Skip to content

remimestdagh/FeatureViewerTypeScript

 
 

Repository files navigation

TypeScript Feature Viewer

This is a code repository for the BioComputingUP Feature Viewer project. Full documentation at: https://biocomputingup.github.io/FeatureViewerTypeScript-documentation/.

The Feature-Viewer was published as:

The Feature-Viewer: a visualization tool for positional annotations on a sequence
L. Paladin, M. Schaeffer et al., Bioinformatics 2020

This project is based on the Javascript version calipho-sib/feature-viewer, Copyright (c) 2015, SIB Swiss Institute of Bioinformatics. This version is based on Typescript and compatible with Angular 2+ framework.

Represent biological data with the feature viewer library! Used in MobiDB, DisProt, RepeatsDB and PhytotypeDB.

Dependencies

Getting started

1 Install the library using npm

npm install feature-viewer-typescript

2 Import the feature viewer in javascript or your angular component

import {FeatureViewer} from 'feature-viewer-typescript/lib';

3 Optional: if you are installing the feature viewer in an Angular 2+ based App, you may need to load the feature viewer stylesheet in your angular.json "styles" to ensure the correct pioritization of stylesheets.

styles: [
    "./node_modules/feature-viewer-typescript/assets/fv.scss"
]

4 Place the feature viewer in your html

<div id="myfv"></div>

5 Create an instance of the feature viewer in javascript and style it

const proteinsequence = 'MTKFTILLISLLFCIAHTCSASKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEE'
const fv = new FeatureViewer(proteinsequence, '#myfv', {
               showAxis: true,
               showSequence: true,
               toolbar: true,
               toolbarPosition: 'left',
               zoomMax: 10,
               flagColor: '#DFD5F5'
           });

6 Add features and subfeatures

fv.addFeatures(
      [
        { // simple rect
          type: 'rect',
          id: 'useUniqueId',
          data: [ {
            x: 50, y: 78,
            tooltip: '<button class="myButton">Button</button>'} ],
        },
        { // circles
          type: 'circle',
          id: 'mycircle',
          label: 'Circle feature',
          data: [{x: 10 , y: 100}, {x: 50, y: 70}, {x: 40, y: 60, color: '#00ac8f', tooltip: 'I have different color'}],
          color: '#61795e'
        },
        { // curve (height and yLim) with tooltip and subfeatures
          type: 'curve',
          id: 'mycurve',
          label: 'Curve label',
          data: [{x: 1, y: 0}, {x: 40, y: 102}, {x: 80, y: 5}, {x: 50, y: 184}, {x: 75, y: 4}],
          height: 1,
          yLim: 200,
          color: '#00babd',
          tooltip: '<b>Very</b> <span style="color: #C21F39">Stylable</span> <b><i><span style="color: #ffc520">Tooltip </span></i></b>',
          subfeatures: [
            {
              type: 'rect',
              data: [
                {x: 20, y: 30},
                {x: 15, y: 45},
                {x: 70, y: 76, label: 'myRect', tooltip: 'myTooltip'}
              ],
              id: 'aDifferentId',
              label: 'I am a subfeature!'
            }
          ]
        }
      ]
    )

7 Output

Feature Viewer

Support

If you have any problem or suggestion please open an issue.

Developers

Build with: npm run sass && webpack.

To test: run test-index.html.

License

This repo is based on calipho-sib/feature-viewer, Copyright (c) 2015, SIB Swiss Institute of Bioinformatics.

This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version.

About

Library to visualize protein sequence features in Typescript using D3. This repository is based on calipho-sib/feature-viewer.

Resources

License

Contributing

Stars

Watchers

Forks

Releases

No releases published

Packages

No packages published

Languages

  • TypeScript 86.7%
  • HTML 11.7%
  • SCSS 1.3%
  • JavaScript 0.3%