Skip to content
Permalink
Browse files

[sextante] added OTB algorithms to simplified list

  • Loading branch information
volaya committed Apr 27, 2013
1 parent 6fc81e8 commit 345c14505ead529e0d7c1a60a00585eb6b9fb58f
Showing with 81 additions and 4 deletions.
  1. +81 −4 python/plugins/sextante/gui/help/algclasssification.txt
@@ -5,12 +5,89 @@ gdalogr:merge,USE_ORIGINAL_NAME,Raster/General tools
gdalogr:nearblack,USE_ORIGINAL_NAME,Raster/Analysis
gdalogr:ogr2ogr,Export vector layer,Vector/General tools
gdalogr:ogrinfo,Vector layer information,Vector/Statistics
gdalogr:pct2rgb,USE_ORIGINAL_NAME,Images/Image tools
gdalogr:pct2rgb,PCT to RGB,Images/Image Manipulation
gdalogr:proximity,USE_ORIGINAL_NAME,Raster/Analysis
gdalogr:rgb2pct,USE_ORIGINAL_NAME,Images/Image tools
gdalogr:rgb2pct,RGB to PCT,Images/Image Manipulation
gdalogr:sieve,Remove small pixel clumps (nearest neighbour),Raster/Edition
gdalogr:translateconvertformat,Export raster layer,Raster/General tools
gdalogr:warpreproject,Reproject raster layer,Raster/General tools
otb:bandmath,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:binarymorphologicaloperation,USE_ORIGINAL_NAME,Images/Image Filtering
otb:bundletoperfectsensor,USE_ORIGINAL_NAME,Images/Geometry
otb:cartographictogeographiccoordinatesconversion,USE_ORIGINAL_NAME,Images/Geometry
otb:classificationregularization,USE_ORIGINAL_NAME,Images/Learning
otb:colormapping,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:computeconfusionmatrix,USE_ORIGINAL_NAME,Images/Learning
otb:computeimagessecondorderstatistics,USE_ORIGINAL_NAME,Images/Learning
otb:computepolylinefeaturefromimage,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:concatenate,USE_ORIGINAL_NAME,Images/Vector Data Manipulation
otb:connectedcomponentsegmentation,USE_ORIGINAL_NAME,Images/Segmentation
otb:convertsensorpointtogeographicpoint,USE_ORIGINAL_NAME,Images/Geometry
otb:dimensionalityreductionapplication,USE_ORIGINAL_NAME,Images/Image Filtering
otb:disparitymaptoelevationmap,USE_ORIGINAL_NAME,Images/Stereo
otb:edgeextraction,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:edisonmeanshiftsegmentationlabeledrasteroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:edisonmeanshiftsegmentationlargescalevectoroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:extractroi,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:fineregistration,USE_ORIGINAL_NAME,Images/Stereo
otb:fusionofclassifications,USE_ORIGINAL_NAME,Images/Learning
otb:fuzzymodelestimation,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:grayscalemorphologicaloperation,USE_ORIGINAL_NAME,Images/Image Filtering
otb:gridbasedimageresampling,USE_ORIGINAL_NAME,Images/Geometry
otb:haralicktextureextraction,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:hoovercomparesegmentation,USE_ORIGINAL_NAME,Images/Segmentation
otb:hyperspectraldataunmixing,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:imageconversion,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:imageenvelope,USE_ORIGINAL_NAME,Images/Geometry
otb:imageresamplingwitharigidtransform,USE_ORIGINAL_NAME,Images/Geometry
otb:imagescomparaison,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:imagesconcatenation,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:imagesvmclassification,USE_ORIGINAL_NAME,Images/Learning
otb:imagetokmzexport,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:linesegmentdetection,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:localstatisticextraction,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:maximumautocorrelationfactordecomposition,USE_ORIGINAL_NAME,Images/Image Filtering
otb:meanshiftfiltering,USE_ORIGINAL_NAME,Images/Image Filtering
otb:meanshiftsegmentationlabeledrasteroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:meanshiftsegmentationlargescalevectoroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:morphologicalprofilesbasedsegmentationlabeledrasteroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:morphologicalprofilesbasedsegmentationlargescalevectoroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:multiresolutionpyramid,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:multivariatealterationdetector,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:obtainutmzonefromgeopoint,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:openstreetmaplayersimportationsapplications,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:opticalcalibration,USE_ORIGINAL_NAME,Images/Calibration
otb:orthorectification,USE_ORIGINAL_NAME,Images/Geometry
otb:pansharpening,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:pixelvalue,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:pixelwiseblockmatching,USE_ORIGINAL_NAME,Images/Stereo
otb:pixelwiseblockmatching,USE_ORIGINAL_NAME,Images/Stereo
otb:quicklook,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:radiometricindices,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:rasterization,USE_ORIGINAL_NAME,Images/Vector Data Manipulation
otb:readimageinformation,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:rescaleimage,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:sarradiometriccalibration,USE_ORIGINAL_NAME,Images/Calibration
otb:sfstextureextraction,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:simpleconnectedcomponentssegmentationlabeledrasteroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:simpleconnectedcomponentssegmentationlargescalevectoroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:smoothing,USE_ORIGINAL_NAME,Images/Image Filtering
otb:somclassification,USE_ORIGINAL_NAME,Images/Learning
otb:splitimage,USE_ORIGINAL_NAME,Images/Image Manipulation
otb:stereorectificationdeformationgridgenerator,USE_ORIGINAL_NAME,Images/Geometry
otb:stereosensormodeltoelevationmap,USE_ORIGINAL_NAME,Images/Stereo
otb:superimposesensor,USE_ORIGINAL_NAME,Images/Geometry
otb:trainsvmclassifierfrommultipleimages,USE_ORIGINAL_NAME,Images/Learning
otb:unsupervisedkmeansimageclassification,USE_ORIGINAL_NAME,Images/Learning
otb:validatesvmimagesclassifier,USE_ORIGINAL_NAME,Images/Learning
otb:vectordataextractroi,USE_ORIGINAL_NAME,Images/Vector Data Manipulation
otb:vectordatareprojection,USE_ORIGINAL_NAME,Images/Vector Data Manipulation
otb:vectordatasetfield,USE_ORIGINAL_NAME,Images/Vector Data Manipulation
otb:vectordatatransformation,USE_ORIGINAL_NAME,Images/Vector Data Manipulation
otb:vectordatavalidation,USE_ORIGINAL_NAME,Images/Feature Extraction
otb:vertexcomponentanalysis,USE_ORIGINAL_NAME,Images/Miscellaneous
otb:watershedsegmentationlabeledrasteroutput,USE_ORIGINAL_NAME,Images/Segmentation
otb:watershedsegmentationlargescalevectoroutput,USE_ORIGINAL_NAME,Images/Segmentation
qgis:addautoincrementalfield,USE_ORIGINAL_NAME,Vector/Table tools
qgis:addfieldtoattributestable,USE_ORIGINAL_NAME,Vector/Table tools
qgis:advancedpythonfieldcalculator,USE_ORIGINAL_NAME,Vector/Table tools
@@ -82,8 +159,8 @@ saga:aggregatepointobservations,USE_ORIGINAL_NAME,Vector/Points
saga:aggregationindex,USE_ORIGINAL_NAME,Raster/Miscellaneous
saga:analyticalhierarchyprocess,USE_ORIGINAL_NAME,Raster/Miscellaneous
saga:analyticalhillshading,USE_ORIGINAL_NAME,Domain specific/Viewsheds\Lighting
saga:bsplineapproximation,USE_ORIGINAL_NAME,Raster - vector/Raster -> Vector
saga:basicterrainanalysis,USE_ORIGINAL_NAME,Domain specific/Terrain analysis and geomorphometry
saga:bsplineapproximation,USE_ORIGINAL_NAME,Raster - vector/Raster -> Vector
saga:burnstreamnetworkintodem,USE_ORIGINAL_NAME,Domain specific/Hydrology
saga:catchmentareaflowtracing,USE_ORIGINAL_NAME,Domain specific/Hydrology
saga:catchmentareamassfluxmethod,USE_ORIGINAL_NAME,Domain specific/Hydrology
@@ -223,8 +300,8 @@ saga:nearestneighbour,USE_ORIGINAL_NAME,Raster - vector/Vector -> Raster
saga:orderedweightedaveragingowa,USE_ORIGINAL_NAME,Raster/Analysis
saga:ordinarykriging,USE_ORIGINAL_NAME,Raster - vector/Vector -> Raster
saga:ordinarykrigingglobal,USE_ORIGINAL_NAME,Raster - vector/Vector -> Raster
saga:overlandflowkinematicwaved8,USE_ORIGINAL_NAME,Domain specific/Hydrology
saga:overlandflowdistancetochannelnetwork,USE_ORIGINAL_NAME,Domain specific/Hydrology
saga:overlandflowkinematicwaved8,USE_ORIGINAL_NAME,Domain specific/Hydrology
saga:patching,USE_ORIGINAL_NAME,Raster/General tools
saga:patternanalysis,USE_ORIGINAL_NAME,Raster/Analysis
saga:pointsfilter,USE_ORIGINAL_NAME,Vector/Points

0 comments on commit 345c145

Please sign in to comment.
You can’t perform that action at this time.