 0x868: 0x2000, 0x869: 0x2000, + 0x86a: 0x2000, 0x86b: 0x2000, 0x86c: 0x2000, 0x86d: 0x2000, 0x86e: 0x2000, 0x86f: 0x2000, + 0x870: 0x2000, 0x871: 0x2000, 0x872: 0x2000, 0x873: 0x2000, + // Block 0x22, offset 0x880 + 0x880: 0x2000, 0x881: 0x2000, 0x882: 0x2000, 0x883: 0x2000, 0x884: 0x2000, 0x885: 0x2000, + 0x886: 0x2000, 0x887: 0x2000, 0x888: 0x2000, 0x889: 0x2000, 0x88a: 0x2000, 0x88b: 0x2000, + 0x88c: 0x2000, 0x88d: 0x2000, 0x88e: 0x2000, 0x88f: 0x2000, + 0x892: 0x2000, 0x893: 0x2000, 0x894: 0x2000, 0x895: 0x2000, + 0x8a0: 0x200e, 0x8a1: 0x2000, 0x8a3: 0x2000, + 0x8a4: 0x2000, 0x8a5: 0x2000, 0x8a6: 0x2000, 0x8a7: 0x2000, 0x8a8: 0x2000, 0x8a9: 0x2000, + 0x8b2: 0x2000, 0x8b3: 0x2000, + 0x8b6: 0x2000, 0x8b7: 0x2000, + 0x8bc: 0x2000, 0x8bd: 0x2000, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x2000, 0x8c1: 0x2000, + 0x8c6: 0x2000, 0x8c7: 0x2000, 0x8c8: 0x2000, 0x8cb: 0x200f, + 0x8ce: 0x2000, 0x8cf: 0x2000, 0x8d0: 0x2000, 0x8d1: 0x2000, + 0x8e2: 0x2000, 0x8e3: 0x2000, + 0x8e4: 0x2000, 0x8e5: 0x2000, + 0x8ef: 0x2000, + 0x8fd: 0x4000, 0x8fe: 0x4000, + // Block 0x24, offset 0x900 + 0x905: 0x2000, + 0x906: 0x2000, 0x909: 0x2000, + 0x90e: 0x2000, 0x90f: 0x2000, + 0x914: 0x4000, 0x915: 0x4000, + 0x91c: 0x2000, + 0x91e: 0x2000, + // Block 0x25, offset 0x940 + 0x940: 0x2000, 0x942: 0x2000, + 0x948: 0x4000, 0x949: 0x4000, 0x94a: 0x4000, 0x94b: 0x4000, + 0x94c: 0x4000, 0x94d: 0x4000, 0x94e: 0x4000, 0x94f: 0x4000, 0x950: 0x4000, 0x951: 0x4000, + 0x952: 0x4000, 0x953: 0x4000, + 0x960: 0x2000, 0x961: 0x2000, 0x963: 0x2000, + 0x964: 0x2000, 0x965: 0x2000, 0x967: 0x2000, 0x968: 0x2000, 0x969: 0x2000, + 0x96a: 0x2000, 0x96c: 0x2000, 0x96d: 0x2000, 0x96f: 0x2000, + 0x97f: 0x4000, + // Block 0x26, offset 0x980 + 0x993: 0x4000, + 0x99e: 0x2000, 0x99f: 0x2000, 0x9a1: 0x4000, + 0x9aa: 0x4000, 0x9ab: 0x4000, + 0x9bd: 0x4000, 0x9be: 0x4000, 0x9bf: 0x2000, + // Block 0x27, offset 0x9c0 + 0x9c4: 0x4000, 0x9c5: 0x4000, + 0x9c6: 0x2000, 0x9c7: 0x2000, 0x9c8: 0x2000, 0x9c9: 0x2000, 0x9ca: 0x2000, 0x9cb: 0x2000, + 0x9cc: 0x2000, 0x9cd: 0x2000, 0x9ce: 0x4000, 0x9cf: 0x2000, 0x9d0: 0x2000, 0x9d1: 0x2000, + 0x9d2: 0x2000, 0x9d3: 0x2000, 0x9d4: 0x4000, 0x9d5: 0x2000, 0x9d6: 0x2000, 0x9d7: 0x2000, + 0x9d8: 0x2000, 0x9d9: 0x2000, 0x9da: 0x2000, 0x9db: 0x2000, 0x9dc: 0x2000, 0x9dd: 0x2000, + 0x9de: 0x2000, 0x9df: 0x2000, 0x9e0: 0x2000, 0x9e1: 0x2000, 0x9e3: 0x2000, + 0x9e8: 0x2000, 0x9e9: 0x2000, + 0x9ea: 0x4000, 0x9eb: 0x2000, 0x9ec: 0x2000, 0x9ed: 0x2000, 0x9ee: 0x2000, 0x9ef: 0x2000, + 0x9f0: 0x2000, 0x9f1: 0x2000, 0x9f2: 0x4000, 0x9f3: 0x4000, 0x9f4: 0x2000, 0x9f5: 0x4000, + 0x9f6: 0x2000, 0x9f7: 0x2000, 0x9f8: 0x2000, 0x9f9: 0x2000, 0x9fa: 0x4000, 0x9fb: 0x2000, + 0x9fc: 0x2000, 0x9fd: 0x4000, 0x9fe: 0x2000, 0x9ff: 0x2000, + // Block 0x28, offset 0xa00 + 0xa05: 0x4000, + 0xa0a: 0x4000, 0xa0b: 0x4000, + 0xa28: 0x4000, + 0xa3d: 0x2000, + // Block 0x29, offset 0xa40 + 0xa4c: 0x4000, 0xa4e: 0x4000, + 0xa53: 0x4000, 0xa54: 0x4000, 0xa55: 0x4000, 0xa57: 0x4000, + 0xa76: 0x2000, 0xa77: 0x2000, 0xa78: 0x2000, 0xa79: 0x2000, 0xa7a: 0x2000, 0xa7b: 0x2000, + 0xa7c: 0x2000, 0xa7d: 0x2000, 0xa7e: 0x2000, 0xa7f: 0x2000, + // Block 0x2a, offset 0xa80 + 0xa95: 0x4000, 0xa96: 0x4000, 0xa97: 0x4000, + 0xab0: 0x4000, + 0xabf: 0x4000, + // Block 0x2b, offset 0xac0 + 0xae6: 0x6000, 0xae7: 0x6000, 0xae8: 0x6000, 0xae9: 0x6000, + 0xaea: 0x6000, 0xaeb: 0x6000, 0xaec: 0x6000, 0xaed: 0x6000, + // Block 0x2c, offset 0xb00 + 0xb05: 0x6010, + 0xb06: 0x6011, + // Block 0x2d, offset 0xb40 + 0xb5b: 0x4000, 0xb5c: 0x4000, + // Block 0x2e, offset 0xb80 + 0xb90: 0x4000, + 0xb95: 0x4000, 0xb96: 0x2000, 0xb97: 0x2000, + 0xb98: 0x2000, 0xb99: 0x2000, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x4000, 0xbc1: 0x4000, 0xbc2: 0x4000, 0xbc3: 0x4000, 0xbc4: 0x4000, 0xbc5: 0x4000, + 0xbc6: 0x4000, 0xbc7: 0x4000, 0xbc8: 0x4000, 0xbc9: 0x4000, 0xbca: 0x4000, 0xbcb: 0x4000, + 0xbcc: 0x4000, 0xbcd: 0x4000, 0xbce: 0x4000, 0xbcf: 0x4000, 0xbd0: 0x4000, 0xbd1: 0x4000, + 0xbd2: 0x4000, 0xbd3: 0x4000, 0xbd4: 0x4000, 0xbd5: 0x4000, 0xbd6: 0x4000, 0xbd7: 0x4000, + 0xbd8: 0x4000, 0xbd9: 0x4000, 0xbdb: 0x4000, 0xbdc: 0x4000, 0xbdd: 0x4000, + 0xbde: 0x4000, 0xbdf: 0x4000, 0xbe0: 0x4000, 0xbe1: 0x4000, 0xbe2: 0x4000, 0xbe3: 0x4000, + 0xbe4: 0x4000, 0xbe5: 0x4000, 0xbe6: 0x4000, 0xbe7: 0x4000, 0xbe8: 0x4000, 0xbe9: 0x4000, + 0xbea: 0x4000, 0xbeb: 0x4000, 0xbec: 0x4000, 0xbed: 0x4000, 0xbee: 0x4000, 0xbef: 0x4000, + 0xbf0: 0x4000, 0xbf1: 0x4000, 0xbf2: 0x4000, 0xbf3: 0x4000, 0xbf4: 0x4000, 0xbf5: 0x4000, + 0xbf6: 0x4000, 0xbf7: 0x4000, 0xbf8: 0x4000, 0xbf9: 0x4000, 0xbfa: 0x4000, 0xbfb: 0x4000, + 0xbfc: 0x4000, 0xbfd: 0x4000, 0xbfe: 0x4000, 0xbff: 0x4000, + // Block 0x30, offset 0xc00 + 0xc00: 0x4000, 0xc01: 0x4000, 0xc02: 0x4000, 0xc03: 0x4000, 0xc04: 0x4000, 0xc05: 0x4000, + 0xc06: 0x4000, 0xc07: 0x4000, 0xc08: 0x4000, 0xc09: 0x4000, 0xc0a: 0x4000, 0xc0b: 0x4000, + 0xc0c: 0x4000, 0xc0d: 0x4000, 0xc0e: 0x4000, 0xc0f: 0x4000, 0xc10: 0x4000, 0xc11: 0x4000, + 0xc12: 0x4000, 0xc13: 0x4000, 0xc14: 0x4000, 0xc15: 0x4000, 0xc16: 0x4000, 0xc17: 0x4000, + 0xc18: 0x4000, 0xc19: 0x4000, 0xc1a: 0x4000, 0xc1b: 0x4000, 0xc1c: 0x4000, 0xc1d: 0x4000, + 0xc1e: 0x4000, 0xc1f: 0x4000, 0xc20: 0x4000, 0xc21: 0x4000, 0xc22: 0x4000, 0xc23: 0x4000, + 0xc24: 0x4000, 0xc25: 0x4000, 0xc26: 0x4000, 0xc27: 0x4000, 0xc28: 0x4000, 0xc29: 0x4000, + 0xc2a: 0x4000, 0xc2b: 0x4000, 0xc2c: 0x4000, 0xc2d: 0x4000, 0xc2e: 0x4000, 0xc2f: 0x4000, + 0xc30: 0x4000, 0xc31: 0x4000, 0xc32: 0x4000, 0xc33: 0x4000, + // Block 0x31, offset 0xc40 + 0xc40: 0x4000, 0xc41: 0x4000, 0xc42: 0x4000, 0xc43: 0x4000, 0xc44: 0x4000, 0xc45: 0x4000, + 0xc46: 0x4000, 0xc47: 0x4000, 0xc48: 0x4000, 0xc49: 0x4000, 0xc4a: 0x4000, 0xc4b: 0x4000, + 0xc4c: 0x4000, 0xc4d: 0x4000, 0xc4e: 0x4000, 0xc4f: 0x4000, 0xc50: 0x4000, 0xc51: 0x4000, + 0xc52: 0x4000, 0xc53: 0x4000, 0xc54: 0x4000, 0xc55: 0x4000, + 0xc70: 0x4000, 0xc71: 0x4000, 0xc72: 0x4000, 0xc73: 0x4000, 0xc74: 0x4000, 0xc75: 0x4000, + 0xc76: 0x4000, 0xc77: 0x4000, 0xc78: 0x4000, 0xc79: 0x4000, 0xc7a: 0x4000, 0xc7b: 0x4000, + // Block 0x32, offset 0xc80 + 0xc80: 0x9012, 0xc81: 0x4013, 0xc82: 0x4014, 0xc83: 0x4000, 0xc84: 0x4000, 0xc85: 0x4000, + 0xc86: 0x4000, 0xc87: 0x4000, 0xc88: 0x4000, 0xc89: 0x4000, 0xc8a: 0x4000, 0xc8b: 0x4000, + 0xc8c: 0x4015, 0xc8d: 0x4015, 0xc8e: 0x4000, 0xc8f: 0x4000, 0xc90: 0x4000, 0xc91: 0x4000, + 0xc92: 0x4000, 0xc93: 0x4000, 0xc94: 0x4000, 0xc95: 0x4000, 0xc96: 0x4000, 0xc97: 0x4000, + 0xc98: 0x4000, 0xc99: 0x4000, 0xc9a: 0x4000, 0xc9b: 0x4000, 0xc9c: 0x4000, 0xc9d: 0x4000, + 0xc9e: 0x4000, 0xc9f: 0x4000, 0xca0: 0x4000, 0xca1: 0x4000, 0xca2: 0x4000, 0xca3: 0x4000, + 0xca4: 0x4000, 0xca5: 0x4000, 0xca6: 0x4000, 0xca7: 0x4000, 0xca8: 0x4000, 0xca9: 0x4000, + 0xcaa: 0x4000, 0xcab: 0x4000, 0xcac: 0x4000, 0xcad: 0x4000, 0xcae: 0x4000, 0xcaf: 0x4000, + 0xcb0: 0x4000, 0xcb1: 0x4000, 0xcb2: 0x4000, 0xcb3: 0x4000, 0xcb4: 0x4000, 0xcb5: 0x4000, + 0xcb6: 0x4000, 0xcb7: 0x4000, 0xcb8: 0x4000, 0xcb9: 0x4000, 0xcba: 0x4000, 0xcbb: 0x4000, + 0xcbc: 0x4000, 0xcbd: 0x4000, 0xcbe: 0x4000, + // Block 0x33, offset 0xcc0 + 0xcc1: 0x4000, 0xcc2: 0x4000, 0xcc3: 0x4000, 0xcc4: 0x4000, 0xcc5: 0x4000, + 0xcc6: 0x4000, 0xcc7: 0x4000, 0xcc8: 0x4000, 0xcc9: 0x4000, 0xcca: 0x4000, 0xccb: 0x4000, + 0xccc: 0x4000, 0xccd: 0x4000, 0xcce: 0x4000, 0xccf: 0x4000, 0xcd0: 0x4000, 0xcd1: 0x4000, + 0xcd2: 0x4000, 0xcd3: 0x4000, 0xcd4: 0x4000, 0xcd5: 0x4000, 0xcd6: 0x4000, 0xcd7: 0x4000, + 0xcd8: 0x4000, 0xcd9: 0x4000, 0xcda: 0x4000, 0xcdb: 0x4000, 0xcdc: 0x4000, 0xcdd: 0x4000, + 0xcde: 0x4000, 0xcdf: 0x4000, 0xce0: 0x4000, 0xce1: 0x4000, 0xce2: 0x4000, 0xce3: 0x4000, + 0xce4: 0x4000, 0xce5: 0x4000, 0xce6: 0x4000, 0xce7: 0x4000, 0xce8: 0x4000, 0xce9: 0x4000, + 0xcea: 0x4000, 0xceb: 0x4000, 0xcec: 0x4000, 0xced: 0x4000, 0xcee: 0x4000, 0xcef: 0x4000, + 0xcf0: 0x4000, 0xcf1: 0x4000, 0xcf2: 0x4000, 0xcf3: 0x4000, 0xcf4: 0x4000, 0xcf5: 0x4000, + 0xcf6: 0x4000, 0xcf7: 0x4000, 0xcf8: 0x4000, 0xcf9: 0x4000, 0xcfa: 0x4000, 0xcfb: 0x4000, + 0xcfc: 0x4000, 0xcfd: 0x4000, 0xcfe: 0x4000, 0xcff: 0x4000, + // Block 0x34, offset 0xd00 + 0xd00: 0x4000, 0xd01: 0x4000, 0xd02: 0x4000, 0xd03: 0x4000, 0xd04: 0x4000, 0xd05: 0x4000, + 0xd06: 0x4000, 0xd07: 0x4000, 0xd08: 0x4000, 0xd09: 0x4000, 0xd0a: 0x4000, 0xd0b: 0x4000, + 0xd0c: 0x4000, 0xd0d: 0x4000, 0xd0e: 0x4000, 0xd0f: 0x4000, 0xd10: 0x4000, 0xd11: 0x4000, + 0xd12: 0x4000, 0xd13: 0x4000, 0xd14: 0x4000, 0xd15: 0x4000, 0xd16: 0x4000, + 0xd19: 0x4016, 0xd1a: 0x4017, 0xd1b: 0x4000, 0xd1c: 0x4000, 0xd1d: 0x4000, + 0xd1e: 0x4000, 0xd1f: 0x4000, 0xd20: 0x4000, 0xd21: 0x4018, 0xd22: 0x4019, 0xd23: 0x401a, + 0xd24: 0x401b, 0xd25: 0x401c, 0xd26: 0x401d, 0xd27: 0x401e, 0xd28: 0x401f, 0xd29: 0x4020, + 0xd2a: 0x4021, 0xd2b: 0x4022, 0xd2c: 0x4000, 0xd2d: 0x4010, 0xd2e: 0x4000, 0xd2f: 0x4023, + 0xd30: 0x4000, 0xd31: 0x4024, 0xd32: 0x4000, 0xd33: 0x4025, 0xd34: 0x4000, 0xd35: 0x4026, + 0xd36: 0x4000, 0xd37: 0x401a, 0xd38: 0x4000, 0xd39: 0x4027, 0xd3a: 0x4000, 0xd3b: 0x4028, + 0xd3c: 0x4000, 0xd3d: 0x4020, 0xd3e: 0x4000, 0xd3f: 0x4029, + // Block 0x35, offset 0xd40 + 0xd40: 0x4000, 0xd41: 0x402a, 0xd42: 0x4000, 0xd43: 0x402b, 0xd44: 0x402c, 0xd45: 0x4000, + 0xd46: 0x4017, 0xd47: 0x4000, 0xd48: 0x402d, 0xd49: 0x4000, 0xd4a: 0x402e, 0xd4b: 0x402f, + 0xd4c: 0x4030, 0xd4d: 0x4017, 0xd4e: 0x4016, 0xd4f: 0x4017, 0xd50: 0x4000, 0xd51: 0x4000, + 0xd52: 0x4031, 0xd53: 0x4000, 0xd54: 0x4000, 0xd55: 0x4031, 0xd56: 0x4000, 0xd57: 0x4000, + 0xd58: 0x4032, 0xd59: 0x4000, 0xd5a: 0x4000, 0xd5b: 0x4032, 0xd5c: 0x4000, 0xd5d: 0x4000, + 0xd5e: 0x4033, 0xd5f: 0x402e, 0xd60: 0x4034, 0xd61: 0x4035, 0xd62: 0x4034, 0xd63: 0x4036, + 0xd64: 0x4037, 0xd65: 0x4024, 0xd66: 0x4035, 0xd67: 0x4025, 0xd68: 0x4038, 0xd69: 0x4038, + 0xd6a: 0x4039, 0xd6b: 0x4039, 0xd6c: 0x403a, 0xd6d: 0x403a, 0xd6e: 0x4000, 0xd6f: 0x4035, + 0xd70: 0x4000, 0xd71: 0x4000, 0xd72: 0x403b, 0xd73: 0x403c, 0xd74: 0x4000, 0xd75: 0x4000, + 0xd76: 0x4000, 0xd77: 0x4000, 0xd78: 0x4000, 0xd79: 0x4000, 0xd7a: 0x4000, 0xd7b: 0x403d, + 0xd7c: 0x401c, 0xd7d: 0x4000, 0xd7e: 0x4000, 0xd7f: 0x4000, + // Block 0x36, offset 0xd80 + 0xd85: 0x4000, + 0xd86: 0x4000, 0xd87: 0x4000, 0xd88: 0x4000, 0xd89: 0x4000, 0xd8a: 0x4000, 0xd8b: 0x4000, + 0xd8c: 0x4000, 0xd8d: 0x4000, 0xd8e: 0x4000, 0xd8f: 0x4000, 0xd90: 0x4000, 0xd91: 0x4000, + 0xd92: 0x4000, 0xd93: 0x4000, 0xd94: 0x4000, 0xd95: 0x4000, 0xd96: 0x4000, 0xd97: 0x4000, + 0xd98: 0x4000, 0xd99: 0x4000, 0xd9a: 0x4000, 0xd9b: 0x4000, 0xd9c: 0x4000, 0xd9d: 0x4000, + 0xd9e: 0x4000, 0xd9f: 0x4000, 0xda0: 0x4000, 0xda1: 0x4000, 0xda2: 0x4000, 0xda3: 0x4000, + 0xda4: 0x4000, 0xda5: 0x4000, 0xda6: 0x4000, 0xda7: 0x4000, 0xda8: 0x4000, 0xda9: 0x4000, + 0xdaa: 0x4000, 0xdab: 0x4000, 0xdac: 0x4000, 0xdad: 0x4000, 0xdae: 0x4000, 0xdaf: 0x4000, + 0xdb1: 0x403e, 0xdb2: 0x403e, 0xdb3: 0x403e, 0xdb4: 0x403e, 0xdb5: 0x403e, + 0xdb6: 0x403e, 0xdb7: 0x403e, 0xdb8: 0x403e, 0xdb9: 0x403e, 0xdba: 0x403e, 0xdbb: 0x403e, + 0xdbc: 0x403e, 0xdbd: 0x403e, 0xdbe: 0x403e, 0xdbf: 0x403e, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x4037, 0xdc1: 0x4037, 0xdc2: 0x4037, 0xdc3: 0x4037, 0xdc4: 0x4037, 0xdc5: 0x4037, + 0xdc6: 0x4037, 0xdc7: 0x4037, 0xdc8: 0x4037, 0xdc9: 0x4037, 0xdca: 0x4037, 0xdcb: 0x4037, + 0xdcc: 0x4037, 0xdcd: 0x4037, 0xdce: 0x4037, 0xdcf: 0x400e, 0xdd0: 0x403f, 0xdd1: 0x4040, + 0xdd2: 0x4041, 0xdd3: 0x4040, 0xdd4: 0x403f, 0xdd5: 0x4042, 0xdd6: 0x4043, 0xdd7: 0x4044, + 0xdd8: 0x4040, 0xdd9: 0x4041, 0xdda: 0x4040, 0xddb: 0x4045, 0xddc: 0x4009, 0xddd: 0x4045, + 0xdde: 0x4046, 0xddf: 0x4045, 0xde0: 0x4047, 0xde1: 0x400b, 0xde2: 0x400a, 0xde3: 0x400c, + 0xde4: 0x4048, 0xde5: 0x4000, 0xde6: 0x4000, 0xde7: 0x4000, 0xde8: 0x4000, 0xde9: 0x4000, + 0xdea: 0x4000, 0xdeb: 0x4000, 0xdec: 0x4000, 0xded: 0x4000, 0xdee: 0x4000, 0xdef: 0x4000, + 0xdf0: 0x4000, 0xdf1: 0x4000, 0xdf2: 0x4000, 0xdf3: 0x4000, 0xdf4: 0x4000, 0xdf5: 0x4000, + 0xdf6: 0x4000, 0xdf7: 0x4000, 0xdf8: 0x4000, 0xdf9: 0x4000, 0xdfa: 0x4000, 0xdfb: 0x4000, + 0xdfc: 0x4000, 0xdfd: 0x4000, 0xdfe: 0x4000, 0xdff: 0x4000, + // Block 0x38, offset 0xe00 + 0xe00: 0x4000, 0xe01: 0x4000, 0xe02: 0x4000, 0xe03: 0x4000, 0xe04: 0x4000, 0xe05: 0x4000, + 0xe06: 0x4000, 0xe07: 0x4000, 0xe08: 0x4000, 0xe09: 0x4000, 0xe0a: 0x4000, 0xe0b: 0x4000, + 0xe0c: 0x4000, 0xe0d: 0x4000, 0xe0e: 0x4000, 0xe10: 0x4000, 0xe11: 0x4000, + 0xe12: 0x4000, 0xe13: 0x4000, 0xe14: 0x4000, 0xe15: 0x4000, 0xe16: 0x4000, 0xe17: 0x4000, + 0xe18: 0x4000, 0xe19: 0x4000, 0xe1a: 0x4000, 0xe1b: 0x4000, 0xe1c: 0x4000, 0xe1d: 0x4000, + 0xe1e: 0x4000, 0xe1f: 0x4000, 0xe20: 0x4000, 0xe21: 0x4000, 0xe22: 0x4000, 0xe23: 0x4000, + 0xe24: 0x4000, 0xe25: 0x4000, 0xe26: 0x4000, 0xe27: 0x4000, 0xe28: 0x4000, 0xe29: 0x4000, + 0xe2a: 0x4000, 0xe2b: 0x4000, 0xe2c: 0x4000, 0xe2d: 0x4000, 0xe2e: 0x4000, 0xe2f: 0x4000, + 0xe30: 0x4000, 0xe31: 0x4000, 0xe32: 0x4000, 0xe33: 0x4000, 0xe34: 0x4000, 0xe35: 0x4000, + 0xe36: 0x4000, 0xe37: 0x4000, 0xe38: 0x4000, 0xe39: 0x4000, 0xe3a: 0x4000, 0xe3b: 0x4000, + 0xe3c: 0x4000, 0xe3d: 0x4000, 0xe3e: 0x4000, 0xe3f: 0x4000, + // Block 0x39, offset 0xe40 + 0xe40: 0x4000, 0xe41: 0x4000, 0xe42: 0x4000, 0xe43: 0x4000, 0xe44: 0x4000, 0xe45: 0x4000, + 0xe46: 0x4000, 0xe47: 0x4000, 0xe48: 0x4000, 0xe49: 0x4000, 0xe4a: 0x4000, 0xe4b: 0x4000, + 0xe4c: 0x4000, 0xe4d: 0x4000, 0xe4e: 0x4000, 0xe4f: 0x4000, 0xe50: 0x4000, 0xe51: 0x4000, + 0xe52: 0x4000, 0xe53: 0x4000, 0xe54: 0x4000, 0xe55: 0x4000, 0xe56: 0x4000, 0xe57: 0x4000, + 0xe58: 0x4000, 0xe59: 0x4000, 0xe5a: 0x4000, 0xe5b: 0x4000, 0xe5c: 0x4000, 0xe5d: 0x4000, + 0xe5e: 0x4000, 0xe5f: 0x4000, 0xe60: 0x4000, 0xe61: 0x4000, 0xe62: 0x4000, 0xe63: 0x4000, + 0xe70: 0x4000, 0xe71: 0x4000, 0xe72: 0x4000, 0xe73: 0x4000, 0xe74: 0x4000, 0xe75: 0x4000, + 0xe76: 0x4000, 0xe77: 0x4000, 0xe78: 0x4000, 0xe79: 0x4000, 0xe7a: 0x4000, 0xe7b: 0x4000, + 0xe7c: 0x4000, 0xe7d: 0x4000, 0xe7e: 0x4000, 0xe7f: 0x4000, + // Block 0x3a, offset 0xe80 + 0xe80: 0x4000, 0xe81: 0x4000, 0xe82: 0x4000, 0xe83: 0x4000, 0xe84: 0x4000, 0xe85: 0x4000, + 0xe86: 0x4000, 0xe87: 0x4000, 0xe88: 0x4000, 0xe89: 0x4000, 0xe8a: 0x4000, 0xe8b: 0x4000, + 0xe8c: 0x4000, 0xe8d: 0x4000, 0xe8e: 0x4000, 0xe8f: 0x4000, 0xe90: 0x4000, 0xe91: 0x4000, + 0xe92: 0x4000, 0xe93: 0x4000, 0xe94: 0x4000, 0xe95: 0x4000, 0xe96: 0x4000, 0xe97: 0x4000, + 0xe98: 0x4000, 0xe99: 0x4000, 0xe9a: 0x4000, 0xe9b: 0x4000, 0xe9c: 0x4000, 0xe9d: 0x4000, + 0xe9e: 0x4000, 0xea0: 0x4000, 0xea1: 0x4000, 0xea2: 0x4000, 0xea3: 0x4000, + 0xea4: 0x4000, 0xea5: 0x4000, 0xea6: 0x4000, 0xea7: 0x4000, 0xea8: 0x4000, 0xea9: 0x4000, + 0xeaa: 0x4000, 0xeab: 0x4000, 0xeac: 0x4000, 0xead: 0x4000, 0xeae: 0x4000, 0xeaf: 0x4000, + 0xeb0: 0x4000, 0xeb1: 0x4000, 0xeb2: 0x4000, 0xeb3: 0x4000, 0xeb4: 0x4000, 0xeb5: 0x4000, + 0xeb6: 0x4000, 0xeb7: 0x4000, 0xeb8: 0x4000, 0xeb9: 0x4000, 0xeba: 0x4000, 0xebb: 0x4000, + 0xebc: 0x4000, 0xebd: 0x4000, 0xebe: 0x4000, 0xebf: 0x4000, + // Block 0x3b, offset 0xec0 + 0xec0: 0x4000, 0xec1: 0x4000, 0xec2: 0x4000, 0xec3: 0x4000, 0xec4: 0x4000, 0xec5: 0x4000, + 0xec6: 0x4000, 0xec7: 0x4000, 0xec8: 0x2000, 0xec9: 0x2000, 0xeca: 0x2000, 0xecb: 0x2000, + 0xecc: 0x2000, 0xecd: 0x2000, 0xece: 0x2000, 0xecf: 0x2000, 0xed0: 0x4000, 0xed1: 0x4000, + 0xed2: 0x4000, 0xed3: 0x4000, 0xed4: 0x4000, 0xed5: 0x4000, 0xed6: 0x4000, 0xed7: 0x4000, + 0xed8: 0x4000, 0xed9: 0x4000, 0xeda: 0x4000, 0xedb: 0x4000, 0xedc: 0x4000, 0xedd: 0x4000, + 0xede: 0x4000, 0xedf: 0x4000, 0xee0: 0x4000, 0xee1: 0x4000, 0xee2: 0x4000, 0xee3: 0x4000, + 0xee4: 0x4000, 0xee5: 0x4000, 0xee6: 0x4000, 0xee7: 0x4000, 0xee8: 0x4000, 0xee9: 0x4000, + 0xeea: 0x4000, 0xeeb: 0x4000, 0xeec: 0x4000, 0xeed: 0x4000, 0xeee: 0x4000, 0xeef: 0x4000, + 0xef0: 0x4000, 0xef1: 0x4000, 0xef2: 0x4000, 0xef3: 0x4000, 0xef4: 0x4000, 0xef5: 0x4000, + 0xef6: 0x4000, 0xef7: 0x4000, 0xef8: 0x4000, 0xef9: 0x4000, 0xefa: 0x4000, 0xefb: 0x4000, + 0xefc: 0x4000, 0xefd: 0x4000, 0xefe: 0x4000, 0xeff: 0x4000, + // Block 0x3c, offset 0xf00 + 0xf00: 0x4000, 0xf01: 0x4000, 0xf02: 0x4000, 0xf03: 0x4000, 0xf04: 0x4000, 0xf05: 0x4000, + 0xf06: 0x4000, 0xf07: 0x4000, 0xf08: 0x4000, 0xf09: 0x4000, 0xf0a: 0x4000, 0xf0b: 0x4000, + 0xf0c: 0x4000, 0xf10: 0x4000, 0xf11: 0x4000, + 0xf12: 0x4000, 0xf13: 0x4000, 0xf14: 0x4000, 0xf15: 0x4000, 0xf16: 0x4000, 0xf17: 0x4000, + 0xf18: 0x4000, 0xf19: 0x4000, 0xf1a: 0x4000, 0xf1b: 0x4000, 0xf1c: 0x4000, 0xf1d: 0x4000, + 0xf1e: 0x4000, 0xf1f: 0x4000, 0xf20: 0x4000, 0xf21: 0x4000, 0xf22: 0x4000, 0xf23: 0x4000, + 0xf24: 0x4000, 0xf25: 0x4000, 0xf26: 0x4000, 0xf27: 0x4000, 0xf28: 0x4000, 0xf29: 0x4000, + 0xf2a: 0x4000, 0xf2b: 0x4000, 0xf2c: 0x4000, 0xf2d: 0x4000, 0xf2e: 0x4000, 0xf2f: 0x4000, + 0xf30: 0x4000, 0xf31: 0x4000, 0xf32: 0x4000, 0xf33: 0x4000, 0xf34: 0x4000, 0xf35: 0x4000, + 0xf36: 0x4000, 0xf37: 0x4000, 0xf38: 0x4000, 0xf39: 0x4000, 0xf3a: 0x4000, 0xf3b: 0x4000, + 0xf3c: 0x4000, 0xf3d: 0x4000, 0xf3e: 0x4000, 0xf3f: 0x4000, + // Block 0x3d, offset 0xf40 + 0xf40: 0x4000, 0xf41: 0x4000, 0xf42: 0x4000, 0xf43: 0x4000, 0xf44: 0x4000, 0xf45: 0x4000, + 0xf46: 0x4000, + // Block 0x3e, offset 0xf80 + 0xfa0: 0x4000, 0xfa1: 0x4000, 0xfa2: 0x4000, 0xfa3: 0x4000, + 0xfa4: 0x4000, 0xfa5: 0x4000, 0xfa6: 0x4000, 0xfa7: 0x4000, 0xfa8: 0x4000, 0xfa9: 0x4000, + 0xfaa: 0x4000, 0xfab: 0x4000, 0xfac: 0x4000, 0xfad: 0x4000, 0xfae: 0x4000, 0xfaf: 0x4000, + 0xfb0: 0x4000, 0xfb1: 0x4000, 0xfb2: 0x4000, 0xfb3: 0x4000, 0xfb4: 0x4000, 0xfb5: 0x4000, + 0xfb6: 0x4000, 0xfb7: 0x4000, 0xfb8: 0x4000, 0xfb9: 0x4000, 0xfba: 0x4000, 0xfbb: 0x4000, + 0xfbc: 0x4000, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x4000, 0xfc1: 0x4000, 0xfc2: 0x4000, 0xfc3: 0x4000, 0xfc4: 0x4000, 0xfc5: 0x4000, + 0xfc6: 0x4000, 0xfc7: 0x4000, 0xfc8: 0x4000, 0xfc9: 0x4000, 0xfca: 0x4000, 0xfcb: 0x4000, + 0xfcc: 0x4000, 0xfcd: 0x4000, 0xfce: 0x4000, 0xfcf: 0x4000, 0xfd0: 0x4000, 0xfd1: 0x4000, + 0xfd2: 0x4000, 0xfd3: 0x4000, 0xfd4: 0x4000, 0xfd5: 0x4000, 0xfd6: 0x4000, 0xfd7: 0x4000, + 0xfd8: 0x4000, 0xfd9: 0x4000, 0xfda: 0x4000, 0xfdb: 0x4000, 0xfdc: 0x4000, 0xfdd: 0x4000, + 0xfde: 0x4000, 0xfdf: 0x4000, 0xfe0: 0x4000, 0xfe1: 0x4000, 0xfe2: 0x4000, 0xfe3: 0x4000, + // Block 0x40, offset 0x1000 + 0x1000: 0x2000, 0x1001: 0x2000, 0x1002: 0x2000, 0x1003: 0x2000, 0x1004: 0x2000, 0x1005: 0x2000, + 0x1006: 0x2000, 0x1007: 0x2000, 0x1008: 0x2000, 0x1009: 0x2000, 0x100a: 0x2000, 0x100b: 0x2000, + 0x100c: 0x2000, 0x100d: 0x2000, 0x100e: 0x2000, 0x100f: 0x2000, 0x1010: 0x4000, 0x1011: 0x4000, + 0x1012: 0x4000, 0x1013: 0x4000, 0x1014: 0x4000, 0x1015: 0x4000, 0x1016: 0x4000, 0x1017: 0x4000, + 0x1018: 0x4000, 0x1019: 0x4000, + 0x1030: 0x4000, 0x1031: 0x4000, 0x1032: 0x4000, 0x1033: 0x4000, 0x1034: 0x4000, 0x1035: 0x4000, + 0x1036: 0x4000, 0x1037: 0x4000, 0x1038: 0x4000, 0x1039: 0x4000, 0x103a: 0x4000, 0x103b: 0x4000, + 0x103c: 0x4000, 0x103d: 0x4000, 0x103e: 0x4000, 0x103f: 0x4000, + // Block 0x41, offset 0x1040 + 0x1040: 0x4000, 0x1041: 0x4000, 0x1042: 0x4000, 0x1043: 0x4000, 0x1044: 0x4000, 0x1045: 0x4000, + 0x1046: 0x4000, 0x1047: 0x4000, 0x1048: 0x4000, 0x1049: 0x4000, 0x104a: 0x4000, 0x104b: 0x4000, + 0x104c: 0x4000, 0x104d: 0x4000, 0x104e: 0x4000, 0x104f: 0x4000, 0x1050: 0x4000, 0x1051: 0x4000, + 0x1052: 0x4000, 0x1054: 0x4000, 0x1055: 0x4000, 0x1056: 0x4000, 0x1057: 0x4000, + 0x1058: 0x4000, 0x1059: 0x4000, 0x105a: 0x4000, 0x105b: 0x4000, 0x105c: 0x4000, 0x105d: 0x4000, + 0x105e: 0x4000, 0x105f: 0x4000, 0x1060: 0x4000, 0x1061: 0x4000, 0x1062: 0x4000, 0x1063: 0x4000, + 0x1064: 0x4000, 0x1065: 0x4000, 0x1066: 0x4000, 0x1068: 0x4000, 0x1069: 0x4000, + 0x106a: 0x4000, 0x106b: 0x4000, + // Block 0x42, offset 0x1080 + 0x1081: 0x9012, 0x1082: 0x9012, 0x1083: 0x9012, 0x1084: 0x9012, 0x1085: 0x9012, + 0x1086: 0x9012, 0x1087: 0x9012, 0x1088: 0x9012, 0x1089: 0x9012, 0x108a: 0x9012, 0x108b: 0x9012, + 0x108c: 0x9012, 0x108d: 0x9012, 0x108e: 0x9012, 0x108f: 0x9012, 0x1090: 0x9012, 0x1091: 0x9012, + 0x1092: 0x9012, 0x1093: 0x9012, 0x1094: 0x9012, 0x1095: 0x9012, 0x1096: 0x9012, 0x1097: 0x9012, + 0x1098: 0x9012, 0x1099: 0x9012, 0x109a: 0x9012, 0x109b: 0x9012, 0x109c: 0x9012, 0x109d: 0x9012, + 0x109e: 0x9012, 0x109f: 0x9012, 0x10a0: 0x9049, 0x10a1: 0x9049, 0x10a2: 0x9049, 0x10a3: 0x9049, + 0x10a4: 0x9049, 0x10a5: 0x9049, 0x10a6: 0x9049, 0x10a7: 0x9049, 0x10a8: 0x9049, 0x10a9: 0x9049, + 0x10aa: 0x9049, 0x10ab: 0x9049, 0x10ac: 0x9049, 0x10ad: 0x9049, 0x10ae: 0x9049, 0x10af: 0x9049, + 0x10b0: 0x9049, 0x10b1: 0x9049, 0x10b2: 0x9049, 0x10b3: 0x9049, 0x10b4: 0x9049, 0x10b5: 0x9049, + 0x10b6: 0x9049, 0x10b7: 0x9049, 0x10b8: 0x9049, 0x10b9: 0x9049, 0x10ba: 0x9049, 0x10bb: 0x9049, + 0x10bc: 0x9049, 0x10bd: 0x9049, 0x10be: 0x9049, 0x10bf: 0x9049, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x9049, 0x10c1: 0x9049, 0x10c2: 0x9049, 0x10c3: 0x9049, 0x10c4: 0x9049, 0x10c5: 0x9049, + 0x10c6: 0x9049, 0x10c7: 0x9049, 0x10c8: 0x9049, 0x10c9: 0x9049, 0x10ca: 0x9049, 0x10cb: 0x9049, + 0x10cc: 0x9049, 0x10cd: 0x9049, 0x10ce: 0x9049, 0x10cf: 0x9049, 0x10d0: 0x9049, 0x10d1: 0x9049, + 0x10d2: 0x9049, 0x10d3: 0x9049, 0x10d4: 0x9049, 0x10d5: 0x9049, 0x10d6: 0x9049, 0x10d7: 0x9049, + 0x10d8: 0x9049, 0x10d9: 0x9049, 0x10da: 0x9049, 0x10db: 0x9049, 0x10dc: 0x9049, 0x10dd: 0x9049, + 0x10de: 0x9049, 0x10df: 0x904a, 0x10e0: 0x904b, 0x10e1: 0xb04c, 0x10e2: 0xb04d, 0x10e3: 0xb04d, + 0x10e4: 0xb04e, 0x10e5: 0xb04f, 0x10e6: 0xb050, 0x10e7: 0xb051, 0x10e8: 0xb052, 0x10e9: 0xb053, + 0x10ea: 0xb054, 0x10eb: 0xb055, 0x10ec: 0xb056, 0x10ed: 0xb057, 0x10ee: 0xb058, 0x10ef: 0xb059, + 0x10f0: 0xb05a, 0x10f1: 0xb05b, 0x10f2: 0xb05c, 0x10f3: 0xb05d, 0x10f4: 0xb05e, 0x10f5: 0xb05f, + 0x10f6: 0xb060, 0x10f7: 0xb061, 0x10f8: 0xb062, 0x10f9: 0xb063, 0x10fa: 0xb064, 0x10fb: 0xb065, + 0x10fc: 0xb052, 0x10fd: 0xb066, 0x10fe: 0xb067, 0x10ff: 0xb055, + // Block 0x44, offset 0x1100 + 0x1100: 0xb068, 0x1101: 0xb069, 0x1102: 0xb06a, 0x1103: 0xb06b, 0x1104: 0xb05a, 0x1105: 0xb056, + 0x1106: 0xb06c, 0x1107: 0xb06d, 0x1108: 0xb06b, 0x1109: 0xb06e, 0x110a: 0xb06b, 0x110b: 0xb06f, + 0x110c: 0xb06f, 0x110d: 0xb070, 0x110e: 0xb070, 0x110f: 0xb071, 0x1110: 0xb056, 0x1111: 0xb072, + 0x1112: 0xb073, 0x1113: 0xb072, 0x1114: 0xb074, 0x1115: 0xb073, 0x1116: 0xb075, 0x1117: 0xb075, + 0x1118: 0xb076, 0x1119: 0xb076, 0x111a: 0xb077, 0x111b: 0xb077, 0x111c: 0xb073, 0x111d: 0xb078, + 0x111e: 0xb079, 0x111f: 0xb067, 0x1120: 0xb07a, 0x1121: 0xb07b, 0x1122: 0xb07b, 0x1123: 0xb07b, + 0x1124: 0xb07b, 0x1125: 0xb07b, 0x1126: 0xb07b, 0x1127: 0xb07b, 0x1128: 0xb07b, 0x1129: 0xb07b, + 0x112a: 0xb07b, 0x112b: 0xb07b, 0x112c: 0xb07b, 0x112d: 0xb07b, 0x112e: 0xb07b, 0x112f: 0xb07b, + 0x1130: 0xb07c, 0x1131: 0xb07c, 0x1132: 0xb07c, 0x1133: 0xb07c, 0x1134: 0xb07c, 0x1135: 0xb07c, + 0x1136: 0xb07c, 0x1137: 0xb07c, 0x1138: 0xb07c, 0x1139: 0xb07c, 0x113a: 0xb07c, 0x113b: 0xb07c, + 0x113c: 0xb07c, 0x113d: 0xb07c, 0x113e: 0xb07c, + // Block 0x45, offset 0x1140 + 0x1142: 0xb07d, 0x1143: 0xb07e, 0x1144: 0xb07f, 0x1145: 0xb080, + 0x1146: 0xb07f, 0x1147: 0xb07e, 0x114a: 0xb081, 0x114b: 0xb082, + 0x114c: 0xb083, 0x114d: 0xb07f, 0x114e: 0xb080, 0x114f: 0xb07f, + 0x1152: 0xb084, 0x1153: 0xb085, 0x1154: 0xb084, 0x1155: 0xb086, 0x1156: 0xb084, 0x1157: 0xb087, + 0x115a: 0xb088, 0x115b: 0xb089, 0x115c: 0xb08a, + 0x1160: 0x908b, 0x1161: 0x908b, 0x1162: 0x908c, 0x1163: 0x908d, + 0x1164: 0x908b, 0x1165: 0x908e, 0x1166: 0x908f, 0x1168: 0xb090, 0x1169: 0xb091, + 0x116a: 0xb092, 0x116b: 0xb091, 0x116c: 0xb093, 0x116d: 0xb094, 0x116e: 0xb095, + 0x117d: 0x2000, + // Block 0x46, offset 0x1180 + 0x11a0: 0x4000, 0x11a1: 0x4000, 0x11a2: 0x4000, 0x11a3: 0x4000, + 0x11a4: 0x4000, + 0x11b0: 0x4000, 0x11b1: 0x4000, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x4000, 0x11c1: 0x4000, 0x11c2: 0x4000, 0x11c3: 0x4000, 0x11c4: 0x4000, 0x11c5: 0x4000, + 0x11c6: 0x4000, 0x11c7: 0x4000, 0x11c8: 0x4000, 0x11c9: 0x4000, 0x11ca: 0x4000, 0x11cb: 0x4000, + 0x11cc: 0x4000, 0x11cd: 0x4000, 0x11ce: 0x4000, 0x11cf: 0x4000, 0x11d0: 0x4000, 0x11d1: 0x4000, + 0x11d2: 0x4000, 0x11d3: 0x4000, 0x11d4: 0x4000, 0x11d5: 0x4000, 0x11d6: 0x4000, 0x11d7: 0x4000, + 0x11d8: 0x4000, 0x11d9: 0x4000, 0x11da: 0x4000, 0x11db: 0x4000, 0x11dc: 0x4000, 0x11dd: 0x4000, + 0x11de: 0x4000, 0x11df: 0x4000, 0x11e0: 0x4000, 0x11e1: 0x4000, 0x11e2: 0x4000, 0x11e3: 0x4000, + 0x11e4: 0x4000, 0x11e5: 0x4000, 0x11e6: 0x4000, 0x11e7: 0x4000, 0x11e8: 0x4000, 0x11e9: 0x4000, + 0x11ea: 0x4000, 0x11eb: 0x4000, 0x11ec: 0x4000, 0x11ed: 0x4000, 0x11ee: 0x4000, 0x11ef: 0x4000, + 0x11f0: 0x4000, 0x11f1: 0x4000, 0x11f2: 0x4000, 0x11f3: 0x4000, 0x11f4: 0x4000, 0x11f5: 0x4000, + 0x11f6: 0x4000, 0x11f7: 0x4000, + // Block 0x48, offset 0x1200 + 0x1200: 0x4000, 0x1201: 0x4000, 0x1202: 0x4000, 0x1203: 0x4000, 0x1204: 0x4000, 0x1205: 0x4000, + 0x1206: 0x4000, 0x1207: 0x4000, 0x1208: 0x4000, 0x1209: 0x4000, 0x120a: 0x4000, 0x120b: 0x4000, + 0x120c: 0x4000, 0x120d: 0x4000, 0x120e: 0x4000, 0x120f: 0x4000, 0x1210: 0x4000, 0x1211: 0x4000, + 0x1212: 0x4000, 0x1213: 0x4000, 0x1214: 0x4000, 0x1215: 0x4000, + // Block 0x49, offset 0x1240 + 0x1240: 0x4000, 0x1241: 0x4000, 0x1242: 0x4000, 0x1243: 0x4000, 0x1244: 0x4000, 0x1245: 0x4000, + 0x1246: 0x4000, 0x1247: 0x4000, 0x1248: 0x4000, + // Block 0x4a, offset 0x1280 + 0x12b0: 0x4000, 0x12b1: 0x4000, 0x12b2: 0x4000, 0x12b3: 0x4000, 0x12b5: 0x4000, + 0x12b6: 0x4000, 0x12b7: 0x4000, 0x12b8: 0x4000, 0x12b9: 0x4000, 0x12ba: 0x4000, 0x12bb: 0x4000, + 0x12bd: 0x4000, 0x12be: 0x4000, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x4000, 0x12c1: 0x4000, 0x12c2: 0x4000, 0x12c3: 0x4000, 0x12c4: 0x4000, 0x12c5: 0x4000, + 0x12c6: 0x4000, 0x12c7: 0x4000, 0x12c8: 0x4000, 0x12c9: 0x4000, 0x12ca: 0x4000, 0x12cb: 0x4000, + 0x12cc: 0x4000, 0x12cd: 0x4000, 0x12ce: 0x4000, 0x12cf: 0x4000, 0x12d0: 0x4000, 0x12d1: 0x4000, + 0x12d2: 0x4000, 0x12d3: 0x4000, 0x12d4: 0x4000, 0x12d5: 0x4000, 0x12d6: 0x4000, 0x12d7: 0x4000, + 0x12d8: 0x4000, 0x12d9: 0x4000, 0x12da: 0x4000, 0x12db: 0x4000, 0x12dc: 0x4000, 0x12dd: 0x4000, + 0x12de: 0x4000, 0x12df: 0x4000, 0x12e0: 0x4000, 0x12e1: 0x4000, 0x12e2: 0x4000, + 0x12f2: 0x4000, + // Block 0x4c, offset 0x1300 + 0x1310: 0x4000, 0x1311: 0x4000, + 0x1312: 0x4000, 0x1315: 0x4000, + 0x1324: 0x4000, 0x1325: 0x4000, 0x1326: 0x4000, 0x1327: 0x4000, + 0x1330: 0x4000, 0x1331: 0x4000, 0x1332: 0x4000, 0x1333: 0x4000, 0x1334: 0x4000, 0x1335: 0x4000, + 0x1336: 0x4000, 0x1337: 0x4000, 0x1338: 0x4000, 0x1339: 0x4000, 0x133a: 0x4000, 0x133b: 0x4000, + 0x133c: 0x4000, 0x133d: 0x4000, 0x133e: 0x4000, 0x133f: 0x4000, + // Block 0x4d, offset 0x1340 + 0x1340: 0x4000, 0x1341: 0x4000, 0x1342: 0x4000, 0x1343: 0x4000, 0x1344: 0x4000, 0x1345: 0x4000, + 0x1346: 0x4000, 0x1347: 0x4000, 0x1348: 0x4000, 0x1349: 0x4000, 0x134a: 0x4000, 0x134b: 0x4000, + 0x134c: 0x4000, 0x134d: 0x4000, 0x134e: 0x4000, 0x134f: 0x4000, 0x1350: 0x4000, 0x1351: 0x4000, + 0x1352: 0x4000, 0x1353: 0x4000, 0x1354: 0x4000, 0x1355: 0x4000, 0x1356: 0x4000, 0x1357: 0x4000, + 0x1358: 0x4000, 0x1359: 0x4000, 0x135a: 0x4000, 0x135b: 0x4000, 0x135c: 0x4000, 0x135d: 0x4000, + 0x135e: 0x4000, 0x135f: 0x4000, 0x1360: 0x4000, 0x1361: 0x4000, 0x1362: 0x4000, 0x1363: 0x4000, + 0x1364: 0x4000, 0x1365: 0x4000, 0x1366: 0x4000, 0x1367: 0x4000, 0x1368: 0x4000, 0x1369: 0x4000, + 0x136a: 0x4000, 0x136b: 0x4000, 0x136c: 0x4000, 0x136d: 0x4000, 0x136e: 0x4000, 0x136f: 0x4000, + 0x1370: 0x4000, 0x1371: 0x4000, 0x1372: 0x4000, 0x1373: 0x4000, 0x1374: 0x4000, 0x1375: 0x4000, + 0x1376: 0x4000, 0x1377: 0x4000, 0x1378: 0x4000, 0x1379: 0x4000, 0x137a: 0x4000, 0x137b: 0x4000, + // Block 0x4e, offset 0x1380 + 0x1384: 0x4000, + // Block 0x4f, offset 0x13c0 + 0x13cf: 0x4000, + // Block 0x50, offset 0x1400 + 0x1400: 0x2000, 0x1401: 0x2000, 0x1402: 0x2000, 0x1403: 0x2000, 0x1404: 0x2000, 0x1405: 0x2000, + 0x1406: 0x2000, 0x1407: 0x2000, 0x1408: 0x2000, 0x1409: 0x2000, 0x140a: 0x2000, + 0x1410: 0x2000, 0x1411: 0x2000, + 0x1412: 0x2000, 0x1413: 0x2000, 0x1414: 0x2000, 0x1415: 0x2000, 0x1416: 0x2000, 0x1417: 0x2000, + 0x1418: 0x2000, 0x1419: 0x2000, 0x141a: 0x2000, 0x141b: 0x2000, 0x141c: 0x2000, 0x141d: 0x2000, + 0x141e: 0x2000, 0x141f: 0x2000, 0x1420: 0x2000, 0x1421: 0x2000, 0x1422: 0x2000, 0x1423: 0x2000, + 0x1424: 0x2000, 0x1425: 0x2000, 0x1426: 0x2000, 0x1427: 0x2000, 0x1428: 0x2000, 0x1429: 0x2000, + 0x142a: 0x2000, 0x142b: 0x2000, 0x142c: 0x2000, 0x142d: 0x2000, + 0x1430: 0x2000, 0x1431: 0x2000, 0x1432: 0x2000, 0x1433: 0x2000, 0x1434: 0x2000, 0x1435: 0x2000, + 0x1436: 0x2000, 0x1437: 0x2000, 0x1438: 0x2000, 0x1439: 0x2000, 0x143a: 0x2000, 0x143b: 0x2000, + 0x143c: 0x2000, 0x143d: 0x2000, 0x143e: 0x2000, 0x143f: 0x2000, + // Block 0x51, offset 0x1440 + 0x1440: 0x2000, 0x1441: 0x2000, 0x1442: 0x2000, 0x1443: 0x2000, 0x1444: 0x2000, 0x1445: 0x2000, + 0x1446: 0x2000, 0x1447: 0x2000, 0x1448: 0x2000, 0x1449: 0x2000, 0x144a: 0x2000, 0x144b: 0x2000, + 0x144c: 0x2000, 0x144d: 0x2000, 0x144e: 0x2000, 0x144f: 0x2000, 0x1450: 0x2000, 0x1451: 0x2000, + 0x1452: 0x2000, 0x1453: 0x2000, 0x1454: 0x2000, 0x1455: 0x2000, 0x1456: 0x2000, 0x1457: 0x2000, + 0x1458: 0x2000, 0x1459: 0x2000, 0x145a: 0x2000, 0x145b: 0x2000, 0x145c: 0x2000, 0x145d: 0x2000, + 0x145e: 0x2000, 0x145f: 0x2000, 0x1460: 0x2000, 0x1461: 0x2000, 0x1462: 0x2000, 0x1463: 0x2000, + 0x1464: 0x2000, 0x1465: 0x2000, 0x1466: 0x2000, 0x1467: 0x2000, 0x1468: 0x2000, 0x1469: 0x2000, + 0x1470: 0x2000, 0x1471: 0x2000, 0x1472: 0x2000, 0x1473: 0x2000, 0x1474: 0x2000, 0x1475: 0x2000, + 0x1476: 0x2000, 0x1477: 0x2000, 0x1478: 0x2000, 0x1479: 0x2000, 0x147a: 0x2000, 0x147b: 0x2000, + 0x147c: 0x2000, 0x147d: 0x2000, 0x147e: 0x2000, 0x147f: 0x2000, + // Block 0x52, offset 0x1480 + 0x1480: 0x2000, 0x1481: 0x2000, 0x1482: 0x2000, 0x1483: 0x2000, 0x1484: 0x2000, 0x1485: 0x2000, + 0x1486: 0x2000, 0x1487: 0x2000, 0x1488: 0x2000, 0x1489: 0x2000, 0x148a: 0x2000, 0x148b: 0x2000, + 0x148c: 0x2000, 0x148d: 0x2000, 0x148e: 0x4000, 0x148f: 0x2000, 0x1490: 0x2000, 0x1491: 0x4000, + 0x1492: 0x4000, 0x1493: 0x4000, 0x1494: 0x4000, 0x1495: 0x4000, 0x1496: 0x4000, 0x1497: 0x4000, + 0x1498: 0x4000, 0x1499: 0x4000, 0x149a: 0x4000, 0x149b: 0x2000, 0x149c: 0x2000, 0x149d: 0x2000, + 0x149e: 0x2000, 0x149f: 0x2000, 0x14a0: 0x2000, 0x14a1: 0x2000, 0x14a2: 0x2000, 0x14a3: 0x2000, + 0x14a4: 0x2000, 0x14a5: 0x2000, 0x14a6: 0x2000, 0x14a7: 0x2000, 0x14a8: 0x2000, 0x14a9: 0x2000, + 0x14aa: 0x2000, 0x14ab: 0x2000, 0x14ac: 0x2000, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x4000, 0x14c1: 0x4000, 0x14c2: 0x4000, + 0x14d0: 0x4000, 0x14d1: 0x4000, + 0x14d2: 0x4000, 0x14d3: 0x4000, 0x14d4: 0x4000, 0x14d5: 0x4000, 0x14d6: 0x4000, 0x14d7: 0x4000, + 0x14d8: 0x4000, 0x14d9: 0x4000, 0x14da: 0x4000, 0x14db: 0x4000, 0x14dc: 0x4000, 0x14dd: 0x4000, + 0x14de: 0x4000, 0x14df: 0x4000, 0x14e0: 0x4000, 0x14e1: 0x4000, 0x14e2: 0x4000, 0x14e3: 0x4000, + 0x14e4: 0x4000, 0x14e5: 0x4000, 0x14e6: 0x4000, 0x14e7: 0x4000, 0x14e8: 0x4000, 0x14e9: 0x4000, + 0x14ea: 0x4000, 0x14eb: 0x4000, 0x14ec: 0x4000, 0x14ed: 0x4000, 0x14ee: 0x4000, 0x14ef: 0x4000, + 0x14f0: 0x4000, 0x14f1: 0x4000, 0x14f2: 0x4000, 0x14f3: 0x4000, 0x14f4: 0x4000, 0x14f5: 0x4000, + 0x14f6: 0x4000, 0x14f7: 0x4000, 0x14f8: 0x4000, 0x14f9: 0x4000, 0x14fa: 0x4000, 0x14fb: 0x4000, + // Block 0x54, offset 0x1500 + 0x1500: 0x4000, 0x1501: 0x4000, 0x1502: 0x4000, 0x1503: 0x4000, 0x1504: 0x4000, 0x1505: 0x4000, + 0x1506: 0x4000, 0x1507: 0x4000, 0x1508: 0x4000, + 0x1510: 0x4000, 0x1511: 0x4000, + 0x1520: 0x4000, 0x1521: 0x4000, 0x1522: 0x4000, 0x1523: 0x4000, + 0x1524: 0x4000, 0x1525: 0x4000, + // Block 0x55, offset 0x1540 + 0x1540: 0x4000, 0x1541: 0x4000, 0x1542: 0x4000, 0x1543: 0x4000, 0x1544: 0x4000, 0x1545: 0x4000, + 0x1546: 0x4000, 0x1547: 0x4000, 0x1548: 0x4000, 0x1549: 0x4000, 0x154a: 0x4000, 0x154b: 0x4000, + 0x154c: 0x4000, 0x154d: 0x4000, 0x154e: 0x4000, 0x154f: 0x4000, 0x1550: 0x4000, 0x1551: 0x4000, + 0x1552: 0x4000, 0x1553: 0x4000, 0x1554: 0x4000, 0x1555: 0x4000, 0x1556: 0x4000, 0x1557: 0x4000, + 0x1558: 0x4000, 0x1559: 0x4000, 0x155a: 0x4000, 0x155b: 0x4000, 0x155c: 0x4000, 0x155d: 0x4000, + 0x155e: 0x4000, 0x155f: 0x4000, 0x1560: 0x4000, + 0x156d: 0x4000, 0x156e: 0x4000, 0x156f: 0x4000, + 0x1570: 0x4000, 0x1571: 0x4000, 0x1572: 0x4000, 0x1573: 0x4000, 0x1574: 0x4000, 0x1575: 0x4000, + 0x1577: 0x4000, 0x1578: 0x4000, 0x1579: 0x4000, 0x157a: 0x4000, 0x157b: 0x4000, + 0x157c: 0x4000, 0x157d: 0x4000, 0x157e: 0x4000, 0x157f: 0x4000, + // Block 0x56, offset 0x1580 + 0x1580: 0x4000, 0x1581: 0x4000, 0x1582: 0x4000, 0x1583: 0x4000, 0x1584: 0x4000, 0x1585: 0x4000, + 0x1586: 0x4000, 0x1587: 0x4000, 0x1588: 0x4000, 0x1589: 0x4000, 0x158a: 0x4000, 0x158b: 0x4000, + 0x158c: 0x4000, 0x158d: 0x4000, 0x158e: 0x4000, 0x158f: 0x4000, 0x1590: 0x4000, 0x1591: 0x4000, + 0x1592: 0x4000, 0x1593: 0x4000, 0x1594: 0x4000, 0x1595: 0x4000, 0x1596: 0x4000, 0x1597: 0x4000, + 0x1598: 0x4000, 0x1599: 0x4000, 0x159a: 0x4000, 0x159b: 0x4000, 0x159c: 0x4000, 0x159d: 0x4000, + 0x159e: 0x4000, 0x159f: 0x4000, 0x15a0: 0x4000, 0x15a1: 0x4000, 0x15a2: 0x4000, 0x15a3: 0x4000, + 0x15a4: 0x4000, 0x15a5: 0x4000, 0x15a6: 0x4000, 0x15a7: 0x4000, 0x15a8: 0x4000, 0x15a9: 0x4000, + 0x15aa: 0x4000, 0x15ab: 0x4000, 0x15ac: 0x4000, 0x15ad: 0x4000, 0x15ae: 0x4000, 0x15af: 0x4000, + 0x15b0: 0x4000, 0x15b1: 0x4000, 0x15b2: 0x4000, 0x15b3: 0x4000, 0x15b4: 0x4000, 0x15b5: 0x4000, + 0x15b6: 0x4000, 0x15b7: 0x4000, 0x15b8: 0x4000, 0x15b9: 0x4000, 0x15ba: 0x4000, 0x15bb: 0x4000, + 0x15bc: 0x4000, 0x15be: 0x4000, 0x15bf: 0x4000, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x4000, 0x15c1: 0x4000, 0x15c2: 0x4000, 0x15c3: 0x4000, 0x15c4: 0x4000, 0x15c5: 0x4000, + 0x15c6: 0x4000, 0x15c7: 0x4000, 0x15c8: 0x4000, 0x15c9: 0x4000, 0x15ca: 0x4000, 0x15cb: 0x4000, + 0x15cc: 0x4000, 0x15cd: 0x4000, 0x15ce: 0x4000, 0x15cf: 0x4000, 0x15d0: 0x4000, 0x15d1: 0x4000, + 0x15d2: 0x4000, 0x15d3: 0x4000, + 0x15e0: 0x4000, 0x15e1: 0x4000, 0x15e2: 0x4000, 0x15e3: 0x4000, + 0x15e4: 0x4000, 0x15e5: 0x4000, 0x15e6: 0x4000, 0x15e7: 0x4000, 0x15e8: 0x4000, 0x15e9: 0x4000, + 0x15ea: 0x4000, 0x15eb: 0x4000, 0x15ec: 0x4000, 0x15ed: 0x4000, 0x15ee: 0x4000, 0x15ef: 0x4000, + 0x15f0: 0x4000, 0x15f1: 0x4000, 0x15f2: 0x4000, 0x15f3: 0x4000, 0x15f4: 0x4000, 0x15f5: 0x4000, + 0x15f6: 0x4000, 0x15f7: 0x4000, 0x15f8: 0x4000, 0x15f9: 0x4000, 0x15fa: 0x4000, 0x15fb: 0x4000, + 0x15fc: 0x4000, 0x15fd: 0x4000, 0x15fe: 0x4000, 0x15ff: 0x4000, + // Block 0x58, offset 0x1600 + 0x1600: 0x4000, 0x1601: 0x4000, 0x1602: 0x4000, 0x1603: 0x4000, 0x1604: 0x4000, 0x1605: 0x4000, + 0x1606: 0x4000, 0x1607: 0x4000, 0x1608: 0x4000, 0x1609: 0x4000, 0x160a: 0x4000, + 0x160f: 0x4000, 0x1610: 0x4000, 0x1611: 0x4000, + 0x1612: 0x4000, 0x1613: 0x4000, + 0x1620: 0x4000, 0x1621: 0x4000, 0x1622: 0x4000, 0x1623: 0x4000, + 0x1624: 0x4000, 0x1625: 0x4000, 0x1626: 0x4000, 0x1627: 0x4000, 0x1628: 0x4000, 0x1629: 0x4000, + 0x162a: 0x4000, 0x162b: 0x4000, 0x162c: 0x4000, 0x162d: 0x4000, 0x162e: 0x4000, 0x162f: 0x4000, + 0x1630: 0x4000, 0x1634: 0x4000, + 0x1638: 0x4000, 0x1639: 0x4000, 0x163a: 0x4000, 0x163b: 0x4000, + 0x163c: 0x4000, 0x163d: 0x4000, 0x163e: 0x4000, 0x163f: 0x4000, + // Block 0x59, offset 0x1640 + 0x1640: 0x4000, 0x1641: 0x4000, 0x1642: 0x4000, 0x1643: 0x4000, 0x1644: 0x4000, 0x1645: 0x4000, + 0x1646: 0x4000, 0x1647: 0x4000, 0x1648: 0x4000, 0x1649: 0x4000, 0x164a: 0x4000, 0x164b: 0x4000, + 0x164c: 0x4000, 0x164d: 0x4000, 0x164e: 0x4000, 0x164f: 0x4000, 0x1650: 0x4000, 0x1651: 0x4000, + 0x1652: 0x4000, 0x1653: 0x4000, 0x1654: 0x4000, 0x1655: 0x4000, 0x1656: 0x4000, 0x1657: 0x4000, + 0x1658: 0x4000, 0x1659: 0x4000, 0x165a: 0x4000, 0x165b: 0x4000, 0x165c: 0x4000, 0x165d: 0x4000, + 0x165e: 0x4000, 0x165f: 0x4000, 0x1660: 0x4000, 0x1661: 0x4000, 0x1662: 0x4000, 0x1663: 0x4000, + 0x1664: 0x4000, 0x1665: 0x4000, 0x1666: 0x4000, 0x1667: 0x4000, 0x1668: 0x4000, 0x1669: 0x4000, + 0x166a: 0x4000, 0x166b: 0x4000, 0x166c: 0x4000, 0x166d: 0x4000, 0x166e: 0x4000, 0x166f: 0x4000, + 0x1670: 0x4000, 0x1671: 0x4000, 0x1672: 0x4000, 0x1673: 0x4000, 0x1674: 0x4000, 0x1675: 0x4000, + 0x1676: 0x4000, 0x1677: 0x4000, 0x1678: 0x4000, 0x1679: 0x4000, 0x167a: 0x4000, 0x167b: 0x4000, + 0x167c: 0x4000, 0x167d: 0x4000, 0x167e: 0x4000, + // Block 0x5a, offset 0x1680 + 0x1680: 0x4000, 0x1682: 0x4000, 0x1683: 0x4000, 0x1684: 0x4000, 0x1685: 0x4000, + 0x1686: 0x4000, 0x1687: 0x4000, 0x1688: 0x4000, 0x1689: 0x4000, 0x168a: 0x4000, 0x168b: 0x4000, + 0x168c: 0x4000, 0x168d: 0x4000, 0x168e: 0x4000, 0x168f: 0x4000, 0x1690: 0x4000, 0x1691: 0x4000, + 0x1692: 0x4000, 0x1693: 0x4000, 0x1694: 0x4000, 0x1695: 0x4000, 0x1696: 0x4000, 0x1697: 0x4000, + 0x1698: 0x4000, 0x1699: 0x4000, 0x169a: 0x4000, 0x169b: 0x4000, 0x169c: 0x4000, 0x169d: 0x4000, + 0x169e: 0x4000, 0x169f: 0x4000, 0x16a0: 0x4000, 0x16a1: 0x4000, 0x16a2: 0x4000, 0x16a3: 0x4000, + 0x16a4: 0x4000, 0x16a5: 0x4000, 0x16a6: 0x4000, 0x16a7: 0x4000, 0x16a8: 0x4000, 0x16a9: 0x4000, + 0x16aa: 0x4000, 0x16ab: 0x4000, 0x16ac: 0x4000, 0x16ad: 0x4000, 0x16ae: 0x4000, 0x16af: 0x4000, + 0x16b0: 0x4000, 0x16b1: 0x4000, 0x16b2: 0x4000, 0x16b3: 0x4000, 0x16b4: 0x4000, 0x16b5: 0x4000, + 0x16b6: 0x4000, 0x16b7: 0x4000, 0x16b8: 0x4000, 0x16b9: 0x4000, 0x16ba: 0x4000, 0x16bb: 0x4000, + 0x16bc: 0x4000, 0x16bd: 0x4000, 0x16be: 0x4000, 0x16bf: 0x4000, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x4000, 0x16c1: 0x4000, 0x16c2: 0x4000, 0x16c3: 0x4000, 0x16c4: 0x4000, 0x16c5: 0x4000, + 0x16c6: 0x4000, 0x16c7: 0x4000, 0x16c8: 0x4000, 0x16c9: 0x4000, 0x16ca: 0x4000, 0x16cb: 0x4000, + 0x16cc: 0x4000, 0x16cd: 0x4000, 0x16ce: 0x4000, 0x16cf: 0x4000, 0x16d0: 0x4000, 0x16d1: 0x4000, + 0x16d2: 0x4000, 0x16d3: 0x4000, 0x16d4: 0x4000, 0x16d5: 0x4000, 0x16d6: 0x4000, 0x16d7: 0x4000, + 0x16d8: 0x4000, 0x16d9: 0x4000, 0x16da: 0x4000, 0x16db: 0x4000, 0x16dc: 0x4000, 0x16dd: 0x4000, + 0x16de: 0x4000, 0x16df: 0x4000, 0x16e0: 0x4000, 0x16e1: 0x4000, 0x16e2: 0x4000, 0x16e3: 0x4000, + 0x16e4: 0x4000, 0x16e5: 0x4000, 0x16e6: 0x4000, 0x16e7: 0x4000, 0x16e8: 0x4000, 0x16e9: 0x4000, + 0x16ea: 0x4000, 0x16eb: 0x4000, 0x16ec: 0x4000, 0x16ed: 0x4000, 0x16ee: 0x4000, 0x16ef: 0x4000, + 0x16f0: 0x4000, 0x16f1: 0x4000, 0x16f2: 0x4000, 0x16f3: 0x4000, 0x16f4: 0x4000, 0x16f5: 0x4000, + 0x16f6: 0x4000, 0x16f7: 0x4000, 0x16f8: 0x4000, 0x16f9: 0x4000, 0x16fa: 0x4000, 0x16fb: 0x4000, + 0x16fc: 0x4000, 0x16ff: 0x4000, + // Block 0x5c, offset 0x1700 + 0x1700: 0x4000, 0x1701: 0x4000, 0x1702: 0x4000, 0x1703: 0x4000, 0x1704: 0x4000, 0x1705: 0x4000, + 0x1706: 0x4000, 0x1707: 0x4000, 0x1708: 0x4000, 0x1709: 0x4000, 0x170a: 0x4000, 0x170b: 0x4000, + 0x170c: 0x4000, 0x170d: 0x4000, 0x170e: 0x4000, 0x170f: 0x4000, 0x1710: 0x4000, 0x1711: 0x4000, + 0x1712: 0x4000, 0x1713: 0x4000, 0x1714: 0x4000, 0x1715: 0x4000, 0x1716: 0x4000, 0x1717: 0x4000, + 0x1718: 0x4000, 0x1719: 0x4000, 0x171a: 0x4000, 0x171b: 0x4000, 0x171c: 0x4000, 0x171d: 0x4000, + 0x171e: 0x4000, 0x171f: 0x4000, 0x1720: 0x4000, 0x1721: 0x4000, 0x1722: 0x4000, 0x1723: 0x4000, + 0x1724: 0x4000, 0x1725: 0x4000, 0x1726: 0x4000, 0x1727: 0x4000, 0x1728: 0x4000, 0x1729: 0x4000, + 0x172a: 0x4000, 0x172b: 0x4000, 0x172c: 0x4000, 0x172d: 0x4000, 0x172e: 0x4000, 0x172f: 0x4000, + 0x1730: 0x4000, 0x1731: 0x4000, 0x1732: 0x4000, 0x1733: 0x4000, 0x1734: 0x4000, 0x1735: 0x4000, + 0x1736: 0x4000, 0x1737: 0x4000, 0x1738: 0x4000, 0x1739: 0x4000, 0x173a: 0x4000, 0x173b: 0x4000, + 0x173c: 0x4000, 0x173d: 0x4000, + // Block 0x5d, offset 0x1740 + 0x174b: 0x4000, + 0x174c: 0x4000, 0x174d: 0x4000, 0x174e: 0x4000, 0x1750: 0x4000, 0x1751: 0x4000, + 0x1752: 0x4000, 0x1753: 0x4000, 0x1754: 0x4000, 0x1755: 0x4000, 0x1756: 0x4000, 0x1757: 0x4000, + 0x1758: 0x4000, 0x1759: 0x4000, 0x175a: 0x4000, 0x175b: 0x4000, 0x175c: 0x4000, 0x175d: 0x4000, + 0x175e: 0x4000, 0x175f: 0x4000, 0x1760: 0x4000, 0x1761: 0x4000, 0x1762: 0x4000, 0x1763: 0x4000, + 0x1764: 0x4000, 0x1765: 0x4000, 0x1766: 0x4000, 0x1767: 0x4000, + 0x177a: 0x4000, + // Block 0x5e, offset 0x1780 + 0x1795: 0x4000, 0x1796: 0x4000, + 0x17a4: 0x4000, + // Block 0x5f, offset 0x17c0 + 0x17fb: 0x4000, + 0x17fc: 0x4000, 0x17fd: 0x4000, 0x17fe: 0x4000, 0x17ff: 0x4000, + // Block 0x60, offset 0x1800 + 0x1800: 0x4000, 0x1801: 0x4000, 0x1802: 0x4000, 0x1803: 0x4000, 0x1804: 0x4000, 0x1805: 0x4000, + 0x1806: 0x4000, 0x1807: 0x4000, 0x1808: 0x4000, 0x1809: 0x4000, 0x180a: 0x4000, 0x180b: 0x4000, + 0x180c: 0x4000, 0x180d: 0x4000, 0x180e: 0x4000, 0x180f: 0x4000, + // Block 0x61, offset 0x1840 + 0x1840: 0x4000, 0x1841: 0x4000, 0x1842: 0x4000, 0x1843: 0x4000, 0x1844: 0x4000, 0x1845: 0x4000, + 0x184c: 0x4000, 0x1850: 0x4000, 0x1851: 0x4000, + 0x1852: 0x4000, 0x1855: 0x4000, 0x1856: 0x4000, 0x1857: 0x4000, + 0x185c: 0x4000, 0x185d: 0x4000, + 0x185e: 0x4000, 0x185f: 0x4000, + 0x186b: 0x4000, 0x186c: 0x4000, + 0x1874: 0x4000, 0x1875: 0x4000, + 0x1876: 0x4000, 0x1877: 0x4000, 0x1878: 0x4000, 0x1879: 0x4000, 0x187a: 0x4000, 0x187b: 0x4000, + 0x187c: 0x4000, + // Block 0x62, offset 0x1880 + 0x18a0: 0x4000, 0x18a1: 0x4000, 0x18a2: 0x4000, 0x18a3: 0x4000, + 0x18a4: 0x4000, 0x18a5: 0x4000, 0x18a6: 0x4000, 0x18a7: 0x4000, 0x18a8: 0x4000, 0x18a9: 0x4000, + 0x18aa: 0x4000, 0x18ab: 0x4000, + 0x18b0: 0x4000, + // Block 0x63, offset 0x18c0 + 0x18cc: 0x4000, 0x18cd: 0x4000, 0x18ce: 0x4000, 0x18cf: 0x4000, 0x18d0: 0x4000, 0x18d1: 0x4000, + 0x18d2: 0x4000, 0x18d3: 0x4000, 0x18d4: 0x4000, 0x18d5: 0x4000, 0x18d6: 0x4000, 0x18d7: 0x4000, + 0x18d8: 0x4000, 0x18d9: 0x4000, 0x18da: 0x4000, 0x18db: 0x4000, 0x18dc: 0x4000, 0x18dd: 0x4000, + 0x18de: 0x4000, 0x18df: 0x4000, 0x18e0: 0x4000, 0x18e1: 0x4000, 0x18e2: 0x4000, 0x18e3: 0x4000, + 0x18e4: 0x4000, 0x18e5: 0x4000, 0x18e6: 0x4000, 0x18e7: 0x4000, 0x18e8: 0x4000, 0x18e9: 0x4000, + 0x18ea: 0x4000, 0x18eb: 0x4000, 0x18ec: 0x4000, 0x18ed: 0x4000, 0x18ee: 0x4000, 0x18ef: 0x4000, + 0x18f0: 0x4000, 0x18f1: 0x4000, 0x18f2: 0x4000, 0x18f3: 0x4000, 0x18f4: 0x4000, 0x18f5: 0x4000, + 0x18f6: 0x4000, 0x18f7: 0x4000, 0x18f8: 0x4000, 0x18f9: 0x4000, 0x18fa: 0x4000, + 0x18fc: 0x4000, 0x18fd: 0x4000, 0x18fe: 0x4000, 0x18ff: 0x4000, + // Block 0x64, offset 0x1900 + 0x1900: 0x4000, 0x1901: 0x4000, 0x1902: 0x4000, 0x1903: 0x4000, 0x1904: 0x4000, 0x1905: 0x4000, + 0x1907: 0x4000, 0x1908: 0x4000, 0x1909: 0x4000, 0x190a: 0x4000, 0x190b: 0x4000, + 0x190c: 0x4000, 0x190d: 0x4000, 0x190e: 0x4000, 0x190f: 0x4000, 0x1910: 0x4000, 0x1911: 0x4000, + 0x1912: 0x4000, 0x1913: 0x4000, 0x1914: 0x4000, 0x1915: 0x4000, 0x1916: 0x4000, 0x1917: 0x4000, + 0x1918: 0x4000, 0x1919: 0x4000, 0x191a: 0x4000, 0x191b: 0x4000, 0x191c: 0x4000, 0x191d: 0x4000, + 0x191e: 0x4000, 0x191f: 0x4000, 0x1920: 0x4000, 0x1921: 0x4000, 0x1922: 0x4000, 0x1923: 0x4000, + 0x1924: 0x4000, 0x1925: 0x4000, 0x1926: 0x4000, 0x1927: 0x4000, 0x1928: 0x4000, 0x1929: 0x4000, + 0x192a: 0x4000, 0x192b: 0x4000, 0x192c: 0x4000, 0x192d: 0x4000, 0x192e: 0x4000, 0x192f: 0x4000, + 0x1930: 0x4000, 0x1931: 0x4000, 0x1932: 0x4000, 0x1933: 0x4000, 0x1934: 0x4000, 0x1935: 0x4000, + 0x1936: 0x4000, 0x1937: 0x4000, 0x1938: 0x4000, 0x1939: 0x4000, 0x193a: 0x4000, 0x193b: 0x4000, + 0x193c: 0x4000, 0x193d: 0x4000, 0x193e: 0x4000, 0x193f: 0x4000, + // Block 0x65, offset 0x1940 + 0x1970: 0x4000, 0x1971: 0x4000, 0x1972: 0x4000, 0x1973: 0x4000, 0x1974: 0x4000, 0x1975: 0x4000, + 0x1976: 0x4000, 0x1977: 0x4000, 0x1978: 0x4000, 0x1979: 0x4000, 0x197a: 0x4000, 0x197b: 0x4000, + 0x197c: 0x4000, + // Block 0x66, offset 0x1980 + 0x1980: 0x4000, 0x1981: 0x4000, 0x1982: 0x4000, 0x1983: 0x4000, 0x1984: 0x4000, 0x1985: 0x4000, + 0x1986: 0x4000, 0x1987: 0x4000, 0x1988: 0x4000, + 0x1990: 0x4000, 0x1991: 0x4000, + 0x1992: 0x4000, 0x1993: 0x4000, 0x1994: 0x4000, 0x1995: 0x4000, 0x1996: 0x4000, 0x1997: 0x4000, + 0x1998: 0x4000, 0x1999: 0x4000, 0x199a: 0x4000, 0x199b: 0x4000, 0x199c: 0x4000, 0x199d: 0x4000, + 0x199e: 0x4000, 0x199f: 0x4000, 0x19a0: 0x4000, 0x19a1: 0x4000, 0x19a2: 0x4000, 0x19a3: 0x4000, + 0x19a4: 0x4000, 0x19a5: 0x4000, 0x19a6: 0x4000, 0x19a7: 0x4000, 0x19a8: 0x4000, 0x19a9: 0x4000, + 0x19aa: 0x4000, 0x19ab: 0x4000, 0x19ac: 0x4000, 0x19ad: 0x4000, 0x19ae: 0x4000, 0x19af: 0x4000, + 0x19b0: 0x4000, 0x19b1: 0x4000, 0x19b2: 0x4000, 0x19b3: 0x4000, 0x19b4: 0x4000, 0x19b5: 0x4000, + 0x19b6: 0x4000, 0x19b7: 0x4000, 0x19b8: 0x4000, 0x19b9: 0x4000, 0x19ba: 0x4000, 0x19bb: 0x4000, + 0x19bc: 0x4000, 0x19bd: 0x4000, 0x19bf: 0x4000, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x4000, 0x19c1: 0x4000, 0x19c2: 0x4000, 0x19c3: 0x4000, 0x19c4: 0x4000, 0x19c5: 0x4000, + 0x19ce: 0x4000, 0x19cf: 0x4000, 0x19d0: 0x4000, 0x19d1: 0x4000, + 0x19d2: 0x4000, 0x19d3: 0x4000, 0x19d4: 0x4000, 0x19d5: 0x4000, 0x19d6: 0x4000, 0x19d7: 0x4000, + 0x19d8: 0x4000, 0x19d9: 0x4000, 0x19da: 0x4000, 0x19db: 0x4000, + 0x19e0: 0x4000, 0x19e1: 0x4000, 0x19e2: 0x4000, 0x19e3: 0x4000, + 0x19e4: 0x4000, 0x19e5: 0x4000, 0x19e6: 0x4000, 0x19e7: 0x4000, 0x19e8: 0x4000, + 0x19f0: 0x4000, 0x19f1: 0x4000, 0x19f2: 0x4000, 0x19f3: 0x4000, 0x19f4: 0x4000, 0x19f5: 0x4000, + 0x19f6: 0x4000, 0x19f7: 0x4000, 0x19f8: 0x4000, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x2000, 0x1a01: 0x2000, 0x1a02: 0x2000, 0x1a03: 0x2000, 0x1a04: 0x2000, 0x1a05: 0x2000, + 0x1a06: 0x2000, 0x1a07: 0x2000, 0x1a08: 0x2000, 0x1a09: 0x2000, 0x1a0a: 0x2000, 0x1a0b: 0x2000, + 0x1a0c: 0x2000, 0x1a0d: 0x2000, 0x1a0e: 0x2000, 0x1a0f: 0x2000, 0x1a10: 0x2000, 0x1a11: 0x2000, + 0x1a12: 0x2000, 0x1a13: 0x2000, 0x1a14: 0x2000, 0x1a15: 0x2000, 0x1a16: 0x2000, 0x1a17: 0x2000, + 0x1a18: 0x2000, 0x1a19: 0x2000, 0x1a1a: 0x2000, 0x1a1b: 0x2000, 0x1a1c: 0x2000, 0x1a1d: 0x2000, + 0x1a1e: 0x2000, 0x1a1f: 0x2000, 0x1a20: 0x2000, 0x1a21: 0x2000, 0x1a22: 0x2000, 0x1a23: 0x2000, + 0x1a24: 0x2000, 0x1a25: 0x2000, 0x1a26: 0x2000, 0x1a27: 0x2000, 0x1a28: 0x2000, 0x1a29: 0x2000, + 0x1a2a: 0x2000, 0x1a2b: 0x2000, 0x1a2c: 0x2000, 0x1a2d: 0x2000, 0x1a2e: 0x2000, 0x1a2f: 0x2000, + 0x1a30: 0x2000, 0x1a31: 0x2000, 0x1a32: 0x2000, 0x1a33: 0x2000, 0x1a34: 0x2000, 0x1a35: 0x2000, + 0x1a36: 0x2000, 0x1a37: 0x2000, 0x1a38: 0x2000, 0x1a39: 0x2000, 0x1a3a: 0x2000, 0x1a3b: 0x2000, + 0x1a3c: 0x2000, 0x1a3d: 0x2000, +} + +// widthIndex: 23 blocks, 1472 entries, 1472 bytes +// Block 0 is the zero block. +var widthIndex = [1472]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc7: 0x05, + 0xc9: 0x06, 0xcb: 0x07, 0xcc: 0x08, 0xcd: 0x09, 0xce: 0x0a, 0xcf: 0x0b, + 0xd0: 0x0c, 0xd1: 0x0d, + 0xe1: 0x02, 0xe2: 0x03, 0xe3: 0x04, 0xe4: 0x05, 0xe5: 0x06, 0xe6: 0x06, 0xe7: 0x06, + 0xe8: 0x06, 0xe9: 0x06, 0xea: 0x07, 0xeb: 0x06, 0xec: 0x06, 0xed: 0x08, 0xee: 0x09, 0xef: 0x0a, + 0xf0: 0x10, 0xf3: 0x13, 0xf4: 0x14, + // Block 0x4, offset 0x100 + 0x104: 0x0e, 0x105: 0x0f, + // Block 0x5, offset 0x140 + 0x140: 0x10, 0x141: 0x11, 0x142: 0x12, 0x144: 0x13, 0x145: 0x14, 0x146: 0x15, 0x147: 0x16, + 0x148: 0x17, 0x149: 0x18, 0x14a: 0x19, 0x14c: 0x1a, 0x14f: 0x1b, + 0x151: 0x1c, 0x152: 0x08, 0x153: 0x1d, 0x154: 0x1e, 0x155: 0x1f, 0x156: 0x20, 0x157: 0x21, + 0x158: 0x22, 0x159: 0x23, 0x15a: 0x24, 0x15b: 0x25, 0x15c: 0x26, 0x15d: 0x27, 0x15e: 0x28, 0x15f: 0x29, + 0x166: 0x2a, + 0x16c: 0x2b, 0x16d: 0x2c, + 0x17a: 0x2d, 0x17b: 0x2e, 0x17c: 0x0e, 0x17d: 0x0e, 0x17e: 0x0e, 0x17f: 0x2f, + // Block 0x6, offset 0x180 + 0x180: 0x30, 0x181: 0x31, 0x182: 0x32, 0x183: 0x33, 0x184: 0x34, 0x185: 0x35, 0x186: 0x36, 0x187: 0x37, + 0x188: 0x38, 0x189: 0x39, 0x18a: 0x0e, 0x18b: 0x0e, 0x18c: 0x0e, 0x18d: 0x0e, 0x18e: 0x0e, 0x18f: 0x0e, + 0x190: 0x0e, 0x191: 0x0e, 0x192: 0x0e, 0x193: 0x0e, 0x194: 0x0e, 0x195: 0x0e, 0x196: 0x0e, 0x197: 0x0e, + 0x198: 0x0e, 0x199: 0x0e, 0x19a: 0x0e, 0x19b: 0x0e, 0x19c: 0x0e, 0x19d: 0x0e, 0x19e: 0x0e, 0x19f: 0x0e, + 0x1a0: 0x0e, 0x1a1: 0x0e, 0x1a2: 0x0e, 0x1a3: 0x0e, 0x1a4: 0x0e, 0x1a5: 0x0e, 0x1a6: 0x0e, 0x1a7: 0x0e, + 0x1a8: 0x0e, 0x1a9: 0x0e, 0x1aa: 0x0e, 0x1ab: 0x0e, 0x1ac: 0x0e, 0x1ad: 0x0e, 0x1ae: 0x0e, 0x1af: 0x0e, + 0x1b0: 0x0e, 0x1b1: 0x0e, 0x1b2: 0x0e, 0x1b3: 0x0e, 0x1b4: 0x0e, 0x1b5: 0x0e, 0x1b6: 0x0e, 0x1b7: 0x0e, + 0x1b8: 0x0e, 0x1b9: 0x0e, 0x1ba: 0x0e, 0x1bb: 0x0e, 0x1bc: 0x0e, 0x1bd: 0x0e, 0x1be: 0x0e, 0x1bf: 0x0e, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0e, 0x1c1: 0x0e, 0x1c2: 0x0e, 0x1c3: 0x0e, 0x1c4: 0x0e, 0x1c5: 0x0e, 0x1c6: 0x0e, 0x1c7: 0x0e, + 0x1c8: 0x0e, 0x1c9: 0x0e, 0x1ca: 0x0e, 0x1cb: 0x0e, 0x1cc: 0x0e, 0x1cd: 0x0e, 0x1ce: 0x0e, 0x1cf: 0x0e, + 0x1d0: 0x0e, 0x1d1: 0x0e, 0x1d2: 0x0e, 0x1d3: 0x0e, 0x1d4: 0x0e, 0x1d5: 0x0e, 0x1d6: 0x0e, 0x1d7: 0x0e, + 0x1d8: 0x0e, 0x1d9: 0x0e, 0x1da: 0x0e, 0x1db: 0x0e, 0x1dc: 0x0e, 0x1dd: 0x0e, 0x1de: 0x0e, 0x1df: 0x0e, + 0x1e0: 0x0e, 0x1e1: 0x0e, 0x1e2: 0x0e, 0x1e3: 0x0e, 0x1e4: 0x0e, 0x1e5: 0x0e, 0x1e6: 0x0e, 0x1e7: 0x0e, + 0x1e8: 0x0e, 0x1e9: 0x0e, 0x1ea: 0x0e, 0x1eb: 0x0e, 0x1ec: 0x0e, 0x1ed: 0x0e, 0x1ee: 0x0e, 0x1ef: 0x0e, + 0x1f0: 0x0e, 0x1f1: 0x0e, 0x1f2: 0x0e, 0x1f3: 0x0e, 0x1f4: 0x0e, 0x1f5: 0x0e, 0x1f6: 0x0e, + 0x1f8: 0x0e, 0x1f9: 0x0e, 0x1fa: 0x0e, 0x1fb: 0x0e, 0x1fc: 0x0e, 0x1fd: 0x0e, 0x1fe: 0x0e, 0x1ff: 0x0e, + // Block 0x8, offset 0x200 + 0x200: 0x0e, 0x201: 0x0e, 0x202: 0x0e, 0x203: 0x0e, 0x204: 0x0e, 0x205: 0x0e, 0x206: 0x0e, 0x207: 0x0e, + 0x208: 0x0e, 0x209: 0x0e, 0x20a: 0x0e, 0x20b: 0x0e, 0x20c: 0x0e, 0x20d: 0x0e, 0x20e: 0x0e, 0x20f: 0x0e, + 0x210: 0x0e, 0x211: 0x0e, 0x212: 0x0e, 0x213: 0x0e, 0x214: 0x0e, 0x215: 0x0e, 0x216: 0x0e, 0x217: 0x0e, + 0x218: 0x0e, 0x219: 0x0e, 0x21a: 0x0e, 0x21b: 0x0e, 0x21c: 0x0e, 0x21d: 0x0e, 0x21e: 0x0e, 0x21f: 0x0e, + 0x220: 0x0e, 0x221: 0x0e, 0x222: 0x0e, 0x223: 0x0e, 0x224: 0x0e, 0x225: 0x0e, 0x226: 0x0e, 0x227: 0x0e, + 0x228: 0x0e, 0x229: 0x0e, 0x22a: 0x0e, 0x22b: 0x0e, 0x22c: 0x0e, 0x22d: 0x0e, 0x22e: 0x0e, 0x22f: 0x0e, + 0x230: 0x0e, 0x231: 0x0e, 0x232: 0x0e, 0x233: 0x0e, 0x234: 0x0e, 0x235: 0x0e, 0x236: 0x0e, 0x237: 0x0e, + 0x238: 0x0e, 0x239: 0x0e, 0x23a: 0x0e, 0x23b: 0x0e, 0x23c: 0x0e, 0x23d: 0x0e, 0x23e: 0x0e, 0x23f: 0x0e, + // Block 0x9, offset 0x240 + 0x240: 0x0e, 0x241: 0x0e, 0x242: 0x0e, 0x243: 0x0e, 0x244: 0x0e, 0x245: 0x0e, 0x246: 0x0e, 0x247: 0x0e, + 0x248: 0x0e, 0x249: 0x0e, 0x24a: 0x0e, 0x24b: 0x0e, 0x24c: 0x0e, 0x24d: 0x0e, 0x24e: 0x0e, 0x24f: 0x0e, + 0x250: 0x0e, 0x251: 0x0e, 0x252: 0x3a, 0x253: 0x3b, + 0x265: 0x3c, + 0x270: 0x0e, 0x271: 0x0e, 0x272: 0x0e, 0x273: 0x0e, 0x274: 0x0e, 0x275: 0x0e, 0x276: 0x0e, 0x277: 0x0e, + 0x278: 0x0e, 0x279: 0x0e, 0x27a: 0x0e, 0x27b: 0x0e, 0x27c: 0x0e, 0x27d: 0x0e, 0x27e: 0x0e, 0x27f: 0x0e, + // Block 0xa, offset 0x280 + 0x280: 0x0e, 0x281: 0x0e, 0x282: 0x0e, 0x283: 0x0e, 0x284: 0x0e, 0x285: 0x0e, 0x286: 0x0e, 0x287: 0x0e, + 0x288: 0x0e, 0x289: 0x0e, 0x28a: 0x0e, 0x28b: 0x0e, 0x28c: 0x0e, 0x28d: 0x0e, 0x28e: 0x0e, 0x28f: 0x0e, + 0x290: 0x0e, 0x291: 0x0e, 0x292: 0x0e, 0x293: 0x0e, 0x294: 0x0e, 0x295: 0x0e, 0x296: 0x0e, 0x297: 0x0e, + 0x298: 0x0e, 0x299: 0x0e, 0x29a: 0x0e, 0x29b: 0x0e, 0x29c: 0x0e, 0x29d: 0x0e, 0x29e: 0x3d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x08, 0x2c1: 0x08, 0x2c2: 0x08, 0x2c3: 0x08, 0x2c4: 0x08, 0x2c5: 0x08, 0x2c6: 0x08, 0x2c7: 0x08, + 0x2c8: 0x08, 0x2c9: 0x08, 0x2ca: 0x08, 0x2cb: 0x08, 0x2cc: 0x08, 0x2cd: 0x08, 0x2ce: 0x08, 0x2cf: 0x08, + 0x2d0: 0x08, 0x2d1: 0x08, 0x2d2: 0x08, 0x2d3: 0x08, 0x2d4: 0x08, 0x2d5: 0x08, 0x2d6: 0x08, 0x2d7: 0x08, + 0x2d8: 0x08, 0x2d9: 0x08, 0x2da: 0x08, 0x2db: 0x08, 0x2dc: 0x08, 0x2dd: 0x08, 0x2de: 0x08, 0x2df: 0x08, + 0x2e0: 0x08, 0x2e1: 0x08, 0x2e2: 0x08, 0x2e3: 0x08, 0x2e4: 0x08, 0x2e5: 0x08, 0x2e6: 0x08, 0x2e7: 0x08, + 0x2e8: 0x08, 0x2e9: 0x08, 0x2ea: 0x08, 0x2eb: 0x08, 0x2ec: 0x08, 0x2ed: 0x08, 0x2ee: 0x08, 0x2ef: 0x08, + 0x2f0: 0x08, 0x2f1: 0x08, 0x2f2: 0x08, 0x2f3: 0x08, 0x2f4: 0x08, 0x2f5: 0x08, 0x2f6: 0x08, 0x2f7: 0x08, + 0x2f8: 0x08, 0x2f9: 0x08, 0x2fa: 0x08, 0x2fb: 0x08, 0x2fc: 0x08, 0x2fd: 0x08, 0x2fe: 0x08, 0x2ff: 0x08, + // Block 0xc, offset 0x300 + 0x300: 0x08, 0x301: 0x08, 0x302: 0x08, 0x303: 0x08, 0x304: 0x08, 0x305: 0x08, 0x306: 0x08, 0x307: 0x08, + 0x308: 0x08, 0x309: 0x08, 0x30a: 0x08, 0x30b: 0x08, 0x30c: 0x08, 0x30d: 0x08, 0x30e: 0x08, 0x30f: 0x08, + 0x310: 0x08, 0x311: 0x08, 0x312: 0x08, 0x313: 0x08, 0x314: 0x08, 0x315: 0x08, 0x316: 0x08, 0x317: 0x08, + 0x318: 0x08, 0x319: 0x08, 0x31a: 0x08, 0x31b: 0x08, 0x31c: 0x08, 0x31d: 0x08, 0x31e: 0x08, 0x31f: 0x08, + 0x320: 0x08, 0x321: 0x08, 0x322: 0x08, 0x323: 0x08, 0x324: 0x0e, 0x325: 0x0e, 0x326: 0x0e, 0x327: 0x0e, + 0x328: 0x0e, 0x329: 0x0e, 0x32a: 0x0e, 0x32b: 0x0e, + 0x338: 0x3e, 0x339: 0x3f, 0x33c: 0x40, 0x33d: 0x41, 0x33e: 0x42, 0x33f: 0x43, + // Block 0xd, offset 0x340 + 0x37f: 0x44, + // Block 0xe, offset 0x380 + 0x380: 0x0e, 0x381: 0x0e, 0x382: 0x0e, 0x383: 0x0e, 0x384: 0x0e, 0x385: 0x0e, 0x386: 0x0e, 0x387: 0x0e, + 0x388: 0x0e, 0x389: 0x0e, 0x38a: 0x0e, 0x38b: 0x0e, 0x38c: 0x0e, 0x38d: 0x0e, 0x38e: 0x0e, 0x38f: 0x0e, + 0x390: 0x0e, 0x391: 0x0e, 0x392: 0x0e, 0x393: 0x0e, 0x394: 0x0e, 0x395: 0x0e, 0x396: 0x0e, 0x397: 0x0e, + 0x398: 0x0e, 0x399: 0x0e, 0x39a: 0x0e, 0x39b: 0x0e, 0x39c: 0x0e, 0x39d: 0x0e, 0x39e: 0x0e, 0x39f: 0x45, + 0x3a0: 0x0e, 0x3a1: 0x0e, 0x3a2: 0x0e, 0x3a3: 0x0e, 0x3a4: 0x0e, 0x3a5: 0x0e, 0x3a6: 0x0e, 0x3a7: 0x0e, + 0x3a8: 0x0e, 0x3a9: 0x0e, 0x3aa: 0x0e, 0x3ab: 0x0e, 0x3ac: 0x0e, 0x3ad: 0x0e, 0x3ae: 0x0e, 0x3af: 0x0e, + 0x3b0: 0x0e, 0x3b1: 0x0e, 0x3b2: 0x0e, 0x3b3: 0x46, 0x3b4: 0x47, + // Block 0xf, offset 0x3c0 + 0x3ff: 0x48, + // Block 0x10, offset 0x400 + 0x400: 0x0e, 0x401: 0x0e, 0x402: 0x0e, 0x403: 0x0e, 0x404: 0x49, 0x405: 0x4a, 0x406: 0x0e, 0x407: 0x0e, + 0x408: 0x0e, 0x409: 0x0e, 0x40a: 0x0e, 0x40b: 0x4b, + // Block 0x11, offset 0x440 + 0x440: 0x4c, 0x443: 0x4d, 0x444: 0x4e, 0x445: 0x4f, 0x446: 0x50, + 0x448: 0x51, 0x449: 0x52, 0x44c: 0x53, 0x44d: 0x54, 0x44e: 0x55, 0x44f: 0x56, + 0x450: 0x57, 0x451: 0x58, 0x452: 0x0e, 0x453: 0x59, 0x454: 0x5a, 0x455: 0x5b, 0x456: 0x5c, 0x457: 0x5d, + 0x458: 0x0e, 0x459: 0x5e, 0x45a: 0x0e, 0x45b: 0x5f, 0x45f: 0x60, + 0x464: 0x61, 0x465: 0x62, 0x466: 0x0e, 0x467: 0x0e, + 0x469: 0x63, 0x46a: 0x64, 0x46b: 0x65, + // Block 0x12, offset 0x480 + 0x496: 0x0b, 0x497: 0x06, + 0x498: 0x0c, 0x49a: 0x0d, 0x49b: 0x0e, 0x49f: 0x0f, + 0x4a0: 0x06, 0x4a1: 0x06, 0x4a2: 0x06, 0x4a3: 0x06, 0x4a4: 0x06, 0x4a5: 0x06, 0x4a6: 0x06, 0x4a7: 0x06, + 0x4a8: 0x06, 0x4a9: 0x06, 0x4aa: 0x06, 0x4ab: 0x06, 0x4ac: 0x06, 0x4ad: 0x06, 0x4ae: 0x06, 0x4af: 0x06, + 0x4b0: 0x06, 0x4b1: 0x06, 0x4b2: 0x06, 0x4b3: 0x06, 0x4b4: 0x06, 0x4b5: 0x06, 0x4b6: 0x06, 0x4b7: 0x06, + 0x4b8: 0x06, 0x4b9: 0x06, 0x4ba: 0x06, 0x4bb: 0x06, 0x4bc: 0x06, 0x4bd: 0x06, 0x4be: 0x06, 0x4bf: 0x06, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x08, 0x4c5: 0x08, 0x4c6: 0x08, 0x4c7: 0x09, + // Block 0x14, offset 0x500 + 0x500: 0x08, 0x501: 0x08, 0x502: 0x08, 0x503: 0x08, 0x504: 0x08, 0x505: 0x08, 0x506: 0x08, 0x507: 0x08, + 0x508: 0x08, 0x509: 0x08, 0x50a: 0x08, 0x50b: 0x08, 0x50c: 0x08, 0x50d: 0x08, 0x50e: 0x08, 0x50f: 0x08, + 0x510: 0x08, 0x511: 0x08, 0x512: 0x08, 0x513: 0x08, 0x514: 0x08, 0x515: 0x08, 0x516: 0x08, 0x517: 0x08, + 0x518: 0x08, 0x519: 0x08, 0x51a: 0x08, 0x51b: 0x08, 0x51c: 0x08, 0x51d: 0x08, 0x51e: 0x08, 0x51f: 0x08, + 0x520: 0x08, 0x521: 0x08, 0x522: 0x08, 0x523: 0x08, 0x524: 0x08, 0x525: 0x08, 0x526: 0x08, 0x527: 0x08, + 0x528: 0x08, 0x529: 0x08, 0x52a: 0x08, 0x52b: 0x08, 0x52c: 0x08, 0x52d: 0x08, 0x52e: 0x08, 0x52f: 0x08, + 0x530: 0x08, 0x531: 0x08, 0x532: 0x08, 0x533: 0x08, 0x534: 0x08, 0x535: 0x08, 0x536: 0x08, 0x537: 0x08, + 0x538: 0x08, 0x539: 0x08, 0x53a: 0x08, 0x53b: 0x08, 0x53c: 0x08, 0x53d: 0x08, 0x53e: 0x08, 0x53f: 0x66, + // Block 0x15, offset 0x540 + 0x560: 0x11, + 0x570: 0x09, 0x571: 0x09, 0x572: 0x09, 0x573: 0x09, 0x574: 0x09, 0x575: 0x09, 0x576: 0x09, 0x577: 0x09, + 0x578: 0x09, 0x579: 0x09, 0x57a: 0x09, 0x57b: 0x09, 0x57c: 0x09, 0x57d: 0x09, 0x57e: 0x09, 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x580: 0x09, 0x581: 0x09, 0x582: 0x09, 0x583: 0x09, 0x584: 0x09, 0x585: 0x09, 0x586: 0x09, 0x587: 0x09, + 0x588: 0x09, 0x589: 0x09, 0x58a: 0x09, 0x58b: 0x09, 0x58c: 0x09, 0x58d: 0x09, 0x58e: 0x09, 0x58f: 0x12, +} + +// inverseData contains 4-byte entries of the following format: +// +// <0 padding> +// +// The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the +// UTF-8 encoding of the original rune. Mappings often have the following +// pattern: +// +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// +// By xor-ing the last byte the same entry can be shared by many mappings. This +// reduces the total number of distinct entries by about two thirds. +// The resulting entry for the aforementioned mappings is +// +// { 0x01, 0xE0, 0x00, 0x00 } +// +// Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get +// +// E0 ^ A1 = 41. +// +// Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get +// +// E0 ^ A2 = 42. +// +// Note that because of the xor-ing, the byte sequence stored in the entry is +// not valid UTF-8. +var inverseData = [150][4]byte{ + {0x00, 0x00, 0x00, 0x00}, + {0x03, 0xe3, 0x80, 0xa0}, + {0x03, 0xef, 0xbc, 0xa0}, + {0x03, 0xef, 0xbc, 0xe0}, + {0x03, 0xef, 0xbd, 0xe0}, + {0x03, 0xef, 0xbf, 0x02}, + {0x03, 0xef, 0xbf, 0x00}, + {0x03, 0xef, 0xbf, 0x0e}, + {0x03, 0xef, 0xbf, 0x0c}, + {0x03, 0xef, 0xbf, 0x0f}, + {0x03, 0xef, 0xbf, 0x39}, + {0x03, 0xef, 0xbf, 0x3b}, + {0x03, 0xef, 0xbf, 0x3f}, + {0x03, 0xef, 0xbf, 0x2a}, + {0x03, 0xef, 0xbf, 0x0d}, + {0x03, 0xef, 0xbf, 0x25}, + {0x03, 0xef, 0xbd, 0x1a}, + {0x03, 0xef, 0xbd, 0x26}, + {0x01, 0xa0, 0x00, 0x00}, + {0x03, 0xef, 0xbd, 0x25}, + {0x03, 0xef, 0xbd, 0x23}, + {0x03, 0xef, 0xbd, 0x2e}, + {0x03, 0xef, 0xbe, 0x07}, + {0x03, 0xef, 0xbe, 0x05}, + {0x03, 0xef, 0xbd, 0x06}, + {0x03, 0xef, 0xbd, 0x13}, + {0x03, 0xef, 0xbd, 0x0b}, + {0x03, 0xef, 0xbd, 0x16}, + {0x03, 0xef, 0xbd, 0x0c}, + {0x03, 0xef, 0xbd, 0x15}, + {0x03, 0xef, 0xbd, 0x0d}, + {0x03, 0xef, 0xbd, 0x1c}, + {0x03, 0xef, 0xbd, 0x02}, + {0x03, 0xef, 0xbd, 0x1f}, + {0x03, 0xef, 0xbd, 0x1d}, + {0x03, 0xef, 0xbd, 0x17}, + {0x03, 0xef, 0xbd, 0x08}, + {0x03, 0xef, 0xbd, 0x09}, + {0x03, 0xef, 0xbd, 0x0e}, + {0x03, 0xef, 0xbd, 0x04}, + {0x03, 0xef, 0xbd, 0x05}, + {0x03, 0xef, 0xbe, 0x3f}, + {0x03, 0xef, 0xbe, 0x00}, + {0x03, 0xef, 0xbd, 0x2c}, + {0x03, 0xef, 0xbe, 0x06}, + {0x03, 0xef, 0xbe, 0x0c}, + {0x03, 0xef, 0xbe, 0x0f}, + {0x03, 0xef, 0xbe, 0x0d}, + {0x03, 0xef, 0xbe, 0x0b}, + {0x03, 0xef, 0xbe, 0x19}, + {0x03, 0xef, 0xbe, 0x15}, + {0x03, 0xef, 0xbe, 0x11}, + {0x03, 0xef, 0xbe, 0x31}, + {0x03, 0xef, 0xbe, 0x33}, + {0x03, 0xef, 0xbd, 0x0f}, + {0x03, 0xef, 0xbe, 0x30}, + {0x03, 0xef, 0xbe, 0x3e}, + {0x03, 0xef, 0xbe, 0x32}, + {0x03, 0xef, 0xbe, 0x36}, + {0x03, 0xef, 0xbd, 0x14}, + {0x03, 0xef, 0xbe, 0x2e}, + {0x03, 0xef, 0xbd, 0x1e}, + {0x03, 0xef, 0xbe, 0x10}, + {0x03, 0xef, 0xbf, 0x13}, + {0x03, 0xef, 0xbf, 0x15}, + {0x03, 0xef, 0xbf, 0x17}, + {0x03, 0xef, 0xbf, 0x1f}, + {0x03, 0xef, 0xbf, 0x1d}, + {0x03, 0xef, 0xbf, 0x1b}, + {0x03, 0xef, 0xbf, 0x09}, + {0x03, 0xef, 0xbf, 0x0b}, + {0x03, 0xef, 0xbf, 0x37}, + {0x03, 0xef, 0xbe, 0x04}, + {0x01, 0xe0, 0x00, 0x00}, + {0x03, 0xe2, 0xa6, 0x1a}, + {0x03, 0xe2, 0xa6, 0x26}, + {0x03, 0xe3, 0x80, 0x23}, + {0x03, 0xe3, 0x80, 0x2e}, + {0x03, 0xe3, 0x80, 0x25}, + {0x03, 0xe3, 0x83, 0x1e}, + {0x03, 0xe3, 0x83, 0x14}, + {0x03, 0xe3, 0x82, 0x06}, + {0x03, 0xe3, 0x82, 0x0b}, + {0x03, 0xe3, 0x82, 0x0c}, + {0x03, 0xe3, 0x82, 0x0d}, + {0x03, 0xe3, 0x82, 0x02}, + {0x03, 0xe3, 0x83, 0x0f}, + {0x03, 0xe3, 0x83, 0x08}, + {0x03, 0xe3, 0x83, 0x09}, + {0x03, 0xe3, 0x83, 0x2c}, + {0x03, 0xe3, 0x83, 0x0c}, + {0x03, 0xe3, 0x82, 0x13}, + {0x03, 0xe3, 0x82, 0x16}, + {0x03, 0xe3, 0x82, 0x15}, + {0x03, 0xe3, 0x82, 0x1c}, + {0x03, 0xe3, 0x82, 0x1f}, + {0x03, 0xe3, 0x82, 0x1d}, + {0x03, 0xe3, 0x82, 0x1a}, + {0x03, 0xe3, 0x82, 0x17}, + {0x03, 0xe3, 0x82, 0x08}, + {0x03, 0xe3, 0x82, 0x09}, + {0x03, 0xe3, 0x82, 0x0e}, + {0x03, 0xe3, 0x82, 0x04}, + {0x03, 0xe3, 0x82, 0x05}, + {0x03, 0xe3, 0x82, 0x3f}, + {0x03, 0xe3, 0x83, 0x00}, + {0x03, 0xe3, 0x83, 0x06}, + {0x03, 0xe3, 0x83, 0x05}, + {0x03, 0xe3, 0x83, 0x0d}, + {0x03, 0xe3, 0x83, 0x0b}, + {0x03, 0xe3, 0x83, 0x07}, + {0x03, 0xe3, 0x83, 0x19}, + {0x03, 0xe3, 0x83, 0x15}, + {0x03, 0xe3, 0x83, 0x11}, + {0x03, 0xe3, 0x83, 0x31}, + {0x03, 0xe3, 0x83, 0x33}, + {0x03, 0xe3, 0x83, 0x30}, + {0x03, 0xe3, 0x83, 0x3e}, + {0x03, 0xe3, 0x83, 0x32}, + {0x03, 0xe3, 0x83, 0x36}, + {0x03, 0xe3, 0x83, 0x2e}, + {0x03, 0xe3, 0x82, 0x07}, + {0x03, 0xe3, 0x85, 0x04}, + {0x03, 0xe3, 0x84, 0x10}, + {0x03, 0xe3, 0x85, 0x30}, + {0x03, 0xe3, 0x85, 0x0d}, + {0x03, 0xe3, 0x85, 0x13}, + {0x03, 0xe3, 0x85, 0x15}, + {0x03, 0xe3, 0x85, 0x17}, + {0x03, 0xe3, 0x85, 0x1f}, + {0x03, 0xe3, 0x85, 0x1d}, + {0x03, 0xe3, 0x85, 0x1b}, + {0x03, 0xe3, 0x85, 0x09}, + {0x03, 0xe3, 0x85, 0x0f}, + {0x03, 0xe3, 0x85, 0x0b}, + {0x03, 0xe3, 0x85, 0x37}, + {0x03, 0xe3, 0x85, 0x3b}, + {0x03, 0xe3, 0x85, 0x39}, + {0x03, 0xe3, 0x85, 0x3f}, + {0x02, 0xc2, 0x02, 0x00}, + {0x02, 0xc2, 0x0e, 0x00}, + {0x02, 0xc2, 0x0c, 0x00}, + {0x02, 0xc2, 0x00, 0x00}, + {0x03, 0xe2, 0x82, 0x0f}, + {0x03, 0xe2, 0x94, 0x2a}, + {0x03, 0xe2, 0x86, 0x39}, + {0x03, 0xe2, 0x86, 0x3b}, + {0x03, 0xe2, 0x86, 0x3f}, + {0x03, 0xe2, 0x96, 0x0d}, + {0x03, 0xe2, 0x97, 0x25}, +} + +// Total table size 15512 bytes (15KiB) diff --git a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go b/vendor/golang.org/x/tools/go/ast/inspector/inspector.go index 3fbfebf369..1fc1de0bd1 100644 --- a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go +++ b/vendor/golang.org/x/tools/go/ast/inspector/inspector.go @@ -64,8 +64,9 @@ type event struct { // depth-first order. It calls f(n) for each node n before it visits // n's children. // +// The complete traversal sequence is determined by ast.Inspect. // The types argument, if non-empty, enables type-based filtering of -// events. The function f if is called only for nodes whose type +// events. The function f is called only for nodes whose type // matches an element of the types slice. func (in *Inspector) Preorder(types []ast.Node, f func(ast.Node)) { // Because it avoids postorder calls to f, and the pruning @@ -97,6 +98,7 @@ func (in *Inspector) Preorder(types []ast.Node, f func(ast.Node)) { // of the non-nil children of the node, followed by a call of // f(n, false). // +// The complete traversal sequence is determined by ast.Inspect. // The types argument, if non-empty, enables type-based filtering of // events. The function f if is called only for nodes whose type // matches an element of the types slice. diff --git a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go index 165ede0f8f..03543bd4bb 100644 --- a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go +++ b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go @@ -128,15 +128,14 @@ func Read(in io.Reader, fset *token.FileSet, imports map[string]*types.Package, // (from "version"). Select appropriate importer. if len(data) > 0 { switch data[0] { - case 'i': - _, pkg, err := gcimporter.IImportData(fset, imports, data[1:], path) - return pkg, err + case 'v', 'c', 'd': // binary, till go1.10 + return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) - case 'v', 'c', 'd': - _, pkg, err := gcimporter.BImportData(fset, imports, data, path) + case 'i': // indexed, till go1.19 + _, pkg, err := gcimporter.IImportData(fset, imports, data[1:], path) return pkg, err - case 'u': + case 'u': // unified, from go1.20 _, pkg, err := gcimporter.UImportData(fset, imports, data[1:], path) return pkg, err diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go index 6bb7168d2e..58230038a7 100644 --- a/vendor/golang.org/x/tools/go/packages/golist.go +++ b/vendor/golang.org/x/tools/go/packages/golist.go @@ -625,7 +625,12 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse } if pkg.PkgPath == "unsafe" { - pkg.GoFiles = nil // ignore fake unsafe.go file + pkg.CompiledGoFiles = nil // ignore fake unsafe.go file (#59929) + } else if len(pkg.CompiledGoFiles) == 0 { + // Work around for pre-go.1.11 versions of go list. + // TODO(matloob): they should be handled by the fallback. + // Can we delete this? + pkg.CompiledGoFiles = pkg.GoFiles } // Assume go list emits only absolute paths for Dir. @@ -663,16 +668,12 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse response.Roots = append(response.Roots, pkg.ID) } - // Work around for pre-go.1.11 versions of go list. - // TODO(matloob): they should be handled by the fallback. - // Can we delete this? - if len(pkg.CompiledGoFiles) == 0 { - pkg.CompiledGoFiles = pkg.GoFiles - } - // Temporary work-around for golang/go#39986. Parse filenames out of // error messages. This happens if there are unrecoverable syntax // errors in the source, so we can't match on a specific error message. + // + // TODO(rfindley): remove this heuristic, in favor of considering + // InvalidGoFiles from the list driver. if err := p.Error; err != nil && state.shouldAddFilenameFromError(p) { addFilenameFromPos := func(pos string) bool { split := strings.Split(pos, ":") @@ -891,6 +892,15 @@ func golistargs(cfg *Config, words []string, goVersion int) []string { // probably because you'd just get the TestMain. fmt.Sprintf("-find=%t", !cfg.Tests && cfg.Mode&findFlags == 0 && !usesExportData(cfg)), } + + // golang/go#60456: with go1.21 and later, go list serves pgo variants, which + // can be costly to compute and may result in redundant processing for the + // caller. Disable these variants. If someone wants to add e.g. a NeedPGO + // mode flag, that should be a separate proposal. + if goVersion >= 21 { + fullargs = append(fullargs, "-pgo=off") + } + fullargs = append(fullargs, cfg.BuildFlags...) fullargs = append(fullargs, "--") fullargs = append(fullargs, words...) diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go index 0f1505b808..da1a27eea6 100644 --- a/vendor/golang.org/x/tools/go/packages/packages.go +++ b/vendor/golang.org/x/tools/go/packages/packages.go @@ -308,6 +308,9 @@ type Package struct { TypeErrors []types.Error // GoFiles lists the absolute file paths of the package's Go source files. + // It may include files that should not be compiled, for example because + // they contain non-matching build tags, are documentary pseudo-files such as + // unsafe/unsafe.go or builtin/builtin.go, or are subject to cgo preprocessing. GoFiles []string // CompiledGoFiles lists the absolute file paths of the package's source @@ -627,7 +630,7 @@ func newLoader(cfg *Config) *loader { return ld } -// refine connects the supplied packages into a graph and then adds type and +// refine connects the supplied packages into a graph and then adds type // and syntax information as requested by the LoadMode. func (ld *loader) refine(response *driverResponse) ([]*Package, error) { roots := response.Roots @@ -1040,6 +1043,9 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) { Error: appendError, Sizes: ld.sizes, } + if lpkg.Module != nil && lpkg.Module.GoVersion != "" { + typesinternal.SetGoVersion(tc, "go"+lpkg.Module.GoVersion) + } if (ld.Mode & typecheckCgo) != 0 { if !typesinternal.SetUsesCgo(tc) { appendError(Error{ diff --git a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go index be8f5a867e..c725d839ba 100644 --- a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go +++ b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go @@ -29,10 +29,9 @@ import ( "sort" "strconv" "strings" + _ "unsafe" "golang.org/x/tools/internal/typeparams" - - _ "unsafe" // for go:linkname ) // A Path is an opaque name that identifies a types.Object @@ -113,6 +112,29 @@ const ( opObj = 'O' // .Obj() (Named, TypeParam) ) +// For is equivalent to new(Encoder).For(obj). +// +// It may be more efficient to reuse a single Encoder across several calls. +func For(obj types.Object) (Path, error) { + return new(Encoder).For(obj) +} + +// An Encoder amortizes the cost of encoding the paths of multiple objects. +// The zero value of an Encoder is ready to use. +type Encoder struct { + scopeMemo map[*types.Scope][]types.Object // memoization of scopeObjects + namedMethodsMemo map[*types.Named][]*types.Func // memoization of namedMethods() + skipMethodSorting bool +} + +// Exposed to gopls via golang.org/x/tools/internal/typesinternal +// TODO(golang/go#61443): eliminate this parameter one way or the other. +// +//go:linkname skipMethodSorting +func skipMethodSorting(enc *Encoder) { + enc.skipMethodSorting = true +} + // For returns the path to an object relative to its package, // or an error if the object is not accessible from the package's Scope. // @@ -125,6 +147,17 @@ const ( // These objects are sufficient to define the API of their package. // The objects described by a package's export data are drawn from this set. // +// The set of objects accessible from a package's Scope depends on +// whether the package was produced by type-checking syntax, or +// reading export data; the latter may have a smaller Scope since +// export data trims objects that are not reachable from an exported +// declaration. For example, the For function will return a path for +// an exported method of an unexported type that is not reachable +// from any public declaration; this path will cause the Object +// function to fail if called on a package loaded from export data. +// TODO(adonovan): is this a bug or feature? Should this package +// compute accessibility in the same way? +// // For does not return a path for predeclared names, imported package // names, local names, and unexported package-level names (except // types). @@ -145,24 +178,7 @@ const ( // .Type().Field(0) (field Var X) // // where p is the package (*types.Package) to which X belongs. -func For(obj types.Object) (Path, error) { - return newEncoderFor()(obj) -} - -// An encoder amortizes the cost of encoding the paths of multiple objects. -// Nonexported pending approval of proposal 58668. -type encoder struct { - scopeNamesMemo map[*types.Scope][]string // memoization of Scope.Names() - namedMethodsMemo map[*types.Named][]*types.Func // memoization of namedMethods() -} - -// Exposed to gopls via golang.org/x/tools/internal/typesinternal -// pending approval of proposal 58668. -// -//go:linkname newEncoderFor -func newEncoderFor() func(types.Object) (Path, error) { return new(encoder).For } - -func (enc *encoder) For(obj types.Object) (Path, error) { +func (enc *Encoder) For(obj types.Object) (Path, error) { pkg := obj.Pkg() // This table lists the cases of interest. @@ -260,15 +276,14 @@ func (enc *encoder) For(obj types.Object) (Path, error) { // the best paths because non-types may // refer to types, but not the reverse. empty := make([]byte, 0, 48) // initial space - names := enc.scopeNames(scope) - for _, name := range names { - o := scope.Lookup(name) + objs := enc.scopeObjects(scope) + for _, o := range objs { tname, ok := o.(*types.TypeName) if !ok { continue // handle non-types in second pass } - path := append(empty, name...) + path := append(empty, o.Name()...) path = append(path, opType) T := o.Type() @@ -294,9 +309,8 @@ func (enc *encoder) For(obj types.Object) (Path, error) { // Then inspect everything else: // non-types, and declared methods of defined types. - for _, name := range names { - o := scope.Lookup(name) - path := append(empty, name...) + for _, o := range objs { + path := append(empty, o.Name()...) if _, ok := o.(*types.TypeName); !ok { if o.Exported() { // exported non-type (const, var, func) @@ -310,16 +324,31 @@ func (enc *encoder) For(obj types.Object) (Path, error) { // Inspect declared methods of defined types. if T, ok := o.Type().(*types.Named); ok { path = append(path, opType) - // Note that method index here is always with respect - // to canonical ordering of methods, regardless of how - // they appear in the underlying type. - for i, m := range enc.namedMethods(T) { - path2 := appendOpArg(path, opMethod, i) - if m == obj { - return Path(path2), nil // found declared method + if !enc.skipMethodSorting { + // Note that method index here is always with respect + // to canonical ordering of methods, regardless of how + // they appear in the underlying type. + for i, m := range enc.namedMethods(T) { + path2 := appendOpArg(path, opMethod, i) + if m == obj { + return Path(path2), nil // found declared method + } + if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { + return Path(r), nil + } } - if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { - return Path(r), nil + } else { + // This branch must match the logic in the branch above, using go/types + // APIs without sorting. + for i := 0; i < T.NumMethods(); i++ { + m := T.Method(i) + path2 := appendOpArg(path, opMethod, i) + if m == obj { + return Path(path2), nil // found declared method + } + if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { + return Path(r), nil + } } } } @@ -341,7 +370,7 @@ func appendOpArg(path []byte, op byte, arg int) []byte { // This function is just an optimization that avoids the general scope walking // approach. You are expected to fall back to the general approach if this // function fails. -func (enc *encoder) concreteMethod(meth *types.Func) (Path, bool) { +func (enc *Encoder) concreteMethod(meth *types.Func) (Path, bool) { // Concrete methods can only be declared on package-scoped named types. For // that reason we can skip the expensive walk over the package scope: the // path will always be package -> named type -> method. We can trivially get @@ -414,14 +443,33 @@ func (enc *encoder) concreteMethod(meth *types.Func) (Path, bool) { path := make([]byte, 0, len(name)+8) path = append(path, name...) path = append(path, opType) - for i, m := range enc.namedMethods(named) { - if m == meth { - path = appendOpArg(path, opMethod, i) - return Path(path), true + + if !enc.skipMethodSorting { + for i, m := range enc.namedMethods(named) { + if m == meth { + path = appendOpArg(path, opMethod, i) + return Path(path), true + } + } + } else { + // This branch must match the logic of the branch above, using go/types + // APIs without sorting. + for i := 0; i < named.NumMethods(); i++ { + m := named.Method(i) + if m == meth { + path = appendOpArg(path, opMethod, i) + return Path(path), true + } } } - panic(fmt.Sprintf("couldn't find method %s on type %s", meth, named)) + // Due to golang/go#59944, go/types fails to associate the receiver with + // certain methods on cgo types. + // + // TODO(rfindley): replace this panic once golang/go#59944 is fixed in all Go + // versions gopls supports. + return "", false + // panic(fmt.Sprintf("couldn't find method %s on type %s; methods: %#v", meth, named, enc.namedMethods(named))) } // find finds obj within type T, returning the path to it, or nil if not found. @@ -524,6 +572,12 @@ func findTypeParam(obj types.Object, list *typeparams.TypeParamList, path []byte // Object returns the object denoted by path p within the package pkg. func Object(pkg *types.Package, p Path) (types.Object, error) { + return object(pkg, p, false) +} + +// Note: the skipMethodSorting parameter must match the value of +// Encoder.skipMethodSorting used during encoding. +func object(pkg *types.Package, p Path, skipMethodSorting bool) (types.Object, error) { if p == "" { return nil, fmt.Errorf("empty path") } @@ -687,11 +741,15 @@ func Object(pkg *types.Package, p Path) (types.Object, error) { obj = t.Method(index) // Id-ordered case *types.Named: - methods := namedMethods(t) // (unmemoized) - if index >= len(methods) { - return nil, fmt.Errorf("method index %d out of range [0-%d)", index, len(methods)) + if index >= t.NumMethods() { + return nil, fmt.Errorf("method index %d out of range [0-%d)", index, t.NumMethods()) + } + if skipMethodSorting { + obj = t.Method(index) + } else { + methods := namedMethods(t) // (unmemoized) + obj = methods[index] // Id-ordered } - obj = methods[index] // Id-ordered default: return nil, fmt.Errorf("cannot apply %q to %s (got %T, want interface or named)", code, t, t) @@ -730,23 +788,8 @@ func namedMethods(named *types.Named) []*types.Func { return methods } -// scopeNames is a memoization of scope.Names. Callers must not modify the result. -func (enc *encoder) scopeNames(scope *types.Scope) []string { - m := enc.scopeNamesMemo - if m == nil { - m = make(map[*types.Scope][]string) - enc.scopeNamesMemo = m - } - names, ok := m[scope] - if !ok { - names = scope.Names() // allocates and sorts - m[scope] = names - } - return names -} - // namedMethods is a memoization of the namedMethods function. Callers must not modify the result. -func (enc *encoder) namedMethods(named *types.Named) []*types.Func { +func (enc *Encoder) namedMethods(named *types.Named) []*types.Func { m := enc.namedMethodsMemo if m == nil { m = make(map[*types.Named][]*types.Func) @@ -758,5 +801,24 @@ func (enc *encoder) namedMethods(named *types.Named) []*types.Func { m[named] = methods } return methods +} +// scopeObjects is a memoization of scope objects. +// Callers must not modify the result. +func (enc *Encoder) scopeObjects(scope *types.Scope) []types.Object { + m := enc.scopeMemo + if m == nil { + m = make(map[*types.Scope][]types.Object) + enc.scopeMemo = m + } + objs, ok := m[scope] + if !ok { + names := scope.Names() // allocates and sorts + objs = make([]types.Object, len(names)) + for i, name := range names { + objs[i] = scope.Lookup(name) + } + m[scope] = objs + } + return objs } diff --git a/vendor/golang.org/x/tools/internal/event/tag/tag.go b/vendor/golang.org/x/tools/internal/event/tag/tag.go new file mode 100644 index 0000000000..581b26c204 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/event/tag/tag.go @@ -0,0 +1,59 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag provides the labels used for telemetry throughout gopls. +package tag + +import ( + "golang.org/x/tools/internal/event/keys" +) + +var ( + // create the label keys we use + Method = keys.NewString("method", "") + StatusCode = keys.NewString("status.code", "") + StatusMessage = keys.NewString("status.message", "") + RPCID = keys.NewString("id", "") + RPCDirection = keys.NewString("direction", "") + File = keys.NewString("file", "") + Directory = keys.New("directory", "") + URI = keys.New("URI", "") + Package = keys.NewString("package", "") // sorted comma-separated list of Package IDs + PackagePath = keys.NewString("package_path", "") + Query = keys.New("query", "") + Snapshot = keys.NewUInt64("snapshot", "") + Operation = keys.NewString("operation", "") + + Position = keys.New("position", "") + Category = keys.NewString("category", "") + PackageCount = keys.NewInt("packages", "") + Files = keys.New("files", "") + Port = keys.NewInt("port", "") + Type = keys.New("type", "") + HoverKind = keys.NewString("hoverkind", "") + + NewServer = keys.NewString("new_server", "A new server was added") + EndServer = keys.NewString("end_server", "A server was shut down") + + ServerID = keys.NewString("server", "The server ID an event is related to") + Logfile = keys.NewString("logfile", "") + DebugAddress = keys.NewString("debug_address", "") + GoplsPath = keys.NewString("gopls_path", "") + ClientID = keys.NewString("client_id", "") + + Level = keys.NewInt("level", "The logging level") +) + +var ( + // create the stats we measure + Started = keys.NewInt64("started", "Count of started RPCs.") + ReceivedBytes = keys.NewInt64("received_bytes", "Bytes received.") //, unit.Bytes) + SentBytes = keys.NewInt64("sent_bytes", "Bytes sent.") //, unit.Bytes) + Latency = keys.NewFloat64("latency_ms", "Elapsed time in milliseconds") //, unit.Milliseconds) +) + +const ( + Inbound = "in" + Outbound = "out" +) diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go b/vendor/golang.org/x/tools/internal/gcimporter/bexport.go deleted file mode 100644 index 30582ed6d3..0000000000 --- a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go +++ /dev/null @@ -1,852 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Binary package export. -// This file was derived from $GOROOT/src/cmd/compile/internal/gc/bexport.go; -// see that file for specification of the format. - -package gcimporter - -import ( - "bytes" - "encoding/binary" - "fmt" - "go/constant" - "go/token" - "go/types" - "math" - "math/big" - "sort" - "strings" -) - -// If debugFormat is set, each integer and string value is preceded by a marker -// and position information in the encoding. This mechanism permits an importer -// to recognize immediately when it is out of sync. The importer recognizes this -// mode automatically (i.e., it can import export data produced with debugging -// support even if debugFormat is not set at the time of import). This mode will -// lead to massively larger export data (by a factor of 2 to 3) and should only -// be enabled during development and debugging. -// -// NOTE: This flag is the first flag to enable if importing dies because of -// (suspected) format errors, and whenever a change is made to the format. -const debugFormat = false // default: false - -// Current export format version. Increase with each format change. -// -// Note: The latest binary (non-indexed) export format is at version 6. -// This exporter is still at level 4, but it doesn't matter since -// the binary importer can handle older versions just fine. -// -// 6: package height (CL 105038) -- NOT IMPLEMENTED HERE -// 5: improved position encoding efficiency (issue 20080, CL 41619) -- NOT IMPLEMENTED HERE -// 4: type name objects support type aliases, uses aliasTag -// 3: Go1.8 encoding (same as version 2, aliasTag defined but never used) -// 2: removed unused bool in ODCL export (compiler only) -// 1: header format change (more regular), export package for _ struct fields -// 0: Go1.7 encoding -const exportVersion = 4 - -// trackAllTypes enables cycle tracking for all types, not just named -// types. The existing compiler invariants assume that unnamed types -// that are not completely set up are not used, or else there are spurious -// errors. -// If disabled, only named types are tracked, possibly leading to slightly -// less efficient encoding in rare cases. It also prevents the export of -// some corner-case type declarations (but those are not handled correctly -// with with the textual export format either). -// TODO(gri) enable and remove once issues caused by it are fixed -const trackAllTypes = false - -type exporter struct { - fset *token.FileSet - out bytes.Buffer - - // object -> index maps, indexed in order of serialization - strIndex map[string]int - pkgIndex map[*types.Package]int - typIndex map[types.Type]int - - // position encoding - posInfoFormat bool - prevFile string - prevLine int - - // debugging support - written int // bytes written - indent int // for trace -} - -// internalError represents an error generated inside this package. -type internalError string - -func (e internalError) Error() string { return "gcimporter: " + string(e) } - -func internalErrorf(format string, args ...interface{}) error { - return internalError(fmt.Sprintf(format, args...)) -} - -// BExportData returns binary export data for pkg. -// If no file set is provided, position info will be missing. -func BExportData(fset *token.FileSet, pkg *types.Package) (b []byte, err error) { - if !debug { - defer func() { - if e := recover(); e != nil { - if ierr, ok := e.(internalError); ok { - err = ierr - return - } - // Not an internal error; panic again. - panic(e) - } - }() - } - - p := exporter{ - fset: fset, - strIndex: map[string]int{"": 0}, // empty string is mapped to 0 - pkgIndex: make(map[*types.Package]int), - typIndex: make(map[types.Type]int), - posInfoFormat: true, // TODO(gri) might become a flag, eventually - } - - // write version info - // The version string must start with "version %d" where %d is the version - // number. Additional debugging information may follow after a blank; that - // text is ignored by the importer. - p.rawStringln(fmt.Sprintf("version %d", exportVersion)) - var debug string - if debugFormat { - debug = "debug" - } - p.rawStringln(debug) // cannot use p.bool since it's affected by debugFormat; also want to see this clearly - p.bool(trackAllTypes) - p.bool(p.posInfoFormat) - - // --- generic export data --- - - // populate type map with predeclared "known" types - for index, typ := range predeclared() { - p.typIndex[typ] = index - } - if len(p.typIndex) != len(predeclared()) { - return nil, internalError("duplicate entries in type map?") - } - - // write package data - p.pkg(pkg, true) - if trace { - p.tracef("\n") - } - - // write objects - objcount := 0 - scope := pkg.Scope() - for _, name := range scope.Names() { - if !token.IsExported(name) { - continue - } - if trace { - p.tracef("\n") - } - p.obj(scope.Lookup(name)) - objcount++ - } - - // indicate end of list - if trace { - p.tracef("\n") - } - p.tag(endTag) - - // for self-verification only (redundant) - p.int(objcount) - - if trace { - p.tracef("\n") - } - - // --- end of export data --- - - return p.out.Bytes(), nil -} - -func (p *exporter) pkg(pkg *types.Package, emptypath bool) { - if pkg == nil { - panic(internalError("unexpected nil pkg")) - } - - // if we saw the package before, write its index (>= 0) - if i, ok := p.pkgIndex[pkg]; ok { - p.index('P', i) - return - } - - // otherwise, remember the package, write the package tag (< 0) and package data - if trace { - p.tracef("P%d = { ", len(p.pkgIndex)) - defer p.tracef("} ") - } - p.pkgIndex[pkg] = len(p.pkgIndex) - - p.tag(packageTag) - p.string(pkg.Name()) - if emptypath { - p.string("") - } else { - p.string(pkg.Path()) - } -} - -func (p *exporter) obj(obj types.Object) { - switch obj := obj.(type) { - case *types.Const: - p.tag(constTag) - p.pos(obj) - p.qualifiedName(obj) - p.typ(obj.Type()) - p.value(obj.Val()) - - case *types.TypeName: - if obj.IsAlias() { - p.tag(aliasTag) - p.pos(obj) - p.qualifiedName(obj) - } else { - p.tag(typeTag) - } - p.typ(obj.Type()) - - case *types.Var: - p.tag(varTag) - p.pos(obj) - p.qualifiedName(obj) - p.typ(obj.Type()) - - case *types.Func: - p.tag(funcTag) - p.pos(obj) - p.qualifiedName(obj) - sig := obj.Type().(*types.Signature) - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) - - default: - panic(internalErrorf("unexpected object %v (%T)", obj, obj)) - } -} - -func (p *exporter) pos(obj types.Object) { - if !p.posInfoFormat { - return - } - - file, line := p.fileLine(obj) - if file == p.prevFile { - // common case: write line delta - // delta == 0 means different file or no line change - delta := line - p.prevLine - p.int(delta) - if delta == 0 { - p.int(-1) // -1 means no file change - } - } else { - // different file - p.int(0) - // Encode filename as length of common prefix with previous - // filename, followed by (possibly empty) suffix. Filenames - // frequently share path prefixes, so this can save a lot - // of space and make export data size less dependent on file - // path length. The suffix is unlikely to be empty because - // file names tend to end in ".go". - n := commonPrefixLen(p.prevFile, file) - p.int(n) // n >= 0 - p.string(file[n:]) // write suffix only - p.prevFile = file - p.int(line) - } - p.prevLine = line -} - -func (p *exporter) fileLine(obj types.Object) (file string, line int) { - if p.fset != nil { - pos := p.fset.Position(obj.Pos()) - file = pos.Filename - line = pos.Line - } - return -} - -func commonPrefixLen(a, b string) int { - if len(a) > len(b) { - a, b = b, a - } - // len(a) <= len(b) - i := 0 - for i < len(a) && a[i] == b[i] { - i++ - } - return i -} - -func (p *exporter) qualifiedName(obj types.Object) { - p.string(obj.Name()) - p.pkg(obj.Pkg(), false) -} - -func (p *exporter) typ(t types.Type) { - if t == nil { - panic(internalError("nil type")) - } - - // Possible optimization: Anonymous pointer types *T where - // T is a named type are common. We could canonicalize all - // such types *T to a single type PT = *T. This would lead - // to at most one *T entry in typIndex, and all future *T's - // would be encoded as the respective index directly. Would - // save 1 byte (pointerTag) per *T and reduce the typIndex - // size (at the cost of a canonicalization map). We can do - // this later, without encoding format change. - - // if we saw the type before, write its index (>= 0) - if i, ok := p.typIndex[t]; ok { - p.index('T', i) - return - } - - // otherwise, remember the type, write the type tag (< 0) and type data - if trackAllTypes { - if trace { - p.tracef("T%d = {>\n", len(p.typIndex)) - defer p.tracef("<\n} ") - } - p.typIndex[t] = len(p.typIndex) - } - - switch t := t.(type) { - case *types.Named: - if !trackAllTypes { - // if we don't track all types, track named types now - p.typIndex[t] = len(p.typIndex) - } - - p.tag(namedTag) - p.pos(t.Obj()) - p.qualifiedName(t.Obj()) - p.typ(t.Underlying()) - if !types.IsInterface(t) { - p.assocMethods(t) - } - - case *types.Array: - p.tag(arrayTag) - p.int64(t.Len()) - p.typ(t.Elem()) - - case *types.Slice: - p.tag(sliceTag) - p.typ(t.Elem()) - - case *dddSlice: - p.tag(dddTag) - p.typ(t.elem) - - case *types.Struct: - p.tag(structTag) - p.fieldList(t) - - case *types.Pointer: - p.tag(pointerTag) - p.typ(t.Elem()) - - case *types.Signature: - p.tag(signatureTag) - p.paramList(t.Params(), t.Variadic()) - p.paramList(t.Results(), false) - - case *types.Interface: - p.tag(interfaceTag) - p.iface(t) - - case *types.Map: - p.tag(mapTag) - p.typ(t.Key()) - p.typ(t.Elem()) - - case *types.Chan: - p.tag(chanTag) - p.int(int(3 - t.Dir())) // hack - p.typ(t.Elem()) - - default: - panic(internalErrorf("unexpected type %T: %s", t, t)) - } -} - -func (p *exporter) assocMethods(named *types.Named) { - // Sort methods (for determinism). - var methods []*types.Func - for i := 0; i < named.NumMethods(); i++ { - methods = append(methods, named.Method(i)) - } - sort.Sort(methodsByName(methods)) - - p.int(len(methods)) - - if trace && methods != nil { - p.tracef("associated methods {>\n") - } - - for i, m := range methods { - if trace && i > 0 { - p.tracef("\n") - } - - p.pos(m) - name := m.Name() - p.string(name) - if !exported(name) { - p.pkg(m.Pkg(), false) - } - - sig := m.Type().(*types.Signature) - p.paramList(types.NewTuple(sig.Recv()), false) - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) - p.int(0) // dummy value for go:nointerface pragma - ignored by importer - } - - if trace && methods != nil { - p.tracef("<\n} ") - } -} - -type methodsByName []*types.Func - -func (x methodsByName) Len() int { return len(x) } -func (x methodsByName) Swap(i, j int) { x[i], x[j] = x[j], x[i] } -func (x methodsByName) Less(i, j int) bool { return x[i].Name() < x[j].Name() } - -func (p *exporter) fieldList(t *types.Struct) { - if trace && t.NumFields() > 0 { - p.tracef("fields {>\n") - defer p.tracef("<\n} ") - } - - p.int(t.NumFields()) - for i := 0; i < t.NumFields(); i++ { - if trace && i > 0 { - p.tracef("\n") - } - p.field(t.Field(i)) - p.string(t.Tag(i)) - } -} - -func (p *exporter) field(f *types.Var) { - if !f.IsField() { - panic(internalError("field expected")) - } - - p.pos(f) - p.fieldName(f) - p.typ(f.Type()) -} - -func (p *exporter) iface(t *types.Interface) { - // TODO(gri): enable importer to load embedded interfaces, - // then emit Embeddeds and ExplicitMethods separately here. - p.int(0) - - n := t.NumMethods() - if trace && n > 0 { - p.tracef("methods {>\n") - defer p.tracef("<\n} ") - } - p.int(n) - for i := 0; i < n; i++ { - if trace && i > 0 { - p.tracef("\n") - } - p.method(t.Method(i)) - } -} - -func (p *exporter) method(m *types.Func) { - sig := m.Type().(*types.Signature) - if sig.Recv() == nil { - panic(internalError("method expected")) - } - - p.pos(m) - p.string(m.Name()) - if m.Name() != "_" && !token.IsExported(m.Name()) { - p.pkg(m.Pkg(), false) - } - - // interface method; no need to encode receiver. - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) -} - -func (p *exporter) fieldName(f *types.Var) { - name := f.Name() - - if f.Anonymous() { - // anonymous field - we distinguish between 3 cases: - // 1) field name matches base type name and is exported - // 2) field name matches base type name and is not exported - // 3) field name doesn't match base type name (alias name) - bname := basetypeName(f.Type()) - if name == bname { - if token.IsExported(name) { - name = "" // 1) we don't need to know the field name or package - } else { - name = "?" // 2) use unexported name "?" to force package export - } - } else { - // 3) indicate alias and export name as is - // (this requires an extra "@" but this is a rare case) - p.string("@") - } - } - - p.string(name) - if name != "" && !token.IsExported(name) { - p.pkg(f.Pkg(), false) - } -} - -func basetypeName(typ types.Type) string { - switch typ := deref(typ).(type) { - case *types.Basic: - return typ.Name() - case *types.Named: - return typ.Obj().Name() - default: - return "" // unnamed type - } -} - -func (p *exporter) paramList(params *types.Tuple, variadic bool) { - // use negative length to indicate unnamed parameters - // (look at the first parameter only since either all - // names are present or all are absent) - n := params.Len() - if n > 0 && params.At(0).Name() == "" { - n = -n - } - p.int(n) - for i := 0; i < params.Len(); i++ { - q := params.At(i) - t := q.Type() - if variadic && i == params.Len()-1 { - t = &dddSlice{t.(*types.Slice).Elem()} - } - p.typ(t) - if n > 0 { - name := q.Name() - p.string(name) - if name != "_" { - p.pkg(q.Pkg(), false) - } - } - p.string("") // no compiler-specific info - } -} - -func (p *exporter) value(x constant.Value) { - if trace { - p.tracef("= ") - } - - switch x.Kind() { - case constant.Bool: - tag := falseTag - if constant.BoolVal(x) { - tag = trueTag - } - p.tag(tag) - - case constant.Int: - if v, exact := constant.Int64Val(x); exact { - // common case: x fits into an int64 - use compact encoding - p.tag(int64Tag) - p.int64(v) - return - } - // uncommon case: large x - use float encoding - // (powers of 2 will be encoded efficiently with exponent) - p.tag(floatTag) - p.float(constant.ToFloat(x)) - - case constant.Float: - p.tag(floatTag) - p.float(x) - - case constant.Complex: - p.tag(complexTag) - p.float(constant.Real(x)) - p.float(constant.Imag(x)) - - case constant.String: - p.tag(stringTag) - p.string(constant.StringVal(x)) - - case constant.Unknown: - // package contains type errors - p.tag(unknownTag) - - default: - panic(internalErrorf("unexpected value %v (%T)", x, x)) - } -} - -func (p *exporter) float(x constant.Value) { - if x.Kind() != constant.Float { - panic(internalErrorf("unexpected constant %v, want float", x)) - } - // extract sign (there is no -0) - sign := constant.Sign(x) - if sign == 0 { - // x == 0 - p.int(0) - return - } - // x != 0 - - var f big.Float - if v, exact := constant.Float64Val(x); exact { - // float64 - f.SetFloat64(v) - } else if num, denom := constant.Num(x), constant.Denom(x); num.Kind() == constant.Int { - // TODO(gri): add big.Rat accessor to constant.Value. - r := valueToRat(num) - f.SetRat(r.Quo(r, valueToRat(denom))) - } else { - // Value too large to represent as a fraction => inaccessible. - // TODO(gri): add big.Float accessor to constant.Value. - f.SetFloat64(math.MaxFloat64) // FIXME - } - - // extract exponent such that 0.5 <= m < 1.0 - var m big.Float - exp := f.MantExp(&m) - - // extract mantissa as *big.Int - // - set exponent large enough so mant satisfies mant.IsInt() - // - get *big.Int from mant - m.SetMantExp(&m, int(m.MinPrec())) - mant, acc := m.Int(nil) - if acc != big.Exact { - panic(internalError("internal error")) - } - - p.int(sign) - p.int(exp) - p.string(string(mant.Bytes())) -} - -func valueToRat(x constant.Value) *big.Rat { - // Convert little-endian to big-endian. - // I can't believe this is necessary. - bytes := constant.Bytes(x) - for i := 0; i < len(bytes)/2; i++ { - bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i] - } - return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes)) -} - -func (p *exporter) bool(b bool) bool { - if trace { - p.tracef("[") - defer p.tracef("= %v] ", b) - } - - x := 0 - if b { - x = 1 - } - p.int(x) - return b -} - -// ---------------------------------------------------------------------------- -// Low-level encoders - -func (p *exporter) index(marker byte, index int) { - if index < 0 { - panic(internalError("invalid index < 0")) - } - if debugFormat { - p.marker('t') - } - if trace { - p.tracef("%c%d ", marker, index) - } - p.rawInt64(int64(index)) -} - -func (p *exporter) tag(tag int) { - if tag >= 0 { - panic(internalError("invalid tag >= 0")) - } - if debugFormat { - p.marker('t') - } - if trace { - p.tracef("%s ", tagString[-tag]) - } - p.rawInt64(int64(tag)) -} - -func (p *exporter) int(x int) { - p.int64(int64(x)) -} - -func (p *exporter) int64(x int64) { - if debugFormat { - p.marker('i') - } - if trace { - p.tracef("%d ", x) - } - p.rawInt64(x) -} - -func (p *exporter) string(s string) { - if debugFormat { - p.marker('s') - } - if trace { - p.tracef("%q ", s) - } - // if we saw the string before, write its index (>= 0) - // (the empty string is mapped to 0) - if i, ok := p.strIndex[s]; ok { - p.rawInt64(int64(i)) - return - } - // otherwise, remember string and write its negative length and bytes - p.strIndex[s] = len(p.strIndex) - p.rawInt64(-int64(len(s))) - for i := 0; i < len(s); i++ { - p.rawByte(s[i]) - } -} - -// marker emits a marker byte and position information which makes -// it easy for a reader to detect if it is "out of sync". Used for -// debugFormat format only. -func (p *exporter) marker(m byte) { - p.rawByte(m) - // Enable this for help tracking down the location - // of an incorrect marker when running in debugFormat. - if false && trace { - p.tracef("#%d ", p.written) - } - p.rawInt64(int64(p.written)) -} - -// rawInt64 should only be used by low-level encoders. -func (p *exporter) rawInt64(x int64) { - var tmp [binary.MaxVarintLen64]byte - n := binary.PutVarint(tmp[:], x) - for i := 0; i < n; i++ { - p.rawByte(tmp[i]) - } -} - -// rawStringln should only be used to emit the initial version string. -func (p *exporter) rawStringln(s string) { - for i := 0; i < len(s); i++ { - p.rawByte(s[i]) - } - p.rawByte('\n') -} - -// rawByte is the bottleneck interface to write to p.out. -// rawByte escapes b as follows (any encoding does that -// hides '$'): -// -// '$' => '|' 'S' -// '|' => '|' '|' -// -// Necessary so other tools can find the end of the -// export data by searching for "$$". -// rawByte should only be used by low-level encoders. -func (p *exporter) rawByte(b byte) { - switch b { - case '$': - // write '$' as '|' 'S' - b = 'S' - fallthrough - case '|': - // write '|' as '|' '|' - p.out.WriteByte('|') - p.written++ - } - p.out.WriteByte(b) - p.written++ -} - -// tracef is like fmt.Printf but it rewrites the format string -// to take care of indentation. -func (p *exporter) tracef(format string, args ...interface{}) { - if strings.ContainsAny(format, "<>\n") { - var buf bytes.Buffer - for i := 0; i < len(format); i++ { - // no need to deal with runes - ch := format[i] - switch ch { - case '>': - p.indent++ - continue - case '<': - p.indent-- - continue - } - buf.WriteByte(ch) - if ch == '\n' { - for j := p.indent; j > 0; j-- { - buf.WriteString(". ") - } - } - } - format = buf.String() - } - fmt.Printf(format, args...) -} - -// Debugging support. -// (tagString is only used when tracing is enabled) -var tagString = [...]string{ - // Packages - -packageTag: "package", - - // Types - -namedTag: "named type", - -arrayTag: "array", - -sliceTag: "slice", - -dddTag: "ddd", - -structTag: "struct", - -pointerTag: "pointer", - -signatureTag: "signature", - -interfaceTag: "interface", - -mapTag: "map", - -chanTag: "chan", - - // Values - -falseTag: "false", - -trueTag: "true", - -int64Tag: "int64", - -floatTag: "float", - -fractionTag: "fraction", - -complexTag: "complex", - -stringTag: "string", - -unknownTag: "unknown", - - // Type aliases - -aliasTag: "alias", -} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go index b85de01470..d98b0db2a9 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go @@ -2,340 +2,24 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// This file is a copy of $GOROOT/src/go/internal/gcimporter/bimport.go. +// This file contains the remaining vestiges of +// $GOROOT/src/go/internal/gcimporter/bimport.go. package gcimporter import ( - "encoding/binary" "fmt" - "go/constant" "go/token" "go/types" - "sort" - "strconv" - "strings" "sync" - "unicode" - "unicode/utf8" ) -type importer struct { - imports map[string]*types.Package - data []byte - importpath string - buf []byte // for reading strings - version int // export format version - - // object lists - strList []string // in order of appearance - pathList []string // in order of appearance - pkgList []*types.Package // in order of appearance - typList []types.Type // in order of appearance - interfaceList []*types.Interface // for delayed completion only - trackAllTypes bool - - // position encoding - posInfoFormat bool - prevFile string - prevLine int - fake fakeFileSet - - // debugging support - debugFormat bool - read int // bytes read -} - -// BImportData imports a package from the serialized package data -// and returns the number of bytes consumed and a reference to the package. -// If the export data version is not recognized or the format is otherwise -// compromised, an error is returned. -func BImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) { - // catch panics and return them as errors - const currentVersion = 6 - version := -1 // unknown version - defer func() { - if e := recover(); e != nil { - // Return a (possibly nil or incomplete) package unchanged (see #16088). - if version > currentVersion { - err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e) - } else { - err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e) - } - } - }() - - p := importer{ - imports: imports, - data: data, - importpath: path, - version: version, - strList: []string{""}, // empty string is mapped to 0 - pathList: []string{""}, // empty string is mapped to 0 - fake: fakeFileSet{ - fset: fset, - files: make(map[string]*fileInfo), - }, - } - defer p.fake.setLines() // set lines for files in fset - - // read version info - var versionstr string - if b := p.rawByte(); b == 'c' || b == 'd' { - // Go1.7 encoding; first byte encodes low-level - // encoding format (compact vs debug). - // For backward-compatibility only (avoid problems with - // old installed packages). Newly compiled packages use - // the extensible format string. - // TODO(gri) Remove this support eventually; after Go1.8. - if b == 'd' { - p.debugFormat = true - } - p.trackAllTypes = p.rawByte() == 'a' - p.posInfoFormat = p.int() != 0 - versionstr = p.string() - if versionstr == "v1" { - version = 0 - } - } else { - // Go1.8 extensible encoding - // read version string and extract version number (ignore anything after the version number) - versionstr = p.rawStringln(b) - if s := strings.SplitN(versionstr, " ", 3); len(s) >= 2 && s[0] == "version" { - if v, err := strconv.Atoi(s[1]); err == nil && v > 0 { - version = v - } - } - } - p.version = version - - // read version specific flags - extend as necessary - switch p.version { - // case currentVersion: - // ... - // fallthrough - case currentVersion, 5, 4, 3, 2, 1: - p.debugFormat = p.rawStringln(p.rawByte()) == "debug" - p.trackAllTypes = p.int() != 0 - p.posInfoFormat = p.int() != 0 - case 0: - // Go1.7 encoding format - nothing to do here - default: - errorf("unknown bexport format version %d (%q)", p.version, versionstr) - } - - // --- generic export data --- - - // populate typList with predeclared "known" types - p.typList = append(p.typList, predeclared()...) - - // read package data - pkg = p.pkg() - - // read objects of phase 1 only (see cmd/compile/internal/gc/bexport.go) - objcount := 0 - for { - tag := p.tagOrIndex() - if tag == endTag { - break - } - p.obj(tag) - objcount++ - } - - // self-verification - if count := p.int(); count != objcount { - errorf("got %d objects; want %d", objcount, count) - } - - // ignore compiler-specific import data - - // complete interfaces - // TODO(gri) re-investigate if we still need to do this in a delayed fashion - for _, typ := range p.interfaceList { - typ.Complete() - } - - // record all referenced packages as imports - list := append(([]*types.Package)(nil), p.pkgList[1:]...) - sort.Sort(byPath(list)) - pkg.SetImports(list) - - // package was imported completely and without errors - pkg.MarkComplete() - - return p.read, pkg, nil -} - func errorf(format string, args ...interface{}) { panic(fmt.Sprintf(format, args...)) } -func (p *importer) pkg() *types.Package { - // if the package was seen before, i is its index (>= 0) - i := p.tagOrIndex() - if i >= 0 { - return p.pkgList[i] - } - - // otherwise, i is the package tag (< 0) - if i != packageTag { - errorf("unexpected package tag %d version %d", i, p.version) - } - - // read package data - name := p.string() - var path string - if p.version >= 5 { - path = p.path() - } else { - path = p.string() - } - if p.version >= 6 { - p.int() // package height; unused by go/types - } - - // we should never see an empty package name - if name == "" { - errorf("empty package name in import") - } - - // an empty path denotes the package we are currently importing; - // it must be the first package we see - if (path == "") != (len(p.pkgList) == 0) { - errorf("package path %q for pkg index %d", path, len(p.pkgList)) - } - - // if the package was imported before, use that one; otherwise create a new one - if path == "" { - path = p.importpath - } - pkg := p.imports[path] - if pkg == nil { - pkg = types.NewPackage(path, name) - p.imports[path] = pkg - } else if pkg.Name() != name { - errorf("conflicting names %s and %s for package %q", pkg.Name(), name, path) - } - p.pkgList = append(p.pkgList, pkg) - - return pkg -} - -// objTag returns the tag value for each object kind. -func objTag(obj types.Object) int { - switch obj.(type) { - case *types.Const: - return constTag - case *types.TypeName: - return typeTag - case *types.Var: - return varTag - case *types.Func: - return funcTag - default: - errorf("unexpected object: %v (%T)", obj, obj) // panics - panic("unreachable") - } -} - -func sameObj(a, b types.Object) bool { - // Because unnamed types are not canonicalized, we cannot simply compare types for - // (pointer) identity. - // Ideally we'd check equality of constant values as well, but this is good enough. - return objTag(a) == objTag(b) && types.Identical(a.Type(), b.Type()) -} - -func (p *importer) declare(obj types.Object) { - pkg := obj.Pkg() - if alt := pkg.Scope().Insert(obj); alt != nil { - // This can only trigger if we import a (non-type) object a second time. - // Excluding type aliases, this cannot happen because 1) we only import a package - // once; and b) we ignore compiler-specific export data which may contain - // functions whose inlined function bodies refer to other functions that - // were already imported. - // However, type aliases require reexporting the original type, so we need - // to allow it (see also the comment in cmd/compile/internal/gc/bimport.go, - // method importer.obj, switch case importing functions). - // TODO(gri) review/update this comment once the gc compiler handles type aliases. - if !sameObj(obj, alt) { - errorf("inconsistent import:\n\t%v\npreviously imported as:\n\t%v\n", obj, alt) - } - } -} - -func (p *importer) obj(tag int) { - switch tag { - case constTag: - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - val := p.value() - p.declare(types.NewConst(pos, pkg, name, typ, val)) - - case aliasTag: - // TODO(gri) verify type alias hookup is correct - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - p.declare(types.NewTypeName(pos, pkg, name, typ)) - - case typeTag: - p.typ(nil, nil) - - case varTag: - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - p.declare(types.NewVar(pos, pkg, name, typ)) - - case funcTag: - pos := p.pos() - pkg, name := p.qualifiedName() - params, isddd := p.paramList() - result, _ := p.paramList() - sig := types.NewSignature(nil, params, result, isddd) - p.declare(types.NewFunc(pos, pkg, name, sig)) - - default: - errorf("unexpected object tag %d", tag) - } -} - const deltaNewFile = -64 // see cmd/compile/internal/gc/bexport.go -func (p *importer) pos() token.Pos { - if !p.posInfoFormat { - return token.NoPos - } - - file := p.prevFile - line := p.prevLine - delta := p.int() - line += delta - if p.version >= 5 { - if delta == deltaNewFile { - if n := p.int(); n >= 0 { - // file changed - file = p.path() - line = n - } - } - } else { - if delta == 0 { - if n := p.int(); n >= 0 { - // file changed - file = p.prevFile[:n] + p.string() - line = p.int() - } - } - } - p.prevFile = file - p.prevLine = line - - return p.fake.pos(file, line, 0) -} - // Synthesize a token.Pos type fakeFileSet struct { fset *token.FileSet @@ -389,205 +73,6 @@ var ( fakeLinesOnce sync.Once ) -func (p *importer) qualifiedName() (pkg *types.Package, name string) { - name = p.string() - pkg = p.pkg() - return -} - -func (p *importer) record(t types.Type) { - p.typList = append(p.typList, t) -} - -// A dddSlice is a types.Type representing ...T parameters. -// It only appears for parameter types and does not escape -// the importer. -type dddSlice struct { - elem types.Type -} - -func (t *dddSlice) Underlying() types.Type { return t } -func (t *dddSlice) String() string { return "..." + t.elem.String() } - -// parent is the package which declared the type; parent == nil means -// the package currently imported. The parent package is needed for -// exported struct fields and interface methods which don't contain -// explicit package information in the export data. -// -// A non-nil tname is used as the "owner" of the result type; i.e., -// the result type is the underlying type of tname. tname is used -// to give interface methods a named receiver type where possible. -func (p *importer) typ(parent *types.Package, tname *types.Named) types.Type { - // if the type was seen before, i is its index (>= 0) - i := p.tagOrIndex() - if i >= 0 { - return p.typList[i] - } - - // otherwise, i is the type tag (< 0) - switch i { - case namedTag: - // read type object - pos := p.pos() - parent, name := p.qualifiedName() - scope := parent.Scope() - obj := scope.Lookup(name) - - // if the object doesn't exist yet, create and insert it - if obj == nil { - obj = types.NewTypeName(pos, parent, name, nil) - scope.Insert(obj) - } - - if _, ok := obj.(*types.TypeName); !ok { - errorf("pkg = %s, name = %s => %s", parent, name, obj) - } - - // associate new named type with obj if it doesn't exist yet - t0 := types.NewNamed(obj.(*types.TypeName), nil, nil) - - // but record the existing type, if any - tname := obj.Type().(*types.Named) // tname is either t0 or the existing type - p.record(tname) - - // read underlying type - t0.SetUnderlying(p.typ(parent, t0)) - - // interfaces don't have associated methods - if types.IsInterface(t0) { - return tname - } - - // read associated methods - for i := p.int(); i > 0; i-- { - // TODO(gri) replace this with something closer to fieldName - pos := p.pos() - name := p.string() - if !exported(name) { - p.pkg() - } - - recv, _ := p.paramList() // TODO(gri) do we need a full param list for the receiver? - params, isddd := p.paramList() - result, _ := p.paramList() - p.int() // go:nointerface pragma - discarded - - sig := types.NewSignature(recv.At(0), params, result, isddd) - t0.AddMethod(types.NewFunc(pos, parent, name, sig)) - } - - return tname - - case arrayTag: - t := new(types.Array) - if p.trackAllTypes { - p.record(t) - } - - n := p.int64() - *t = *types.NewArray(p.typ(parent, nil), n) - return t - - case sliceTag: - t := new(types.Slice) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewSlice(p.typ(parent, nil)) - return t - - case dddTag: - t := new(dddSlice) - if p.trackAllTypes { - p.record(t) - } - - t.elem = p.typ(parent, nil) - return t - - case structTag: - t := new(types.Struct) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewStruct(p.fieldList(parent)) - return t - - case pointerTag: - t := new(types.Pointer) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewPointer(p.typ(parent, nil)) - return t - - case signatureTag: - t := new(types.Signature) - if p.trackAllTypes { - p.record(t) - } - - params, isddd := p.paramList() - result, _ := p.paramList() - *t = *types.NewSignature(nil, params, result, isddd) - return t - - case interfaceTag: - // Create a dummy entry in the type list. This is safe because we - // cannot expect the interface type to appear in a cycle, as any - // such cycle must contain a named type which would have been - // first defined earlier. - // TODO(gri) Is this still true now that we have type aliases? - // See issue #23225. - n := len(p.typList) - if p.trackAllTypes { - p.record(nil) - } - - var embeddeds []types.Type - for n := p.int(); n > 0; n-- { - p.pos() - embeddeds = append(embeddeds, p.typ(parent, nil)) - } - - t := newInterface(p.methodList(parent, tname), embeddeds) - p.interfaceList = append(p.interfaceList, t) - if p.trackAllTypes { - p.typList[n] = t - } - return t - - case mapTag: - t := new(types.Map) - if p.trackAllTypes { - p.record(t) - } - - key := p.typ(parent, nil) - val := p.typ(parent, nil) - *t = *types.NewMap(key, val) - return t - - case chanTag: - t := new(types.Chan) - if p.trackAllTypes { - p.record(t) - } - - dir := chanDir(p.int()) - val := p.typ(parent, nil) - *t = *types.NewChan(dir, val) - return t - - default: - errorf("unexpected type tag %d", i) // panics - panic("unreachable") - } -} - func chanDir(d int) types.ChanDir { // tag values must match the constants in cmd/compile/internal/gc/go.go switch d { @@ -603,394 +88,6 @@ func chanDir(d int) types.ChanDir { } } -func (p *importer) fieldList(parent *types.Package) (fields []*types.Var, tags []string) { - if n := p.int(); n > 0 { - fields = make([]*types.Var, n) - tags = make([]string, n) - for i := range fields { - fields[i], tags[i] = p.field(parent) - } - } - return -} - -func (p *importer) field(parent *types.Package) (*types.Var, string) { - pos := p.pos() - pkg, name, alias := p.fieldName(parent) - typ := p.typ(parent, nil) - tag := p.string() - - anonymous := false - if name == "" { - // anonymous field - typ must be T or *T and T must be a type name - switch typ := deref(typ).(type) { - case *types.Basic: // basic types are named types - pkg = nil // // objects defined in Universe scope have no package - name = typ.Name() - case *types.Named: - name = typ.Obj().Name() - default: - errorf("named base type expected") - } - anonymous = true - } else if alias { - // anonymous field: we have an explicit name because it's an alias - anonymous = true - } - - return types.NewField(pos, pkg, name, typ, anonymous), tag -} - -func (p *importer) methodList(parent *types.Package, baseType *types.Named) (methods []*types.Func) { - if n := p.int(); n > 0 { - methods = make([]*types.Func, n) - for i := range methods { - methods[i] = p.method(parent, baseType) - } - } - return -} - -func (p *importer) method(parent *types.Package, baseType *types.Named) *types.Func { - pos := p.pos() - pkg, name, _ := p.fieldName(parent) - // If we don't have a baseType, use a nil receiver. - // A receiver using the actual interface type (which - // we don't know yet) will be filled in when we call - // types.Interface.Complete. - var recv *types.Var - if baseType != nil { - recv = types.NewVar(token.NoPos, parent, "", baseType) - } - params, isddd := p.paramList() - result, _ := p.paramList() - sig := types.NewSignature(recv, params, result, isddd) - return types.NewFunc(pos, pkg, name, sig) -} - -func (p *importer) fieldName(parent *types.Package) (pkg *types.Package, name string, alias bool) { - name = p.string() - pkg = parent - if pkg == nil { - // use the imported package instead - pkg = p.pkgList[0] - } - if p.version == 0 && name == "_" { - // version 0 didn't export a package for _ fields - return - } - switch name { - case "": - // 1) field name matches base type name and is exported: nothing to do - case "?": - // 2) field name matches base type name and is not exported: need package - name = "" - pkg = p.pkg() - case "@": - // 3) field name doesn't match type name (alias) - name = p.string() - alias = true - fallthrough - default: - if !exported(name) { - pkg = p.pkg() - } - } - return -} - -func (p *importer) paramList() (*types.Tuple, bool) { - n := p.int() - if n == 0 { - return nil, false - } - // negative length indicates unnamed parameters - named := true - if n < 0 { - n = -n - named = false - } - // n > 0 - params := make([]*types.Var, n) - isddd := false - for i := range params { - params[i], isddd = p.param(named) - } - return types.NewTuple(params...), isddd -} - -func (p *importer) param(named bool) (*types.Var, bool) { - t := p.typ(nil, nil) - td, isddd := t.(*dddSlice) - if isddd { - t = types.NewSlice(td.elem) - } - - var pkg *types.Package - var name string - if named { - name = p.string() - if name == "" { - errorf("expected named parameter") - } - if name != "_" { - pkg = p.pkg() - } - if i := strings.Index(name, "·"); i > 0 { - name = name[:i] // cut off gc-specific parameter numbering - } - } - - // read and discard compiler-specific info - p.string() - - return types.NewVar(token.NoPos, pkg, name, t), isddd -} - -func exported(name string) bool { - ch, _ := utf8.DecodeRuneInString(name) - return unicode.IsUpper(ch) -} - -func (p *importer) value() constant.Value { - switch tag := p.tagOrIndex(); tag { - case falseTag: - return constant.MakeBool(false) - case trueTag: - return constant.MakeBool(true) - case int64Tag: - return constant.MakeInt64(p.int64()) - case floatTag: - return p.float() - case complexTag: - re := p.float() - im := p.float() - return constant.BinaryOp(re, token.ADD, constant.MakeImag(im)) - case stringTag: - return constant.MakeString(p.string()) - case unknownTag: - return constant.MakeUnknown() - default: - errorf("unexpected value tag %d", tag) // panics - panic("unreachable") - } -} - -func (p *importer) float() constant.Value { - sign := p.int() - if sign == 0 { - return constant.MakeInt64(0) - } - - exp := p.int() - mant := []byte(p.string()) // big endian - - // remove leading 0's if any - for len(mant) > 0 && mant[0] == 0 { - mant = mant[1:] - } - - // convert to little endian - // TODO(gri) go/constant should have a more direct conversion function - // (e.g., once it supports a big.Float based implementation) - for i, j := 0, len(mant)-1; i < j; i, j = i+1, j-1 { - mant[i], mant[j] = mant[j], mant[i] - } - - // adjust exponent (constant.MakeFromBytes creates an integer value, - // but mant represents the mantissa bits such that 0.5 <= mant < 1.0) - exp -= len(mant) << 3 - if len(mant) > 0 { - for msd := mant[len(mant)-1]; msd&0x80 == 0; msd <<= 1 { - exp++ - } - } - - x := constant.MakeFromBytes(mant) - switch { - case exp < 0: - d := constant.Shift(constant.MakeInt64(1), token.SHL, uint(-exp)) - x = constant.BinaryOp(x, token.QUO, d) - case exp > 0: - x = constant.Shift(x, token.SHL, uint(exp)) - } - - if sign < 0 { - x = constant.UnaryOp(token.SUB, x, 0) - } - return x -} - -// ---------------------------------------------------------------------------- -// Low-level decoders - -func (p *importer) tagOrIndex() int { - if p.debugFormat { - p.marker('t') - } - - return int(p.rawInt64()) -} - -func (p *importer) int() int { - x := p.int64() - if int64(int(x)) != x { - errorf("exported integer too large") - } - return int(x) -} - -func (p *importer) int64() int64 { - if p.debugFormat { - p.marker('i') - } - - return p.rawInt64() -} - -func (p *importer) path() string { - if p.debugFormat { - p.marker('p') - } - // if the path was seen before, i is its index (>= 0) - // (the empty string is at index 0) - i := p.rawInt64() - if i >= 0 { - return p.pathList[i] - } - // otherwise, i is the negative path length (< 0) - a := make([]string, -i) - for n := range a { - a[n] = p.string() - } - s := strings.Join(a, "/") - p.pathList = append(p.pathList, s) - return s -} - -func (p *importer) string() string { - if p.debugFormat { - p.marker('s') - } - // if the string was seen before, i is its index (>= 0) - // (the empty string is at index 0) - i := p.rawInt64() - if i >= 0 { - return p.strList[i] - } - // otherwise, i is the negative string length (< 0) - if n := int(-i); n <= cap(p.buf) { - p.buf = p.buf[:n] - } else { - p.buf = make([]byte, n) - } - for i := range p.buf { - p.buf[i] = p.rawByte() - } - s := string(p.buf) - p.strList = append(p.strList, s) - return s -} - -func (p *importer) marker(want byte) { - if got := p.rawByte(); got != want { - errorf("incorrect marker: got %c; want %c (pos = %d)", got, want, p.read) - } - - pos := p.read - if n := int(p.rawInt64()); n != pos { - errorf("incorrect position: got %d; want %d", n, pos) - } -} - -// rawInt64 should only be used by low-level decoders. -func (p *importer) rawInt64() int64 { - i, err := binary.ReadVarint(p) - if err != nil { - errorf("read error: %v", err) - } - return i -} - -// rawStringln should only be used to read the initial version string. -func (p *importer) rawStringln(b byte) string { - p.buf = p.buf[:0] - for b != '\n' { - p.buf = append(p.buf, b) - b = p.rawByte() - } - return string(p.buf) -} - -// needed for binary.ReadVarint in rawInt64 -func (p *importer) ReadByte() (byte, error) { - return p.rawByte(), nil -} - -// byte is the bottleneck interface for reading p.data. -// It unescapes '|' 'S' to '$' and '|' '|' to '|'. -// rawByte should only be used by low-level decoders. -func (p *importer) rawByte() byte { - b := p.data[0] - r := 1 - if b == '|' { - b = p.data[1] - r = 2 - switch b { - case 'S': - b = '$' - case '|': - // nothing to do - default: - errorf("unexpected escape sequence in export data") - } - } - p.data = p.data[r:] - p.read += r - return b - -} - -// ---------------------------------------------------------------------------- -// Export format - -// Tags. Must be < 0. -const ( - // Objects - packageTag = -(iota + 1) - constTag - typeTag - varTag - funcTag - endTag - - // Types - namedTag - arrayTag - sliceTag - dddTag - structTag - pointerTag - signatureTag - interfaceTag - mapTag - chanTag - - // Values - falseTag - trueTag - int64Tag - floatTag - fractionTag // not used by gc - complexTag - stringTag - nilTag // only used by gc (appears in exported inlined function bodies) - unknownTag // not used by gc (only appears in packages with errors) - - // Type aliases - aliasTag -) - var predeclOnce sync.Once var predecl []types.Type // initialized lazily diff --git a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go index a973dece93..b1223713b9 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go @@ -230,20 +230,17 @@ func Import(packages map[string]*types.Package, path, srcDir string, lookup func // Or, define a new standard go/types/gcexportdata package. fset := token.NewFileSet() - // The indexed export format starts with an 'i'; the older - // binary export format starts with a 'c', 'd', or 'v' - // (from "version"). Select appropriate importer. + // Select appropriate importer. if len(data) > 0 { switch data[0] { - case 'i': - _, pkg, err := IImportData(fset, packages, data[1:], id) - return pkg, err + case 'v', 'c', 'd': // binary, till go1.10 + return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) - case 'v', 'c', 'd': - _, pkg, err := BImportData(fset, packages, data, id) + case 'i': // indexed, till go1.19 + _, pkg, err := IImportData(fset, packages, data[1:], id) return pkg, err - case 'u': + case 'u': // unified, from go1.20 _, pkg, err := UImportData(fset, packages, data[1:size], id) return pkg, err diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go index ba53cdcdd1..6103dd7102 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go @@ -22,17 +22,23 @@ import ( "strconv" "strings" + "golang.org/x/tools/go/types/objectpath" "golang.org/x/tools/internal/tokeninternal" "golang.org/x/tools/internal/typeparams" ) // IExportShallow encodes "shallow" export data for the specified package. // -// No promises are made about the encoding other than that it can be -// decoded by the same version of IIExportShallow. If you plan to save -// export data in the file system, be sure to include a cryptographic -// digest of the executable in the key to avoid version skew. -func IExportShallow(fset *token.FileSet, pkg *types.Package) ([]byte, error) { +// No promises are made about the encoding other than that it can be decoded by +// the same version of IIExportShallow. If you plan to save export data in the +// file system, be sure to include a cryptographic digest of the executable in +// the key to avoid version skew. +// +// If the provided reportf func is non-nil, it will be used for reporting bugs +// encountered during export. +// TODO(rfindley): remove reportf when we are confident enough in the new +// objectpath encoding. +func IExportShallow(fset *token.FileSet, pkg *types.Package, reportf ReportFunc) ([]byte, error) { // In principle this operation can only fail if out.Write fails, // but that's impossible for bytes.Buffer---and as a matter of // fact iexportCommon doesn't even check for I/O errors. @@ -44,22 +50,30 @@ func IExportShallow(fset *token.FileSet, pkg *types.Package) ([]byte, error) { return out.Bytes(), err } -// IImportShallow decodes "shallow" types.Package data encoded by IExportShallow -// in the same executable. This function cannot import data from +// IImportShallow decodes "shallow" types.Package data encoded by +// IExportShallow in the same executable. This function cannot import data from // cmd/compile or gcexportdata.Write. -func IImportShallow(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string, insert InsertType) (*types.Package, error) { +// +// The importer calls getPackages to obtain package symbols for all +// packages mentioned in the export data, including the one being +// decoded. +// +// If the provided reportf func is non-nil, it will be used for reporting bugs +// encountered during import. +// TODO(rfindley): remove reportf when we are confident enough in the new +// objectpath encoding. +func IImportShallow(fset *token.FileSet, getPackages GetPackagesFunc, data []byte, path string, reportf ReportFunc) (*types.Package, error) { const bundle = false - pkgs, err := iimportCommon(fset, imports, data, bundle, path, insert) + const shallow = true + pkgs, err := iimportCommon(fset, getPackages, data, bundle, path, shallow, reportf) if err != nil { return nil, err } return pkgs[0], nil } -// InsertType is the type of a function that creates a types.TypeName -// object for a named type and inserts it into the scope of the -// specified Package. -type InsertType = func(pkg *types.Package, name string) +// ReportFunc is the type of a function used to report formatted bugs. +type ReportFunc = func(string, ...interface{}) // Current bundled export format version. Increase with each format change. // 0: initial implementation @@ -313,8 +327,9 @@ type iexporter struct { out *bytes.Buffer version int - shallow bool // don't put types from other packages in the index - localpkg *types.Package // (nil in bundle mode) + shallow bool // don't put types from other packages in the index + objEncoder *objectpath.Encoder // encodes objects from other packages in shallow mode; lazily allocated + localpkg *types.Package // (nil in bundle mode) // allPkgs tracks all packages that have been referenced by // the export data, so we can ensure to include them in the @@ -354,6 +369,17 @@ func (p *iexporter) trace(format string, args ...interface{}) { fmt.Printf(strings.Repeat("..", p.indent)+format+"\n", args...) } +// objectpathEncoder returns the lazily allocated objectpath.Encoder to use +// when encoding objects in other packages during shallow export. +// +// Using a shared Encoder amortizes some of cost of objectpath search. +func (p *iexporter) objectpathEncoder() *objectpath.Encoder { + if p.objEncoder == nil { + p.objEncoder = new(objectpath.Encoder) + } + return p.objEncoder +} + // stringOff returns the offset of s within the string section. // If not already present, it's added to the end. func (p *iexporter) stringOff(s string) uint64 { @@ -413,7 +439,6 @@ type exportWriter struct { p *iexporter data intWriter - currPkg *types.Package prevFile string prevLine int64 prevColumn int64 @@ -436,7 +461,6 @@ func (p *iexporter) doDecl(obj types.Object) { }() } w := p.newWriter() - w.setPkg(obj.Pkg(), false) switch obj := obj.(type) { case *types.Var: @@ -673,6 +697,9 @@ func (w *exportWriter) qualifiedType(obj *types.TypeName) { w.pkg(obj.Pkg()) } +// TODO(rfindley): what does 'pkg' even mean here? It would be better to pass +// it in explicitly into signatures and structs that may use it for +// constructing fields. func (w *exportWriter) typ(t types.Type, pkg *types.Package) { w.data.uint64(w.p.typOff(t, pkg)) } @@ -764,30 +791,53 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { case *types.Signature: w.startType(signatureType) - w.setPkg(pkg, true) + w.pkg(pkg) w.signature(t) case *types.Struct: w.startType(structType) n := t.NumFields() + // Even for struct{} we must emit some qualifying package, because that's + // what the compiler does, and thus that's what the importer expects. + fieldPkg := pkg if n > 0 { - w.setPkg(t.Field(0).Pkg(), true) // qualifying package for field objects - } else { - w.setPkg(pkg, true) + fieldPkg = t.Field(0).Pkg() + } + if fieldPkg == nil { + // TODO(rfindley): improve this very hacky logic. + // + // The importer expects a package to be set for all struct types, even + // those with no fields. A better encoding might be to set NumFields + // before pkg. setPkg panics with a nil package, which may be possible + // to reach with invalid packages (and perhaps valid packages, too?), so + // (arbitrarily) set the localpkg if available. + // + // Alternatively, we may be able to simply guarantee that pkg != nil, by + // reconsidering the encoding of constant values. + if w.p.shallow { + fieldPkg = w.p.localpkg + } else { + panic(internalErrorf("no package to set for empty struct")) + } } + w.pkg(fieldPkg) w.uint64(uint64(n)) + for i := 0; i < n; i++ { f := t.Field(i) + if w.p.shallow { + w.objectPath(f) + } w.pos(f.Pos()) w.string(f.Name()) // unexported fields implicitly qualified by prior setPkg - w.typ(f.Type(), pkg) + w.typ(f.Type(), fieldPkg) w.bool(f.Anonymous()) w.string(t.Tag(i)) // note (or tag) } case *types.Interface: w.startType(interfaceType) - w.setPkg(pkg, true) + w.pkg(pkg) n := t.NumEmbeddeds() w.uint64(uint64(n)) @@ -802,10 +852,16 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { w.typ(ft, tPkg) } + // See comment for struct fields. In shallow mode we change the encoding + // for interface methods that are promoted from other packages. + n = t.NumExplicitMethods() w.uint64(uint64(n)) for i := 0; i < n; i++ { m := t.ExplicitMethod(i) + if w.p.shallow { + w.objectPath(m) + } w.pos(m.Pos()) w.string(m.Name()) sig, _ := m.Type().(*types.Signature) @@ -827,12 +883,61 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) { } } -func (w *exportWriter) setPkg(pkg *types.Package, write bool) { - if write { - w.pkg(pkg) +// objectPath writes the package and objectPath to use to look up obj in a +// different package, when encoding in "shallow" mode. +// +// When doing a shallow import, the importer creates only the local package, +// and requests package symbols for dependencies from the client. +// However, certain types defined in the local package may hold objects defined +// (perhaps deeply) within another package. +// +// For example, consider the following: +// +// package a +// func F() chan * map[string] struct { X int } +// +// package b +// import "a" +// var B = a.F() +// +// In this example, the type of b.B holds fields defined in package a. +// In order to have the correct canonical objects for the field defined in the +// type of B, they are encoded as objectPaths and later looked up in the +// importer. The same problem applies to interface methods. +func (w *exportWriter) objectPath(obj types.Object) { + if obj.Pkg() == nil || obj.Pkg() == w.p.localpkg { + // obj.Pkg() may be nil for the builtin error.Error. + // In this case, or if obj is declared in the local package, no need to + // encode. + w.string("") + return } - - w.currPkg = pkg + objectPath, err := w.p.objectpathEncoder().For(obj) + if err != nil { + // Fall back to the empty string, which will cause the importer to create a + // new object, which matches earlier behavior. Creating a new object is + // sufficient for many purposes (such as type checking), but causes certain + // references algorithms to fail (golang/go#60819). However, we didn't + // notice this problem during months of gopls@v0.12.0 testing. + // + // TODO(golang/go#61674): this workaround is insufficient, as in the case + // where the field forwarded from an instantiated type that may not appear + // in the export data of the original package: + // + // // package a + // type A[P any] struct{ F P } + // + // // package b + // type B a.A[int] + // + // We need to update references algorithms not to depend on this + // de-duplication, at which point we may want to simply remove the + // workaround here. + w.string("") + return + } + w.string(string(objectPath)) + w.pkg(obj.Pkg()) } func (w *exportWriter) signature(sig *types.Signature) { @@ -913,6 +1018,17 @@ func (w *exportWriter) value(typ types.Type, v constant.Value) { w.int64(int64(v.Kind())) } + if v.Kind() == constant.Unknown { + // golang/go#60605: treat unknown constant values as if they have invalid type + // + // This loses some fidelity over the package type-checked from source, but that + // is acceptable. + // + // TODO(rfindley): we should switch on the recorded constant kind rather + // than the constant type + return + } + switch b := typ.Underlying().(*types.Basic); b.Info() & types.IsConstType { case types.IsBoolean: w.bool(constant.BoolVal(v)) @@ -969,6 +1085,16 @@ func constantToFloat(x constant.Value) *big.Float { return &f } +func valueToRat(x constant.Value) *big.Rat { + // Convert little-endian to big-endian. + // I can't believe this is necessary. + bytes := constant.Bytes(x) + for i := 0; i < len(bytes)/2; i++ { + bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i] + } + return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes)) +} + // mpint exports a multi-precision integer. // // For unsigned types, small values are written out as a single @@ -1178,3 +1304,19 @@ func (q *objQueue) popHead() types.Object { q.head++ return obj } + +// internalError represents an error generated inside this package. +type internalError string + +func (e internalError) Error() string { return "gcimporter: " + string(e) } + +// TODO(adonovan): make this call panic, so that it's symmetric with errorf. +// Otherwise it's easy to forget to do anything with the error. +// +// TODO(adonovan): also, consider switching the names "errorf" and +// "internalErrorf" as the former is used for bugs, whose cause is +// internal inconsistency, whereas the latter is used for ordinary +// situations like bad input, whose cause is external. +func internalErrorf(format string, args ...interface{}) error { + return internalError(fmt.Sprintf(format, args...)) +} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go index 448f903e86..8e64cf644f 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go @@ -21,6 +21,7 @@ import ( "sort" "strings" + "golang.org/x/tools/go/types/objectpath" "golang.org/x/tools/internal/typeparams" ) @@ -85,7 +86,7 @@ const ( // If the export data version is not recognized or the format is otherwise // compromised, an error is returned. func IImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (int, *types.Package, error) { - pkgs, err := iimportCommon(fset, imports, data, false, path, nil) + pkgs, err := iimportCommon(fset, GetPackagesFromMap(imports), data, false, path, false, nil) if err != nil { return 0, nil, err } @@ -94,10 +95,49 @@ func IImportData(fset *token.FileSet, imports map[string]*types.Package, data [] // IImportBundle imports a set of packages from the serialized package bundle. func IImportBundle(fset *token.FileSet, imports map[string]*types.Package, data []byte) ([]*types.Package, error) { - return iimportCommon(fset, imports, data, true, "", nil) + return iimportCommon(fset, GetPackagesFromMap(imports), data, true, "", false, nil) } -func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data []byte, bundle bool, path string, insert InsertType) (pkgs []*types.Package, err error) { +// A GetPackagesFunc function obtains the non-nil symbols for a set of +// packages, creating and recursively importing them as needed. An +// implementation should store each package symbol is in the Pkg +// field of the items array. +// +// Any error causes importing to fail. This can be used to quickly read +// the import manifest of an export data file without fully decoding it. +type GetPackagesFunc = func(items []GetPackagesItem) error + +// A GetPackagesItem is a request from the importer for the package +// symbol of the specified name and path. +type GetPackagesItem struct { + Name, Path string + Pkg *types.Package // to be filled in by GetPackagesFunc call + + // private importer state + pathOffset uint64 + nameIndex map[string]uint64 +} + +// GetPackagesFromMap returns a GetPackagesFunc that retrieves +// packages from the given map of package path to package. +// +// The returned function may mutate m: each requested package that is not +// found is created with types.NewPackage and inserted into m. +func GetPackagesFromMap(m map[string]*types.Package) GetPackagesFunc { + return func(items []GetPackagesItem) error { + for i, item := range items { + pkg, ok := m[item.Path] + if !ok { + pkg = types.NewPackage(item.Path, item.Name) + m[item.Path] = pkg + } + items[i].Pkg = pkg + } + return nil + } +} + +func iimportCommon(fset *token.FileSet, getPackages GetPackagesFunc, data []byte, bundle bool, path string, shallow bool, reportf ReportFunc) (pkgs []*types.Package, err error) { const currentVersion = iexportVersionCurrent version := int64(-1) if !debug { @@ -108,7 +148,7 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data } else if version > currentVersion { err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e) } else { - err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e) + err = fmt.Errorf("internal error while importing %q (%v); please report an issue", path, e) } } }() @@ -117,11 +157,8 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data r := &intReader{bytes.NewReader(data), path} if bundle { - bundleVersion := r.uint64() - switch bundleVersion { - case bundleVersion: - default: - errorf("unknown bundle format version %d", bundleVersion) + if v := r.uint64(); v != bundleVersion { + errorf("unknown bundle format version %d", v) } } @@ -139,7 +176,7 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data sLen := int64(r.uint64()) var fLen int64 var fileOffset []uint64 - if insert != nil { + if shallow { // Shallow mode uses a different position encoding. fLen = int64(r.uint64()) fileOffset = make([]uint64, r.uint64()) @@ -158,7 +195,8 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data p := iimporter{ version: int(version), ipath: path, - insert: insert, + shallow: shallow, + reportf: reportf, stringData: stringData, stringCache: make(map[uint64]string), @@ -185,8 +223,9 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data p.typCache[uint64(i)] = pt } - pkgList := make([]*types.Package, r.uint64()) - for i := range pkgList { + // Gather the relevant packages from the manifest. + items := make([]GetPackagesItem, r.uint64()) + for i := range items { pkgPathOff := r.uint64() pkgPath := p.stringAt(pkgPathOff) pkgName := p.stringAt(r.uint64()) @@ -195,30 +234,42 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data if pkgPath == "" { pkgPath = path } - pkg := imports[pkgPath] - if pkg == nil { - pkg = types.NewPackage(pkgPath, pkgName) - imports[pkgPath] = pkg - } else if pkg.Name() != pkgName { - errorf("conflicting names %s and %s for package %q", pkg.Name(), pkgName, path) - } - if i == 0 && !bundle { - p.localpkg = pkg - } - - p.pkgCache[pkgPathOff] = pkg + items[i].Name = pkgName + items[i].Path = pkgPath + items[i].pathOffset = pkgPathOff // Read index for package. nameIndex := make(map[string]uint64) nSyms := r.uint64() - // In shallow mode we don't expect an index for other packages. - assert(nSyms == 0 || p.localpkg == pkg || p.insert == nil) + // In shallow mode, only the current package (i=0) has an index. + assert(!(shallow && i > 0 && nSyms != 0)) for ; nSyms > 0; nSyms-- { name := p.stringAt(r.uint64()) nameIndex[name] = r.uint64() } - p.pkgIndex[pkg] = nameIndex + items[i].nameIndex = nameIndex + } + + // Request packages all at once from the client, + // enabling a parallel implementation. + if err := getPackages(items); err != nil { + return nil, err // don't wrap this error + } + + // Check the results and complete the index. + pkgList := make([]*types.Package, len(items)) + for i, item := range items { + pkg := item.Pkg + if pkg == nil { + errorf("internal error: getPackages returned nil package for %q", item.Path) + } else if pkg.Path() != item.Path { + errorf("internal error: getPackages returned wrong path %q, want %q", pkg.Path(), item.Path) + } else if pkg.Name() != item.Name { + errorf("internal error: getPackages returned wrong name %s for package %q, want %s", pkg.Name(), item.Path, item.Name) + } + p.pkgCache[item.pathOffset] = pkg + p.pkgIndex[pkg] = item.nameIndex pkgList[i] = pkg } @@ -277,6 +328,13 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data typ.Complete() } + // Workaround for golang/go#61561. See the doc for instanceList for details. + for _, typ := range p.instanceList { + if iface, _ := typ.Underlying().(*types.Interface); iface != nil { + iface.Complete() + } + } + return pkgs, nil } @@ -289,8 +347,8 @@ type iimporter struct { version int ipath string - localpkg *types.Package - insert func(pkg *types.Package, name string) // "shallow" mode only + shallow bool + reportf ReportFunc // if non-nil, used to report bugs stringData []byte stringCache map[uint64]string @@ -307,6 +365,12 @@ type iimporter struct { fake fakeFileSet interfaceList []*types.Interface + // Workaround for the go/types bug golang/go#61561: instances produced during + // instantiation may contain incomplete interfaces. Here we only complete the + // underlying type of the instance, which is the most common case but doesn't + // handle parameterized interface literals defined deeper in the type. + instanceList []types.Type // instances for later completion (see golang/go#61561) + // Arguments for calls to SetConstraint that are deferred due to recursive types later []setConstraintArgs @@ -338,13 +402,9 @@ func (p *iimporter) doDecl(pkg *types.Package, name string) { off, ok := p.pkgIndex[pkg][name] if !ok { - // In "shallow" mode, call back to the application to - // find the object and insert it into the package scope. - if p.insert != nil { - assert(pkg != p.localpkg) - p.insert(pkg, name) // "can't fail" - return - } + // In deep mode, the index should be complete. In shallow + // mode, we should have already recursively loaded necessary + // dependencies so the above Lookup succeeds. errorf("%v.%v not in index", pkg, name) } @@ -711,7 +771,8 @@ func (r *importReader) qualifiedIdent() (*types.Package, string) { } func (r *importReader) pos() token.Pos { - if r.p.insert != nil { // shallow mode + if r.p.shallow { + // precise offsets are encoded only in shallow mode return r.posv2() } if r.p.version >= iexportVersionPosCol { @@ -812,13 +873,28 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { fields := make([]*types.Var, r.uint64()) tags := make([]string, len(fields)) for i := range fields { + var field *types.Var + if r.p.shallow { + field, _ = r.objectPathObject().(*types.Var) + } + fpos := r.pos() fname := r.ident() ftyp := r.typ() emb := r.bool() tag := r.string() - fields[i] = types.NewField(fpos, r.currPkg, fname, ftyp, emb) + // Either this is not a shallow import, the field is local, or the + // encoded objectPath failed to produce an object (a bug). + // + // Even in this last, buggy case, fall back on creating a new field. As + // discussed in iexport.go, this is not correct, but mostly works and is + // preferable to failing (for now at least). + if field == nil { + field = types.NewField(fpos, r.currPkg, fname, ftyp, emb) + } + + fields[i] = field tags[i] = tag } return types.NewStruct(fields, tags) @@ -834,6 +910,11 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { methods := make([]*types.Func, r.uint64()) for i := range methods { + var method *types.Func + if r.p.shallow { + method, _ = r.objectPathObject().(*types.Func) + } + mpos := r.pos() mname := r.ident() @@ -843,9 +924,12 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { if base != nil { recv = types.NewVar(token.NoPos, r.currPkg, "", base) } - msig := r.signature(recv, nil, nil) - methods[i] = types.NewFunc(mpos, r.currPkg, mname, msig) + + if method == nil { + method = types.NewFunc(mpos, r.currPkg, mname, msig) + } + methods[i] = method } typ := newInterface(methods, embeddeds) @@ -883,6 +967,9 @@ func (r *importReader) doType(base *types.Named) (res types.Type) { // we must always use the methods of the base (orig) type. // TODO provide a non-nil *Environment t, _ := typeparams.Instantiate(nil, baseType, targs, false) + + // Workaround for golang/go#61561. See the doc for instanceList for details. + r.p.instanceList = append(r.p.instanceList, t) return t case unionType: @@ -901,6 +988,26 @@ func (r *importReader) kind() itag { return itag(r.uint64()) } +// objectPathObject is the inverse of exportWriter.objectPath. +// +// In shallow mode, certain fields and methods may need to be looked up in an +// imported package. See the doc for exportWriter.objectPath for a full +// explanation. +func (r *importReader) objectPathObject() types.Object { + objPath := objectpath.Path(r.string()) + if objPath == "" { + return nil + } + pkg := r.pkg() + obj, err := objectpath.Object(pkg, objPath) + if err != nil { + if r.p.reportf != nil { + r.p.reportf("failed to find object for objectPath %q: %v", objPath, err) + } + } + return obj +} + func (r *importReader) signature(recv *types.Var, rparams []*typeparams.TypeParam, tparams []*typeparams.TypeParam) *types.Signature { params := r.paramList() results := r.paramList() diff --git a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go index 34fc783f82..b977435f62 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go @@ -10,6 +10,7 @@ package gcimporter import ( + "fmt" "go/token" "go/types" "sort" @@ -63,6 +64,14 @@ type typeInfo struct { } func UImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) { + if !debug { + defer func() { + if x := recover(); x != nil { + err = fmt.Errorf("internal error in importing %q (%v); please report an issue", path, x) + } + }() + } + s := string(data) s = s[:strings.LastIndex(s, "\n$$\n")] input := pkgbits.NewPkgDecoder(path, s) diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go index d50551693f..53cf66da01 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go +++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go @@ -8,10 +8,12 @@ package gocommand import ( "bytes" "context" + "errors" "fmt" "io" "log" "os" + "reflect" "regexp" "runtime" "strconv" @@ -22,6 +24,9 @@ import ( exec "golang.org/x/sys/execabs" "golang.org/x/tools/internal/event" + "golang.org/x/tools/internal/event/keys" + "golang.org/x/tools/internal/event/label" + "golang.org/x/tools/internal/event/tag" ) // An Runner will run go command invocations and serialize @@ -51,9 +56,19 @@ func (runner *Runner) initialize() { // 1.14: go: updating go.mod: existing contents have changed since last read var modConcurrencyError = regexp.MustCompile(`go:.*go.mod.*contents have changed`) +// verb is an event label for the go command verb. +var verb = keys.NewString("verb", "go command verb") + +func invLabels(inv Invocation) []label.Label { + return []label.Label{verb.Of(inv.Verb), tag.Directory.Of(inv.WorkingDir)} +} + // Run is a convenience wrapper around RunRaw. // It returns only stdout and a "friendly" error. func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.Run", invLabels(inv)...) + defer done() + stdout, _, friendly, _ := runner.RunRaw(ctx, inv) return stdout, friendly } @@ -61,6 +76,9 @@ func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, e // RunPiped runs the invocation serially, always waiting for any concurrent // invocations to complete first. func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) error { + ctx, done := event.Start(ctx, "gocommand.Runner.RunPiped", invLabels(inv)...) + defer done() + _, err := runner.runPiped(ctx, inv, stdout, stderr) return err } @@ -68,6 +86,8 @@ func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stde // RunRaw runs the invocation, serializing requests only if they fight over // go.mod changes. func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.RunRaw", invLabels(inv)...) + defer done() // Make sure the runner is always initialized. runner.initialize() @@ -215,6 +235,18 @@ func (i *Invocation) run(ctx context.Context, stdout, stderr io.Writer) error { cmd := exec.Command("go", goArgs...) cmd.Stdout = stdout cmd.Stderr = stderr + + // cmd.WaitDelay was added only in go1.20 (see #50436). + if waitDelay := reflect.ValueOf(cmd).Elem().FieldByName("WaitDelay"); waitDelay.IsValid() { + // https://go.dev/issue/59541: don't wait forever copying stderr + // after the command has exited. + // After CL 484741 we copy stdout manually, so we we'll stop reading that as + // soon as ctx is done. However, we also don't want to wait around forever + // for stderr. Give a much-longer-than-reasonable delay and then assume that + // something has wedged in the kernel or runtime. + waitDelay.Set(reflect.ValueOf(30 * time.Second)) + } + // On darwin the cwd gets resolved to the real path, which breaks anything that // expects the working directory to keep the original path, including the // go command when dealing with modules. @@ -229,6 +261,7 @@ func (i *Invocation) run(ctx context.Context, stdout, stderr io.Writer) error { cmd.Env = append(cmd.Env, "PWD="+i.WorkingDir) cmd.Dir = i.WorkingDir } + defer func(start time.Time) { log("%s for %v", time.Since(start), cmdDebugStr(cmd)) }(time.Now()) return runCmdContext(ctx, cmd) @@ -242,10 +275,85 @@ var DebugHangingGoCommands = false // runCmdContext is like exec.CommandContext except it sends os.Interrupt // before os.Kill. -func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { - if err := cmd.Start(); err != nil { +func runCmdContext(ctx context.Context, cmd *exec.Cmd) (err error) { + // If cmd.Stdout is not an *os.File, the exec package will create a pipe and + // copy it to the Writer in a goroutine until the process has finished and + // either the pipe reaches EOF or command's WaitDelay expires. + // + // However, the output from 'go list' can be quite large, and we don't want to + // keep reading (and allocating buffers) if we've already decided we don't + // care about the output. We don't want to wait for the process to finish, and + // we don't wait to wait for the WaitDelay to expire either. + // + // Instead, if cmd.Stdout requires a copying goroutine we explicitly replace + // it with a pipe (which is an *os.File), which we can close in order to stop + // copying output as soon as we realize we don't care about it. + var stdoutW *os.File + if cmd.Stdout != nil { + if _, ok := cmd.Stdout.(*os.File); !ok { + var stdoutR *os.File + stdoutR, stdoutW, err = os.Pipe() + if err != nil { + return err + } + prevStdout := cmd.Stdout + cmd.Stdout = stdoutW + + stdoutErr := make(chan error, 1) + go func() { + _, err := io.Copy(prevStdout, stdoutR) + if err != nil { + err = fmt.Errorf("copying stdout: %w", err) + } + stdoutErr <- err + }() + defer func() { + // We started a goroutine to copy a stdout pipe. + // Wait for it to finish, or terminate it if need be. + var err2 error + select { + case err2 = <-stdoutErr: + stdoutR.Close() + case <-ctx.Done(): + stdoutR.Close() + // Per https://pkg.go.dev/os#File.Close, the call to stdoutR.Close + // should cause the Read call in io.Copy to unblock and return + // immediately, but we still need to receive from stdoutErr to confirm + // that it has happened. + <-stdoutErr + err2 = ctx.Err() + } + if err == nil { + err = err2 + } + }() + + // Per https://pkg.go.dev/os/exec#Cmd, “If Stdout and Stderr are the + // same writer, and have a type that can be compared with ==, at most + // one goroutine at a time will call Write.” + // + // Since we're starting a goroutine that writes to cmd.Stdout, we must + // also update cmd.Stderr so that it still holds. + func() { + defer func() { recover() }() + if cmd.Stderr == prevStdout { + cmd.Stderr = cmd.Stdout + } + }() + } + } + + err = cmd.Start() + if stdoutW != nil { + // The child process has inherited the pipe file, + // so close the copy held in this process. + stdoutW.Close() + stdoutW = nil + } + if err != nil { return err } + resChan := make(chan error, 1) go func() { resChan <- cmd.Wait() @@ -253,11 +361,14 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { // If we're interested in debugging hanging Go commands, stop waiting after a // minute and panic with interesting information. - if DebugHangingGoCommands { + debug := DebugHangingGoCommands + if debug { + timer := time.NewTimer(1 * time.Minute) + defer timer.Stop() select { case err := <-resChan: return err - case <-time.After(1 * time.Minute): + case <-timer.C: HandleHangingGoCommand(cmd.Process) case <-ctx.Done(): } @@ -270,30 +381,25 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { } // Cancelled. Interrupt and see if it ends voluntarily. - cmd.Process.Signal(os.Interrupt) - select { - case err := <-resChan: - return err - case <-time.After(time.Second): + if err := cmd.Process.Signal(os.Interrupt); err == nil { + // (We used to wait only 1s but this proved + // fragile on loaded builder machines.) + timer := time.NewTimer(5 * time.Second) + defer timer.Stop() + select { + case err := <-resChan: + return err + case <-timer.C: + } } // Didn't shut down in response to interrupt. Kill it hard. // TODO(rfindley): per advice from bcmills@, it may be better to send SIGQUIT // on certain platforms, such as unix. - if err := cmd.Process.Kill(); err != nil && DebugHangingGoCommands { - // Don't panic here as this reliably fails on windows with EINVAL. + if err := cmd.Process.Kill(); err != nil && !errors.Is(err, os.ErrProcessDone) && debug { log.Printf("error killing the Go command: %v", err) } - // See above: don't wait indefinitely if we're debugging hanging Go commands. - if DebugHangingGoCommands { - select { - case err := <-resChan: - return err - case <-time.After(10 * time.Second): // a shorter wait as resChan should return quickly following Kill - HandleHangingGoCommand(cmd.Process) - } - } return <-resChan } diff --git a/vendor/golang.org/x/tools/internal/gocommand/version.go b/vendor/golang.org/x/tools/internal/gocommand/version.go index 307a76d474..446c5846a6 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/version.go +++ b/vendor/golang.org/x/tools/internal/gocommand/version.go @@ -23,21 +23,11 @@ import ( func GoVersion(ctx context.Context, inv Invocation, r *Runner) (int, error) { inv.Verb = "list" inv.Args = []string{"-e", "-f", `{{context.ReleaseTags}}`, `--`, `unsafe`} - inv.Env = append(append([]string{}, inv.Env...), "GO111MODULE=off") - // Unset any unneeded flags, and remove them from BuildFlags, if they're - // present. - inv.ModFile = "" + inv.BuildFlags = nil // This is not a build command. inv.ModFlag = "" - var buildFlags []string - for _, flag := range inv.BuildFlags { - // Flags can be prefixed by one or two dashes. - f := strings.TrimPrefix(strings.TrimPrefix(flag, "-"), "-") - if strings.HasPrefix(f, "mod=") || strings.HasPrefix(f, "modfile=") { - continue - } - buildFlags = append(buildFlags, flag) - } - inv.BuildFlags = buildFlags + inv.ModFile = "" + inv.Env = append(inv.Env[:len(inv.Env):len(inv.Env)], "GO111MODULE=off") + stdoutBytes, err := r.Run(ctx, inv) if err != nil { return 0, err diff --git a/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go index a3fb2d4f29..7e638ec24f 100644 --- a/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go +++ b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go @@ -7,7 +7,9 @@ package tokeninternal import ( + "fmt" "go/token" + "sort" "sync" "unsafe" ) @@ -57,3 +59,93 @@ func GetLines(file *token.File) []int { panic("unexpected token.File size") } } + +// AddExistingFiles adds the specified files to the FileSet if they +// are not already present. It panics if any pair of files in the +// resulting FileSet would overlap. +func AddExistingFiles(fset *token.FileSet, files []*token.File) { + // Punch through the FileSet encapsulation. + type tokenFileSet struct { + // This type remained essentially consistent from go1.16 to go1.21. + mutex sync.RWMutex + base int + files []*token.File + _ *token.File // changed to atomic.Pointer[token.File] in go1.19 + } + + // If the size of token.FileSet changes, this will fail to compile. + const delta = int64(unsafe.Sizeof(tokenFileSet{})) - int64(unsafe.Sizeof(token.FileSet{})) + var _ [-delta * delta]int + + type uP = unsafe.Pointer + var ptr *tokenFileSet + *(*uP)(uP(&ptr)) = uP(fset) + ptr.mutex.Lock() + defer ptr.mutex.Unlock() + + // Merge and sort. + newFiles := append(ptr.files, files...) + sort.Slice(newFiles, func(i, j int) bool { + return newFiles[i].Base() < newFiles[j].Base() + }) + + // Reject overlapping files. + // Discard adjacent identical files. + out := newFiles[:0] + for i, file := range newFiles { + if i > 0 { + prev := newFiles[i-1] + if file == prev { + continue + } + if prev.Base()+prev.Size()+1 > file.Base() { + panic(fmt.Sprintf("file %s (%d-%d) overlaps with file %s (%d-%d)", + prev.Name(), prev.Base(), prev.Base()+prev.Size(), + file.Name(), file.Base(), file.Base()+file.Size())) + } + } + out = append(out, file) + } + newFiles = out + + ptr.files = newFiles + + // Advance FileSet.Base(). + if len(newFiles) > 0 { + last := newFiles[len(newFiles)-1] + newBase := last.Base() + last.Size() + 1 + if ptr.base < newBase { + ptr.base = newBase + } + } +} + +// FileSetFor returns a new FileSet containing a sequence of new Files with +// the same base, size, and line as the input files, for use in APIs that +// require a FileSet. +// +// Precondition: the input files must be non-overlapping, and sorted in order +// of their Base. +func FileSetFor(files ...*token.File) *token.FileSet { + fset := token.NewFileSet() + for _, f := range files { + f2 := fset.AddFile(f.Name(), f.Base(), f.Size()) + lines := GetLines(f) + f2.SetLines(lines) + } + return fset +} + +// CloneFileSet creates a new FileSet holding all files in fset. It does not +// create copies of the token.Files in fset: they are added to the resulting +// FileSet unmodified. +func CloneFileSet(fset *token.FileSet) *token.FileSet { + var files []*token.File + fset.Iterate(func(f *token.File) bool { + files = append(files, f) + return true + }) + newFileSet := token.NewFileSet() + AddExistingFiles(newFileSet, files) + return newFileSet +} diff --git a/vendor/golang.org/x/tools/internal/typeparams/common.go b/vendor/golang.org/x/tools/internal/typeparams/common.go index cfba8189f1..d0d0649fe2 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/common.go +++ b/vendor/golang.org/x/tools/internal/typeparams/common.go @@ -23,6 +23,7 @@ package typeparams import ( + "fmt" "go/ast" "go/token" "go/types" @@ -105,6 +106,31 @@ func OriginMethod(fn *types.Func) *types.Func { } orig := NamedTypeOrigin(named) gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name()) + + // This is a fix for a gopls crash (#60628) due to a go/types bug (#60634). In: + // package p + // type T *int + // func (*T) f() {} + // LookupFieldOrMethod(T, true, p, f)=nil, but NewMethodSet(*T)={(*T).f}. + // Here we make them consistent by force. + // (The go/types bug is general, but this workaround is reached only + // for generic T thanks to the early return above.) + if gfn == nil { + mset := types.NewMethodSet(types.NewPointer(orig)) + for i := 0; i < mset.Len(); i++ { + m := mset.At(i) + if m.Obj().Id() == fn.Id() { + gfn = m.Obj() + break + } + } + } + + // In golang/go#61196, we observe another crash, this time inexplicable. + if gfn == nil { + panic(fmt.Sprintf("missing origin method for %s.%s; named == origin: %t, named.NumMethods(): %d, origin.NumMethods(): %d", named, fn, named == orig, named.NumMethods(), orig.NumMethods())) + } + return gfn.(*types.Func) } diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go index b4788978ff..7ed86e1711 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go +++ b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go @@ -129,7 +129,7 @@ func NamedTypeArgs(*types.Named) *TypeList { } // NamedTypeOrigin is the identity method at this Go version. -func NamedTypeOrigin(named *types.Named) types.Type { +func NamedTypeOrigin(named *types.Named) *types.Named { return named } diff --git a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go index 114a36b866..cf301af1db 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go +++ b/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go @@ -103,7 +103,7 @@ func NamedTypeArgs(named *types.Named) *TypeList { } // NamedTypeOrigin returns named.Orig(). -func NamedTypeOrigin(named *types.Named) types.Type { +func NamedTypeOrigin(named *types.Named) *types.Named { return named.Origin() } diff --git a/vendor/golang.org/x/tools/internal/typesinternal/types.go b/vendor/golang.org/x/tools/internal/typesinternal/types.go index 3c53fbc63b..66e8b099bd 100644 --- a/vendor/golang.org/x/tools/internal/typesinternal/types.go +++ b/vendor/golang.org/x/tools/internal/typesinternal/types.go @@ -53,9 +53,16 @@ func ReadGo116ErrorData(err types.Error) (code ErrorCode, start, end token.Pos, var SetGoVersion = func(conf *types.Config, version string) bool { return false } -// NewObjectpathEncoder returns a function closure equivalent to -// objectpath.For but amortized for multiple (sequential) calls. -// It is a temporary workaround, pending the approval of proposal 58668. +// SkipEncoderMethodSorting marks the encoder as not requiring sorted methods, +// as an optimization for gopls (which guarantees the order of parsed source files). // -//go:linkname NewObjectpathFunc golang.org/x/tools/go/types/objectpath.newEncoderFor -func NewObjectpathFunc() func(types.Object) (objectpath.Path, error) +// TODO(golang/go#61443): eliminate this parameter one way or the other. +// +//go:linkname SkipEncoderMethodSorting golang.org/x/tools/go/types/objectpath.skipMethodSorting +func SkipEncoderMethodSorting(enc *objectpath.Encoder) + +// ObjectpathObject is like objectpath.Object, but allows suppressing method +// sorting (which is not necessary for gopls). +// +//go:linkname ObjectpathObject golang.org/x/tools/go/types/objectpath.object +func ObjectpathObject(pkg *types.Package, p objectpath.Path, skipMethodSorting bool) (types.Object, error) diff --git a/vendor/modules.txt b/vendor/modules.txt index 327d616d74..11656775be 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -390,7 +390,7 @@ go.uber.org/zap/internal/color go.uber.org/zap/internal/exit go.uber.org/zap/zapcore go.uber.org/zap/zapgrpc -# golang.org/x/crypto v0.1.0 +# golang.org/x/crypto v0.12.0 ## explicit; go 1.17 golang.org/x/crypto/blowfish golang.org/x/crypto/chacha20 @@ -405,10 +405,10 @@ golang.org/x/crypto/nacl/secretbox golang.org/x/crypto/salsa20/salsa golang.org/x/crypto/ssh golang.org/x/crypto/ssh/internal/bcrypt_pbkdf -# golang.org/x/mod v0.9.0 +# golang.org/x/mod v0.12.0 ## explicit; go 1.17 golang.org/x/mod/semver -# golang.org/x/net v0.8.0 +# golang.org/x/net v0.14.0 ## explicit; go 1.17 golang.org/x/net/bpf golang.org/x/net/context @@ -432,10 +432,10 @@ golang.org/x/net/websocket ## explicit; go 1.17 golang.org/x/oauth2 golang.org/x/oauth2/internal -# golang.org/x/sync v0.1.0 -## explicit +# golang.org/x/sync v0.3.0 +## explicit; go 1.17 golang.org/x/sync/singleflight -# golang.org/x/sys v0.6.0 +# golang.org/x/sys v0.11.0 ## explicit; go 1.17 golang.org/x/sys/cpu golang.org/x/sys/execabs @@ -444,10 +444,10 @@ golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows golang.org/x/sys/windows/registry -# golang.org/x/term v0.6.0 +# golang.org/x/term v0.11.0 ## explicit; go 1.17 golang.org/x/term -# golang.org/x/text v0.8.0 +# golang.org/x/text v0.12.0 ## explicit; go 1.17 golang.org/x/text/encoding golang.org/x/text/encoding/charmap @@ -473,7 +473,7 @@ golang.org/x/text/width # golang.org/x/time v0.3.0 ## explicit golang.org/x/time/rate -# golang.org/x/tools v0.7.0 +# golang.org/x/tools v0.12.0 ## explicit; go 1.18 golang.org/x/tools/go/ast/inspector golang.org/x/tools/go/gcexportdata @@ -484,6 +484,7 @@ golang.org/x/tools/internal/event golang.org/x/tools/internal/event/core golang.org/x/tools/internal/event/keys golang.org/x/tools/internal/event/label +golang.org/x/tools/internal/event/tag golang.org/x/tools/internal/gcimporter golang.org/x/tools/internal/gocommand golang.org/x/tools/internal/packagesinternal