Skip to content

Latest commit

 

History

42 Commits

Folders and files

NameName
Last commit message
Last commit date
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation


AbLang: A language model for antibodies

DOI:10.1101/2022.01.20.477061

Motivation: General protein language models have been shown to summarize the semantics of protein sequences into representations that are useful for state-of-the-art predictive methods. However, for antibody specific problems, such as restoring residues lost due to sequencing errors, a model trained solely on antibodies may be more powerful. Antibodies are one of the few protein types where the volume of sequence data needed for such language models is available, e.g. in the Observed Antibody Space (OAS) database.

Results: Here, we introduce AbLang, a language model trained on the antibody sequences in the OAS database. We demonstrate the power of AbLang by using it to restore missing residues in antibody sequence data, a key issue with B-cell receptor repertoire sequencing, e.g. over 40% of OAS sequences are missing the first 15 amino acids. AbLang restores the missing residues of antibody sequences better than using IMGT germlines or the general protein language model ESM-1b. Further, AbLang does not require knowledge of the germline of the antibody and is seven times faster than ESM-1b.

Availability and implementation: AbLang is a python package available at https://github.com/oxpig/AbLang.


Install AbLang

AbLang is freely available and can be installed with pip.

    pip install ablang

or directly from github.

    pip install -U git+https://github.com/oxpig/AbLang.git

NB: If you use the argument "align=True", you need to manually install a version of ANARCI in the same environment. ANARCI can also be installed using bioconda; however, this version is maintained by a third party.

    conda install -c bioconda anarci

AbLang use cases

A Jupyter notebook showing the different use cases of AbLang and its building blocks can be found here.

Currently, AbLang can be used to generate three different representations/encodings for antibody sequences.

  1. Res-codings: These encodings are 768 values for each residue, useful for residue specific predictions.

  2. Seq-codings: These encodings are 768 values for each sequence, useful for sequence specific predictions. The same length of encodings for each sequence, means these encodings also removes the need to align antibody sequences.

  3. Res-likelihoods: These encodings are the likelihoods of each amino acid at each position in a given antibody sequence, useful for exploring possible mutations. The order of amino acids follows the ablang vocabulary.

These representations can be used for a plethora of antibody design applications. As an example, we have used the res-likelihoods from AbLang to restore missing residues in antibody sequences due either to sequencing errors, such as ambiguous bases, or the limitations of the sequencing techniques used.

Antibody sequence restoration

Restoration of antibody sequences can be done using the "restore" mode as seen below.

import ablang

heavy_ablang = ablang.pretrained("heavy") # Use "light" if you are working with light chains
heavy_ablang.freeze()


seqs = [
    'EV*LVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
    '*************PGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNK*YADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTL*****',
]

heavy_ablang(seqs, mode='restore')

The output of the above is seen below.

array(['EVQLVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
       'QVQLVESGGGVVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS'],
      dtype='<U121')

For restoration of an unknown number of missing residues at the ends of antibody sequences, the "align" parameter can be set to True.

seqs = [
    'EV*LVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
    'PGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNK*YADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTL',
]

heavy_ablang(seqs, mode='restore', align=True)

The output of the above is seen below.

array(['EVQLVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
       'QVQLVESGGGVVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS'],
      dtype='<U121')

Citation

@article{Olsen2022,
  title={AbLang: An antibody language model for completing antibody sequences},
  author={Tobias H. Olsen, Iain H. Moal and Charlotte M. Deane},
  journal={bioRxiv},
  doi={https://doi.org/10.1101/2022.01.20.477061},
  year={2022}
}

About

AbLang: A language model for antibodies

Topics

Resources

Stars

171 stars

Watchers

3 watching

Forks

Releases

Packages

Used by

Contributors

Languages