Permalink
Fetching contributors…
Cannot retrieve contributors at this time
1904 lines (1903 sloc) 101 KB
ID AF063097 standard; DNA; PHG; 33593 BP.
XX
AC AF063097; J02474; L29304; M12772; M13202; M27131; M27836; M34756; M58023;
AC M59752; M64677; U02597; X02300; X02301; X05655; X61229; X87173; X99627;
AC X99628; Z11483;
XX
SV AF063097.1
XX
DT 21-MAY-1998 (Rel. 55, Created)
DT 07-JAN-1999 (Rel. 58, Last updated, Version 2)
XX
DE Bacteriophage P2, complete genome.
XX
KW .
XX
OS Enterobacteria phage P2
OC Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae;
OC P2-like Viruses.
XX
RN [1]
RP 1-9, 33582-33593
RX MEDLINE; 73220701.
RA Murray K., Murray N.E.;
RT "Terminal nucleotide sequences of DNA from temperate coliphages";
RL Nature New Biol. 243(126):134-139(1973).
XX
RN [2]
RP 1-26, 33568-33593
RX MEDLINE; 77209985.
RA Murray K., Isaksson-Forsen A.G., Challberg M., Englund P.T.;
RT "Symmetrical nucleotide sequences in the recognition sites for the ter
RT function of bacteriophages P2, 299 and 186";
RL J. Mol. Biol. 112(3):471-489(1977).
XX
RN [3]
RP 1-26, 33568-33593
RX MEDLINE; 82051282.
RA Lindqvist B.H.;
RT "Recombination between satellite phage P4 and its helper P2. I. In vivo and
RT in vitro construction of P4: :P2 hybrid satellite phage";
RL Gene 14(4):231-241(1981).
XX
RN [4]
RP 2929-3589
RX MEDLINE; 83268689.
RA Christie G.E., Calendar R.;
RT "Bacteriophage P2 late promoters. Transcription initiation sites for two
RT late mRNAs";
RL J. Mol. Biol. 167(4):773-790(1983).
XX
RN [5]
RP 25456-25995
RX MEDLINE; 84248044.
RA Ljungquist E., Kockum K., Bertani E.L.;
RT "DNA sequence of the repressor gene and operator region of bacteriophage
RT P2";
RL Proc. Natl. Acad. Sci. U.S.A. 81:3988-3992(1984).
XX
RN [6]
RP 10188-10518, 17510-17996
RX MEDLINE; 85160858.
RA Christie G.E., Calender R.;
RT "Bacteriophage P2 late promoters - comparison of the four late promoter
RT sequences";
RL J. Mol. Biol. 181:373-382(1985).
XX
RN [7]
RP 23909-24339
RX MEDLINE; 86281704.
RA Birkeland N.K., Lindquist B.H.;
RT "Coliphage P2 late control gene ogr. DNA sequence and product
RT identification";
RL J. Mol. Biol. 188(3):487-490(1986).
XX
RN [8]
RP 23889-24333
RX MEDLINE; 86205872.
RA Christie G.E., Haggard-Ljungquist E., Feiwell R., Calendar R.;
RT "Regulation of bacteriophage P2 late-gene expression: the ogr gene";
RL Proc. Natl. Acad. Sci. U.S.A. 83(10):3238-3242(1986).
XX
RN [9]
RP 25849-27048
RX MEDLINE; 87286423.
RA Haggard-Ljungquist E., Kockum K., Bertani L.E.;
RT "DNA sequences of bacteriophage P2 early genes cox and B and their
RT regulatory sites";
RL Mol. Gen. Genet. 208(1-2):52-56(1987).
XX
RN [10]
RP 25849-27048
RX MEDLINE; 88082694.
RA Saha S., Haggard-Ljungquist E., Nordstrom K.;
RT "The cox protein of bacteriophage P2 inhibits the formation of the
RT repressor protein and autoregulates the early operon";
RL EMBO J. 6(10):3191-3199(1987).
XX
RN [11]
RP 24252-25595
RX MEDLINE; 90006769.
RA Yu A., Bertani L.E., Haggard-Ljungquist E.;
RT "Control of prophage integration and excision in bacteriophage P2:
RT nucleotide sequences of the int gene and att sites";
RL Gene 80(1):1-11(1989).
XX
RN [12]
RP 31590-33593
RX MEDLINE; 90152373.
RA Haggard-Ljungquist E., Barreiro V., Calendar R., Kurnit D.M., Cheng H.;
RT "The P2 phage old gene: sequence, transcription and translational control";
RL Gene 85(1):25-33(1989).
XX
RN [13]
RP 1-266, 33200-33593
RX MEDLINE; 91092507.
RA Ziermann R., Calendar R.;
RT "Characterization of the cos sites of bacteriophages P2 and P4";
RL Gene 96(1):9-15(1990).
XX
RN [14]
RP 17627-19373
RX MEDLINE; 91135001.
RA Temple L.M., Forsburg S.L., Calendar R., Christie G.E.;
RT "Nucleotide sequence of the genes encoding the major tail sheath and tail
RT tube proteins of bacteriophage P2";
RL Virology 181(1):353-358(1991).
XX
RN [15]
RP 4050-5178
RX MEDLINE; 91220668.
RA Six E.W., Sunshine M.G., Williams J., Haggard-Ljungquist E.,
RA Lindqvist B.H.;
RT "Morphopoietic switch mutations of bacteriophage P2";
RL Virology 182(1):34-46(1991).
XX
RN [16]
RP 1-6551
RX MEDLINE; 92115571.
RA Linderoth N.A., Ziermann R., Haggard-Ljungquist E., Christie G.E.,
RA Calendar R.;
RT "Nucleotide sequence of the DNA packaging and capsid synthesis genes of
RT bacteriophage P2";
RL Nucleic Acids Res. 19(25):7207-7214(1991).
XX
RN [17]
RP 12173-15684
RX MEDLINE; 92165720.
RA Haggard-Ljungquist E., Halling C., Calendar R.;
RT "DNA sequence of two tail genes of bacteriophage P2: Further evidence for
RT horizontal transfer of tail fiber genes among unrelated bacteriophages";
RL J. Bacteriol. 174:1462-1477(1992).
XX
RN [18]
RP 26923-30721
RX MEDLINE; 93287108.
RA Liu Y., Saha S., Haggard-Ljungquist E.;
RT "Studies of bacteriophage P2 DNA replication. The DNA sequence of the
RT cis-acting gene A and ori region and construction of a P2 mini-chromosome";
RL J. Mol. Biol. 231(2):361-374(1993).
XX
RN [19]
RP 6288-8381
RX MEDLINE; 94327465.
RA Ziermann R., Bartlett B., Calendar R., Christie G.E.;
RT "Functions involved in bacteriophage P2-induced host cell lysis and
RT identification of a new tail gene";
RL J. Bacteriol. 176:4974-4984(1994).
XX
RN [20]
RP 8376-10381
RX MEDLINE; 94233699.
RA Linderoth N.A., Julien B., Flick K.E., Calendar R., Christie G.E.;
RT "Molecular cloning and characterization of bacteriophage P2 genes R and S
RT involved in tail completion";
RL Virology 200:347-359(1994).
XX
RN [21]
RP 10276-12739
RX MEDLINE; 96036485.
RA Haggard-Liungquist E., Jacobsen E., Rishovd S., Six W.S., Nilssen O.,
RA Sunshine M.G., Lindqvist B.H., Kim K.J., Barreiro V., Koonin E.V.,
RA Calendar R.;
RT "Bacteriophage P2: genes involved in baseplate assembly";
RL Virology 213(1):109-121(1995).
XX
RN [22]
RP 15627-17626, 30643-31622
RA Calendar R., Yu S., Myung H., Barreiro V., Odegrip R., Bertani L.E.,
RA Carlson K., Davenport L., Mosig G., Christie G.E., Haggard-Ljungquist E.;
RT "The lysogenic conversion genes of coliphage P2 have unusually high AT
RT content";
RL (in) Syvanen M., Kado C. (eds.);
RL HORIZONTAL GENE TRANSFER:1-1;
RL Chapman and Hall, London (1998)
XX
RN [23]
RP 19374-23954
RA Christie G.E., Temple L.M., Bartlett B.A., Goodwin T.S.;
RT "Bacteriophage P2 tail assembly genes: Gene organization and a programmed
RT translational frameshift parallel those of bacteriophage lambda";
RL Unpublished.
XX
RN [24]
RP 1-33593
RA Christie G.E., Haggard-Ljungquist E., Calendar R.;
RT "The complete genome of bacteriophage P2";
RL Unpublished.
XX
RN [25]
RP 24351-25595
RA Haggard-Ljungquist E.;
RT ;
RL Submitted (15-SEP-1989) to the EMBL/GenBank/DDBJ databases.
RL Department of Microbial Genetics, Karolinska Institutet, Stockholm, Sweden
XX
RN [26]
RP 1-6551
RA Linderoth N.A.;
RT ;
RL Submitted (13-AUG-1991) to the EMBL/GenBank/DDBJ databases.
RL Dept of Mol and Cell Biology, Div of Biochemistry and Molecular Biology,
RL University of California, 401 Barker Hall, Berkeley, CA 94720, USA
XX
RN [27]
RP 26923-30721
RA Haggard-Ljungquist E.;
RT ;
RL Submitted (12-NOV-1991) to the EMBL/GenBank/DDBJ databases.
RL Department of Microbial Genetics, Karolinska Institutet, S-10401,
RL Stockholm, Sweden
XX
RN [28]
RP 8376-10381
RA Linderoth N.A.;
RT ;
RL Submitted (18-OCT-1993) to the EMBL/GenBank/DDBJ databases.
RL Nora A. Linderoth, Laboratory of Genetics, The Rockefeller University, 1230
RL York Avenue, New York, NY 10021, USA
XX
RN [29]
RP 10276-12739
RA Haggard E.B.;
RT ;
RL Submitted (12-MAY-1995) to the EMBL/GenBank/DDBJ databases.
RL Department of Genetics, Stockholm University, S-10691, Stockholm, Sweden
XX
RN [30]
RP 15627-17626, 30643-31622
RA Haggard-Ljungquist E.;
RT ;
RL Submitted (30-JUL-1996) to the EMBL/GenBank/DDBJ databases.
RL Department of Genetics, Stockholm University, S-106 91, Stockholm, Sweden
XX
RN [31]
RP 17510-23954
RA Christie G.E.;
RT ;
RL Submitted (21-NOV-1996) to the EMBL/GenBank/DDBJ databases.
RL Department of Microbiology and Immunology, Virginia Commonwealth
RL University, Box 980678, Richmond, VA 23298-0678, USA
XX
RN [32]
RP 1-33593
RA Christie G.E.;
RT ;
RL Submitted (05-MAY-1998) to the EMBL/GenBank/DDBJ databases.
RL Department of Microbiology and Immunology, Virginia Commonwealth
RL University, Richmond, VA 23298-0678, USA
XX
DR SPTREMBL; O64312; O64312.
DR SPTREMBL; O64313; O64313.
DR SPTREMBL; O64314; O64314.
DR SPTREMBL; O64315; O64315.
DR SPTREMBL; P79669; P79669.
DR SPTREMBL; P79670; P79670.
DR SPTREMBL; Q38498; Q38498.
DR SWISS-PROT; P04132; RPC_BPP2.
DR SWISS-PROT; P07695; VCOX_BPP2.
DR SWISS-PROT; P07696; VPB_BPP2.
DR SWISS-PROT; P08762; VOGR_BPP2.
DR SWISS-PROT; P10312; VPD_BPP2.
DR SWISS-PROT; P13520; VOLD_BPP2.
DR SWISS-PROT; P22501; VPF1_BPP2.
DR SWISS-PROT; P22502; VPF2_BPP2.
DR SWISS-PROT; P25475; VPL_BPP2.
DR SWISS-PROT; P25476; VPM_BPP2.
DR SWISS-PROT; P25477; VPN_BPP2.
DR SWISS-PROT; P25478; VPO_BPP2.
DR SWISS-PROT; P25479; VPP_BPP2.
DR SWISS-PROT; P25480; VPQ_BPP2.
DR SWISS-PROT; P26699; TFA_BPP2.
DR SWISS-PROT; P26700; VPH_BPP2.
DR SWISS-PROT; P26701; VPI_BPP2.
DR SWISS-PROT; P31340; VPV_BPP2.
DR SWISS-PROT; P36932; VINT_BPP2.
DR SWISS-PROT; P36933; VPR_BPP2.
DR SWISS-PROT; P36934; VPS_BPP2.
DR SWISS-PROT; P36935; YSV_BPP2.
DR SWISS-PROT; P51767; VPJ_BPP2.
DR SWISS-PROT; P51768; VPW_BPP2.
DR SWISS-PROT; P51769; LYSA_BPP2.
DR SWISS-PROT; P51770; LYSB_BPP2.
DR SWISS-PROT; P51771; LYCV_BPP2.
DR SWISS-PROT; P51772; VPX_BPP2.
DR SWISS-PROT; P51773; HOLI_BPP2.
DR SWISS-PROT; Q06419; VPA_BPP2.
DR SWISS-PROT; Q06422; YO80_BPP2.
DR SWISS-PROT; Q06423; YO81_BPP2.
DR SWISS-PROT; Q06424; YO82_BPP2.
DR SWISS-PROT; Q06425; YO83_BPP2.
DR SWISS-PROT; Q06426; YO91_BPP2.
XX
CC On May 20, 1998 this sequence version replaced gi:506838 gi:15821
CC gi:1806573 gi:215666 gi:506836 gi:508561 gi:1061043 gi:215669
CC gi:1769975 gi:494974 gi:215664 gi:15620 gi:393451 gi:1769977
CC gi:215681 gi:215675 gi:215676 gi:15141 gi:414530.
XX
XX
FH Key Location/Qualifiers
FH
FT source 1..33593
FT /db_xref="taxon:10679"
FT /organism="Enterobacteria phage P2"
FT /lab_host="Escherichia coli"
FT misc_feature 1..19
FT /note="cosL; left cohesive end"
FT terminator complement(160..181)
FT /note="tQ; putative rho-independent terminator for P
FT operon"
FT CDS complement(187..1221)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P25480"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="Q"
FT /function="presumed portal protein"
FT /product="gpQ"
FT /protein_id="AAD03268.1"
FT /translation="MSKKKGKTPQPAAKTMTASGPKMEAFTFGEPVPVLDRRDILDYVE
FT CISNGRWYEPPVSFTGLAKSLRAAVHHSSPIYVKRNILASTFIPHPWLSQQDFSRFVLD
FT FLVFGNAFLEKRYSTTGKVIRLETSPAKYTRRGVEEDVYWWVPSFNEPTAFAPGSVFHL
FT LEPDINQELYGLPEYLSALNSAWLNESATLFRRKYYENGAHAGYIMYVTDAVQDRNDIE
FT MLRENMVKSKGRNNFKNLFLYAPQGKADGIKIIPLSEVATKDDFFNIKKASAADLLDAH
FT RIPFQLMGGKPENVGSLGDIEKVAKVFVRNELIPLQDRIREINGWLGQEVIRFKNYSLD
FT TDND"
FT variation complement(653)
FT /note="Qam34 mutation"
FT /replace="t"
FT /gene="Q"
FT CDS complement(1221..2993)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P25479"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="P"
FT /function="terminase; DNA-dependent ATPase"
FT /product="gpP"
FT /protein_id="AAD03269.1"
FT /translation="MTITTDTTLLHDPRRQAALLYWQGFSVPQIAAMLQMKRPTVQSWK
FT QRDGWDSVAPISRVEMSLEARLTQLIIKPQKTGGDFKEIDLLGRQIERLARVNRYSQTG
FT NEADLNPNVANRNKGGRRKPKKNFFSDEAIEKLEQIFFEQSFDYQLHWYRAGLEHRIRD
FT ILKSRQIGATFYFSREALLRALKTGHNQIFLSASKTQAYVFREYIIAFARLVDVDLTGD
FT PIVLGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIPNFQVLRKVASGMASQSHLRSTY
FT FSTPSTLAHDAYPFWSGELFNRGRASAAERVEIDVSHNALAGGLLCADGQWRQIVTIED
FT ALKGGCTLFDIEQLKRENSADDFKNLFMCEFVDDKASVFPFEELQRCMVDTLEEWEDYA
FT PFAANPFGSRPVWIGYDPSHRGDSAGCVVLAPPVVAGGKFRILERHQWKGMDFATQAES
FT IRKLTEKYNVEYIGIDATGLGVGVFQLVRSFYPAARDIRYTPEMKTAMVLKAKDVIRRG
FT CLEYDVSATDITSSFMAIRKTMTSSGRSATYEASRSEEASHADLAWATMHALLNEPLTA
FT GISTPLTSTILEFY"
FT variation complement(2210)
FT /note="Pam24 and Pam137 mutations"
FT /replace="a"
FT /gene="P"
FT variation complement(2948)
FT /note="Pam253 mutation"
FT /replace="a"
FT /gene="P"
FT misc_feature complement(3016)
FT /note="transcription start site for P operon; encodes P,Q"
FT /gene="P"
FT misc_feature 3057..3087
FT /evidence=EXPERIMENTAL
FT /note="activator binding site; pO, pP promoters"
FT misc_feature 3127
FT /evidence=EXPERIMENTAL
FT /note="transcription start site for O operon; encodes O,
FT N, M, L, X, Y, K, lysA, lysB, R, S"
FT CDS 3167..4021
FT /codon_start=1
FT /db_xref="SWISS-PROT:P25478"
FT /transl_table=11
FT /gene="O"
FT /function="presumed capsid scaffolding protein"
FT /product="gpO"
FT /protein_id="AAD03270.1"
FT /translation="MAKKVSKFFRIGVEGDTCDGRVISAQDIQEMAETFDPRVYGCRIN
FT LEHLRGILPDGIFKRYGDVAELKAEKIDDDSALKGKWALFAKITPTDDLIAMNKAAQKV
FT YTSMEIQPNFANTGKCYLVGLAVTDDPASLGTEYLEFCRTAKHNPLNRFKLSPENLISV
FT ATPVELEFEDLPETVFTALTEKVKSIFGRKQASDDARLNDVHEAVTAVAEHVQEKLSAT
FT EQRLAEMETAFSALKQEVTDRADETSQAFTRLKNSLDHTESLTQQRRSKATGGGGDALM
FT TNC"
FT variation 3206
FT /note="Oam71 mutation"
FT /replace="t"
FT /gene="O"
FT variation 3411
FT /note="Oam7 mutation"
FT /replace="a"
FT /gene="O"
FT variation 3878
FT /note="Oam279 mutation"
FT /replace="t"
FT /gene="O"
FT CDS 4080..5153
FT /codon_start=1
FT /db_xref="SWISS-PROT:P25477"
FT /transl_table=11
FT /gene="N"
FT /function="major capsid precursor"
FT /product="gpN"
FT /protein_id="AAD03271.1"
FT /translation="MRQETRFKFNAYLSRVAELNGIDAGDVSKKFTVEPSVTQTLMNTM
FT QESSDFLTRINIVPVSEMKGEKIGIGVTGSIASTTDTAGGTERQPKDFSKLASNKYECD
FT QINFDFYIRYKTLDLWARYQDFQLRIRNAIIKRQSLDFIMAGFNGVKRAETSDRSSNPM
FT LQDVAVGWLQKYRNEAPARVMSKVTDEEGRTTSEVIRVGKGGDYASLDALVMDATNNLI
FT EPWYQEDPDLVVIVGRQLLADKYFPIVNKEQDNSEMLAADVIISQKRIGNLPAVRVPYF
FT PADAMLITKLENLSIYYMDDSHRRVIEENPKLDRVENYESMNIDYVVEDYAAGCLVEKI
FT KVGDFSTPAKATAEPGA"
FT variation 4349..4350
FT /note="Nam209 mutation"
FT /replace="at"
FT /gene="N"
FT variation 4630
FT /note="sir3 mutation; defective for choice of small
FT capsids by satellite phage P4"
FT /replace="c"
FT /gene="N"
FT variation 4695
FT /note="sir5 mutation; defective for choice of small
FT capsids by satellite phage P4"
FT /replace="t"
FT /gene="N"
FT variation 4695..4697
FT /note="sir9 mutation; defective for choice of small
FT capsids by satellite phage P4"
FT /replace=""
FT /gene="N"
FT variation 4699
FT /note="sir2, sir6 and sir8 mutations; defective for choice
FT of small capsids by satellite phage P4"
FT /replace="t"
FT /gene="N"
FT variation 4740
FT /note="sir1 mutation; defective for choice of small
FT capsids by satellite phage P4"
FT /replace="g"
FT /gene="N"
FT variation 4741
FT /note="sir4 mutation; defective for choice of small
FT capsids by satellite phage P4"
FT /replace="a"
FT /gene="N"
FT CDS 5157..5900
FT /codon_start=1
FT /db_xref="SWISS-PROT:P25476"
FT /transl_table=11
FT /gene="M"
FT /function="terminase"
FT /product="gpM"
FT /protein_id="AAD03272.1"
FT /translation="MTSPAQRHMMRVSAAMTAQREAAPLRHATVYEQMLVKLAADQRTL
FT KAIYSKELKAAKKRELLPFWLPWVNGVLELGKGAQDDILMTVMLWRLDTGDIAGALEIA
FT RYALKYGLTMPGKHRRTPPYMFTEEVALAAMRAHAAGESVDTRLLTETLELTATADMPD
FT EVRAKLHKITGLFLRDGGDAAGALAHLQRATQLDCQAGVKKEIERLERELKPKPEPQPK
FT AATRAPRKTRSVTPAKRGRPKKKAS"
FT variation 5361
FT /note="Mts52 mutation"
FT /replace="a"
FT /gene="M"
FT variation 5751
FT /note="Mam32 mutation"
FT /replace="t"
FT /gene="M"
FT CDS 6000..6509
FT /codon_start=1
FT /db_xref="SWISS-PROT:P25475"
FT /transl_table=11
FT /gene="L"
FT /function="capsid completion protein"
FT /product="gpL"
FT /protein_id="AAD03273.1"
FT /translation="MMTLIIPRKEAPVSGEGTVVIPQPAGDEPVIKNTFFFPDIDPKRV
FT RERMRLEQTVAPARLREAIKSGMAETNAELYEYREQKIAAGFTRLADVPADDIDGESIK
FT VFYYERAVCAMATASLYERYRGVDASAKGDKKADSIDSTIDELWRDMRWAVARIQGKPR
FT CIVSQI"
FT variation 6024
FT /note="Lam79 mutation"
FT /replace="t"
FT /gene="L"
FT variation 6240
FT /note="Lam9 mutation"
FT /replace="t"
FT /gene="L"
FT CDS 6509..6712
FT /codon_start=1
FT /db_xref="SWISS-PROT:P51772"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="X"
FT /function="essential tail gene"
FT /product="gpX"
FT /protein_id="AAD03274.1"
FT /translation="MKTFALQGDTLDAICVRYYGRTEGVVETVLAANPGLAELGAVLPH
FT GTAVELPDVQTAPVAETVNLWE"
FT variation 6562
FT /note="Xam95 mutation"
FT /replace="g"
FT /gene="X"
FT CDS 6716..6997
FT /codon_start=1
FT /db_xref="SWISS-PROT:P51773"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="Y"
FT /function="holin; essential for host cell cell lysis"
FT /product="gpY"
FT /protein_id="AAD03275.1"
FT /translation="MTAEEKSVLSLFMIGVLIVVGKVLAGGEPITPRLFIGRMLLGGFV
FT SMVAGVVLVQFPDLSLPAVCGIGSMLGIAGYQVIEIAIQRRFKGRGKQ"
FT variation 6852
FT /note="Yam94 mutation"
FT /replace="a"
FT /gene="Y"
FT CDS 6997..7494
FT /codon_start=1
FT /db_xref="SWISS-PROT:P51771"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="K"
FT /function="endolysin; essential for host cell lysis"
FT /product="gpK"
FT /protein_id="AAD03276.1"
FT /translation="MPVINTHQNIAAFLDMLAVSEGTANHPLTKNRGYDVIVTGLDGKP
FT EIFTDYSDHPFAHGRPAKVFNRRGEKSTASGRYQQLYLFWPHYRKQLALPDFSPLSQDR
FT LAIQLIRERGALDDIRAGRIERAISRCRNIWASLPGAGYGQREHSLEKLVTVWRTAGGV
FT PA"
FT variation 7114
FT /note="Kts60 mutation"
FT /replace="a"
FT /gene="K"
FT variation 7126
FT /note="Kam218 mutation"
FT /replace="t"
FT /gene="K"
FT variation 7318
FT /note="Kam12 mutation"
FT /replace="t"
FT /gene="K"
FT variation 7322
FT /note="Kam76 mutation"
FT /replace="a"
FT /gene="K"
FT CDS 7509..7934
FT /codon_start=1
FT /db_xref="SWISS-PROT:P51769"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="lysA"
FT /function="nonessential; affects timing of lysis"
FT /product="LysA"
FT /protein_id="AAD03277.1"
FT /translation="MKKLSLSLMLNVSLALMLALSLIYPQSVAVNFVAAWAILATVICV
FT VAGGVGVYATEYVLERYGRELPPESLAVKIVTSLFLQPVPWRRRAAALVVVVATFISLV
FT AAGWIFTALIYLVVSLFFRLIRKACRQRLEGREPCQG"
FT variation 7694
FT /note="lysAam96 mutation"
FT /replace="g"
FT /gene="lysA"
FT CDS 7922..8347
FT /codon_start=1
FT /db_xref="SWISS-PROT:P51770"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="lysB"
FT /function="nonessential; affects timing of lysis"
FT /product="LysB"
FT /protein_id="AAD03278.1"
FT /translation="MSRLMIVLVVLLSLAVAGLFLVKHKNASLRASLDRANNVASGQQT
FT TITMLKNQLHVALTRADKNELAQVALRQELENAAKREAQREKTITRLLNENEDFRRWYG
FT ADLPDAVRRLHQRPACTDASDCPQRMPESEPLPDAGQ"
FT variation 8099..8100
FT /note="lysBam97 mutation"
FT /replace="ta"
FT /gene="lysB"
FT attenuator 8399..8417
FT /note="putative transcription attenuator; O operon"
FT CDS 8455..8922
FT /codon_start=1
FT /db_xref="SWISS-PROT:P36933"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="R"
FT /function="essential tail gene; tail completion"
FT /product="gpR"
FT /protein_id="AAD03279.1"
FT /translation="MLKPDSLRRALTDAVTVLKTNPDMLRIFVDNGSIASTLAASLSFE
FT KRYTLNVIVTDFTGDFDLLIVPVLAWLRENQPDIMTTDEGQKKGFTFYADINNDSSFDI
FT SISLMLTERTLVSEVDGALHVKNISEPPPPEPVTRPMELYINGELVSKWDE"
FT variation 8680
FT /note="Ram3 mutation"
FT /replace="t"
FT /gene="R"
FT variation 8710
FT /note="Ram42 mutation"
FT /replace="t"
FT /gene="R"
FT variation 8857
FT /note="Ram23 mutation"
FT /replace="t"
FT /gene="R"
FT CDS 8915..9367
FT /codon_start=1
FT /db_xref="SWISS-PROT:P36934"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="S"
FT /function="essential tail gene; tail completion"
FT /product="gpS"
FT /protein_id="AAD03280.1"
FT /translation="MNEFKRFEDRLTGLIESLSPSGRRRLSAELAKRLRQSQQRRVMAQ
FT KAPDGTPYAPRQQQSVRKKTGRVKRKMFAKLITSRFLHIRASPEQASMEFYGGKSPKIA
FT SVHQFGLSEENRKDGKKIDYPARPLLGFTGEDVQMIEEIILAHLER"
FT variation 9209
FT /note="Sam75 mutation"
FT /replace="t"
FT /gene="S"
FT variation 9213
FT /note="Sam89 mutation"
FT /replace="a"
FT /gene="S"
FT terminator 9397..9433
FT /note="putative rho-independent terminator for O operon"
FT CDS complement(9439..10224)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P36935"
FT /transl_table=11
FT /gene="orf30"
FT /function="nonessential"
FT /product="Orf30"
FT /protein_id="AAD03281.1"
FT /translation="MVSYNVTNVWGLIVFFLCSFAVLAFFSFGKSNLMRLIAHYFNFGY
FT SDKKLKRLDREWRDIQLFKIINGINVSGIENVRMIQQGLIDGKLKTSYFFLTRIWGDIT
FT KPPHIIKTIIVILASIFYILLACYIHNEQSVIVRDATGIPYKNMMYYVYSDKVLLSFKN
FT KAVEFNKTYSLADCKRLQNVFIKDTLPEIACNKLLQLNEEDSEWLSQEIKDNNSHKKAL
FT LILSLVYFTSGLVIFLSYTKFFYANKKVLEYKASNKNHS"
FT misc_feature 10239..10266
FT /evidence=EXPERIMENTAL
FT /note="activator binding site; activation of pV promoter"
FT CDS 10308..10943
FT /codon_start=1
FT /db_xref="SWISS-PROT:P31340"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="V"
FT /function="baseplate assembly protein"
FT /product="gpV"
FT /protein_id="AAD03282.1"
FT /translation="MNTLANIQELARALRNMIRTGIIVETDLNAGRCRVQTGGMCTDWL
FT QWLTHRAGRSRTWWAPSVGEQVLILAVGGELDTAFVLPGIYSGDNPSPSVSADALHIRF
FT PDGAVIEYEPETSALTVSGIKTASVTASGSVTATVPVVMVKASTRVTLDTPEVVCTNRL
FT ITGTLEVQKGGTMRGNIEHTGGELSSNGKVLHTHKHPGDSGGTTGSPL"
FT misc_feature 10308
FT /evidence=EXPERIMENTAL
FT /note="transcription start site for V operon; encodes V,
FT W, J, I, H, G"
FT /gene="V"
FT variation 10329
FT /note="Vam42, Vam203 and Vam205 mutations"
FT /replace="t"
FT /gene="V"
FT variation 10498
FT /note="Vts199 mutation"
FT /replace="a"
FT /gene="V"
FT CDS 10940..11287
FT /codon_start=1
FT /db_xref="SWISS-PROT:P51768"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="W"
FT /function="baseplate assembly protein"
FT /product="gpW"
FT /protein_id="AAD03283.1"
FT /translation="MTARYLGMNRSDGLTVTDLEHISQSIGDILRTPVGSRVMRRDYGS
FT LLASMIDQPQTPALELQIKVACYMAVLKWEPRVTLSSVTTARSFDGRMTVTLTGQHNDT
FT GQPLSLTIPVS"
FT variation 11237
FT /note="Wam50 mutation"
FT /replace="t"
FT /gene="W"
FT CDS 11292..12200
FT /codon_start=1
FT /db_xref="SWISS-PROT:P51767"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="J"
FT /function="baseplate assembly protein"
FT /product="gpJ"
FT /protein_id="AAD03284.1"
FT /translation="MPIIDLNQLPAPDVVEELDFESILAERKATLISLYPEDQQEAVAR
FT TLTLESEPLVKLLEENAYRELIWRQRVNEAARAVMLACAAGNDLDVIGANYNTTRLTIT
FT PADDSTIPPTPAVMESDTDYRLRIQQAFEGLSVAGSVGAYQYHGRSADGRVADISVTSP
FT SPACVTISVLSRENNGVASEDLLAVVRNALNGEDVRPVADRVTVQSAAIVEYQINATLY
FT LYPGPESEPIRAAAVKKLEAYITAQHRLGRDIRLSAIYAALHVEGVQRVELAAPLADIV
FT LNSTQASFCTEYRVVTGGSDE"
FT variation 11937
FT /note="Jam31 mutation"
FT /replace="t"
FT /gene="J"
FT CDS 12193..12723
FT /codon_start=1
FT /db_xref="SWISS-PROT:P26701"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="I"
FT /function="baseplate assembly protein"
FT /product="gpI"
FT /protein_id="AAD03285.1"
FT /translation="MSDSRLLPTGSSPLEVAAAKACAEIEKTPVSIRELWNPDTCPANL
FT LPWLAWAFSVDRWDEKWPEATKRAVIRDAYFIHCHKGTIGAIRRVVEPLGYLINVTEWW
FT ENSDPPGTFRLDIGVLESGITEAMYQEMERLIADAKPASRHLIGLNITRDIPGYLFAGG
FT VAYDGDVITVYPG"
FT variation 12235
FT /note="Iam78 mutation"
FT /replace="t"
FT /gene="I"
FT CDS 12734..14743
FT /codon_start=1
FT /db_xref="SWISS-PROT:P26700"
FT /transl_table=11
FT /gene="H"
FT /function="probable tail fiber protein"
FT /product="gpH"
FT /protein_id="AAD03286.1"
FT /translation="MSIKFRTVITTAGAAKLAAATAPGRRKVGITTMAVGDGGGKLPVP
FT DAGQTGLIHEVWRHALNKISQDKRNSNYIIAELVIPPEVGGFWMRELGLYDDAGTLIAV
FT ANMAESYKPALAEGSGRWQTCRMVIIVSSVASVELTIDTTTVMATQDYVDDKIAEHEQS
FT RRHPDASLTAKGFTQLSSATNSTSETLAATPKAVKAAYDLANGKYTAQDATTARKGLVQ
FT LSSATNSTSETLAATPKAVKTVMDETNKKAPLNSPALTGTPTTPTARQGTNNTQIANTA
FT FVMAAIAALVDSSPDALNTLNELAAALGNDPNFATTMTNALAGKQPKDATLTALAGLAT
FT AADRFPYFTGNDVASLATLTKVGRDILAKSTVAAVIEYLGLQETVNRAGNAVQKNGDTL
FT SGGLTFENDSILAWIRNTDWAKIGFKNDADGDTDSYMWFETGDNGNEYFKWRSRQSTTT
FT KDLMTLKWDALNILVNAVINGCFGVGTTNALGGSSIVLGDNDTGFKQNGDGILDVYANS
FT QRVFRFQNGVAIAFKNIQAGDSKKFSLSSSNTSTKNITFNLWGASTRPVVAELGDEAGW
FT HFYSQRNTDNSVIFAVNGQMQPSNWGNFDSRYVKDVRLGTRVVQLMARGGRYEKAGHTI
FT TGLRIIGEVDGDDEAIFRPIQKYINGTWYNVAQV"
FT variation 13994
FT /note="Ham72 mutation"
FT /replace="t"
FT /gene="H"
FT variation 14336
FT /note="Ham59 mutation"
FT /replace="t"
FT /gene="H"
FT CDS 14747..15274
FT /codon_start=1
FT /db_xref="SWISS-PROT:P26699"
FT /transl_table=11
FT /gene="G"
FT /function="probable tail fiber assembly protein"
FT /product="gpG"
FT /protein_id="AAD03287.1"
FT /translation="MQHLKNIKSGNPKTKEQYQLTKNFDVIWLWSEDGKNWYEEVKNFQ
FT PDTIKIVYDENNIIVAITRDASTLNPEGFSVVEVPDITSNRRADDSGKWMFKDGAVVKR
FT IYTADEQQQQAESQKAALLSEAENVIQPLERAVRLNMATDEERARLESWERYSVLVSRV
FT DPANPEWPEMPQ"
FT variation 14879
FT /note="Gam1 mutation"
FT /replace="t"
FT /gene="G"
FT variation 15294..17233
FT /note="del2 deletion"
FT /replace=""
FT terminator 15639..15666
FT /note="putative rho-independent terminator for V operon"
FT CDS complement(15675..17261)
FT /codon_start=1
FT /db_xref="SPTREMBL:P79669"
FT /note="cloned gene blocks growth of T5"
FT /transl_table=11
FT /gene="fun(Z)"
FT /function="nonessential; lysogenic conversion; confers
FT sensitivity to FUdR"
FT /product="Fun(Z)"
FT /protein_id="AAD03288.1"
FT /translation="MIPIKDLTLGYADAENYKRRENKELLNKVFIRDNHLSRLCEPNIS
FT FLVGEKGTGKTAYSIYLSNNNINNTLATTKYIRETEYQKFITLKSEKHLNLSDFSGIWK
FT VILYLLISKQVLDKEGKISKLLNYSKFSSLNDAIDEYYLKAFSPEIIQALSFVQESKVA
FT AELLHKHATLKGEERESLSFSESRFQINLFYIQKKFEEAFSQIRLSQNHILFIDGIDIR
FT PSSIPYDDYLECIKGLAHAVWEINNDFFPSIKGGKGRMKAVLLIRPDIFESIGLQNQNA
FT KIRDNSVFLDWRTEYVNHRSSQLFEVLDHLLRTQQDMALKKGQAWDHYFPWDSPNVHDN
FT YNHPTSFINFLRWSYYRPRDILRMLEIIKSHASGDDGKNQFSLDDFESPSMQRDYSNYL
FT LGEIKDHLSFYYGSEHYEIFLKFFEFLSGKDTFDYAEYLLAYKQLETHISSISTTKPKF
FT MTTANDFLQFLFGLNVICYIETTEDNNRFIRWCFRERSYANISPKIKTGMKYQIFYGLA
FT KSLNVGKALKK"
FT variation complement(15784)
FT /note="Z81su3 mutation"
FT /replace="a"
FT /gene="fun(Z)"
FT variation complement(15872)
FT /note="Z20 mutation"
FT /replace="t"
FT /gene="fun(Z)"
FT variation complement(15944)
FT /note="Z81 mutation"
FT /replace="t"
FT /gene="fun(Z)"
FT variation complement(15946)
FT /note="fun1 mutation"
FT /replace="t"
FT /gene="fun(Z)"
FT variation complement(16079)
FT /note="csZ150 mutation"
FT /replace="t"
FT /gene="fun(Z)"
FT variation complement(16266)
FT /note="fun99 mutation"
FT /replace="t"
FT /gene="fun(Z)"
FT variation 16267..17299
FT /note="del5 deletion"
FT /replace=""
FT variation complement(16638)
FT /note="csZ150 mutation"
FT /replace="a"
FT /gene="fun(Z)"
FT misc_feature 17555..17583
FT /evidence=EXPERIMENTAL
FT /note="activator binding site; activation of pF promoter"
FT misc_feature 17626..17628
FT /evidence=EXPERIMENTAL
FT /note="transcription start site for F operon; encodes FI,
FT FII, E, E', T, U, D"
FT CDS 17652..18842
FT /codon_start=1
FT /db_xref="SWISS-PROT:P22501"
FT /transl_table=11
FT /gene="FI"
FT /function="essential tail protein; tail sheath"
FT /product="gpFI"
FT /protein_id="AAD03289.1"
FT /translation="MSDYHHGVQVLEINEGTRVISTVSTAIVGMVCTASDADAETFPLN
FT KPVLITNVQSAISKAGKKGTLAASLQAIADQSKPVTVVMRVEDGTGDDEETKLAQTVSN
FT IIGTTDENGQYTGLKAMLAAESVTGVKPRILGVPGLDTKEVAVALASVCQKLRAFGYIS
FT AWGCKTISEVKAYRQNFSQRELMVIWPDFLAWDTVTSTTATAYATARALGLRAKIDQEQ
FT GWHKTLSNVGVNGVTGISASVFWDLQESGTDADLLNESGVTTLIRRDGFRFWGNRTCSD
FT DPLFLFENYTRTAQVVADTMAEAHMWAVDKPITATLIRDIVDGINAKFRELKTNGYIVD
FT ATCWFSEESNDAETLKAGKLYIDYDYTPVPPLENLTLRQRITDKYLANLVTSVNSN"
FT variation 18183
FT /note="Fam4 mutation"
FT /replace="t"
FT /gene="FI"
FT CDS 18855..19373
FT /codon_start=1
FT /db_xref="SWISS-PROT:P22502"
FT /transl_table=11
FT /gene="FII"
FT /function="essential tail protein; tail tube"
FT /product="gpFII"
FT /protein_id="AAD03290.1"
FT /translation="MAMPRKLKLMNVFLNGYSYQGVAKSVTLPKLTRKLENYRGAGMNG
FT SAPVDLGLDDDALSMEWSLGGFPDSVIWELYAATGVDAVPIRFAGSYQRDDTGETVAVE
FT VVMRGRQKEIDTGEGKQGEDTESKISVVCTYFRLTMDGKELVEIDTINMIEKVNGVDRL
FT EQHRRNIGL"
FT CDS 19430..19705
FT /codon_start=1
FT /db_xref="SPTREMBL:O64313"
FT /transl_table=11
FT /gene="E"
FT /function="essential tail protein"
FT /product="gpE"
FT /protein_id="AAD03291.1"
FT /translation="MNKENVITLDNPVKRGEQVIEQVTLMKPSAGTLRGVSLAAVANSE
FT VDALIKVLPRMTAPMLTEQEVAALELPDLVALAGKVVGFLSPNSVQ"
FT CDS join(19430..19684,19684..19857)
FT /codon_start=1
FT /db_xref="SPTREMBL:O64312"
FT /note="shares amino terminus with gpE; -1 frameshift"
FT /transl_table=11
FT /gene="E+E'"
FT /function="essential tail protein"
FT /product="gpE+E'"
FT /protein_id="AAD03292.1"
FT /translation="MNKENVITLDNPVKRGEQVIEQVTLMKPSAGTLRGVSLAAVANSE
FT VDALIKVLPRMTAPMLTEQEVAALELPDLVALAGKVVGFLVAELGAVTFPKNLSVDDLM
FT ADVAVIFHWPPSELYPMSLTELITWREKALRRSGNTNE"
FT variation 19473
FT /note="Ets55 mutation"
FT /replace="a"
FT /gene="E"
FT variation 19619
FT /note="Eam30 mutation"
FT /replace="t"
FT /gene="E"
FT misc_feature 19685
FT /evidence=EXPERIMENTAL
FT /note="site of -1 translational frameshift"
FT /gene="E+E'"
FT CDS 19850..22297
FT /codon_start=1
FT /db_xref="SPTREMBL:O64314"
FT /transl_table=11
FT /gene="T"
FT /function="essential tail protein; putative tail length
FT determinator"
FT /product="gpT"
FT /protein_id="AAD03293.1"
FT /translation="MSNNVKLQVLLRAVDQASRPFKSIRTASKSLSGDIRETQKSLREL
FT NGHASRIEGFRKTSAQLAVTGHALEKARQEAEALATQFKNTERPTRAQAKVLESAKRAA
FT EDLQAKYNRLTDSVKRQQRELAAVGINTRNLAHDEQGLKNRISETTAQLNRQRDALVRV
FT SAQQAKLNAVKQRYQAGKELAGNMASVGAAGVGIAAAGTMAGVKLLMPGYEFAQKNSEL
FT QAVIGVAKDSAEMAALRKQARQLGDNTAASADDAAGAQIIIAKAGGDVDAIQAATPVTL
FT NMALANRRTMEENAALLMGMKSAFQLSNDKVAHIGDVLSMTMNKTAADFDGMSDALTYA
FT APVAKNAGVSIEETAAMVGALHDAKITGSMAGTGSRAVLSRLQAPTGKAWDALKELGVK
FT TSDSKGNTRPIFTILKEMQASFEKNRLGTAQQAEYMKTIFGEEASSAAAVLMTAASTGK
FT LDKLTAAFKASDGKTAELVNIMQDNLGGDFKAFQSAYEAVGTDLFDQQEGALRKLTQTA
FT TKYVLKLDGWIQKNKSLASTIGIIAGGALALTGIIGAIGLVAWPVITGINAIIAAAGAM
FT GAVFTTVGSAVMTAIGAISWPVVAVVAAIVAGALLIRKYWEPVSAFFGGVVEGLKAAFA
FT PVGELFTPLKPVFDWLGEKLQAAWQWFKNLIAPVKATQDTLNRCRDTGVMFGQALADAL
FT MLPLNAFNKLRSGIDWVLEKLGVINKESDTLDQTAARTHTATYGTGDYIPATSSYAGYQ
FT AYQPVTAPAGRSYVDQSKNEYHISLTGGTAPGTQLDRQLQDALEKYERDKRARARASMM
FT HDG"
FT variation 20669
FT /note="Tam215 mutation"
FT /replace="t"
FT /gene="T"
FT variation 21101
FT /note="Tam5 mutation"
FT /replace="t"
FT /gene="T"
FT variation 21528
FT /note="Tam64 mutation"
FT /replace="a"
FT /gene="T"
FT CDS 22312..22791
FT /codon_start=1
FT /db_xref="SPTREMBL:O64315"
FT /transl_table=11
FT /gene="U"
FT /function="essential tail protein"
FT /product="gpU"
FT /protein_id="AAD03294.1"
FT /translation="MMLALGMFVFMRQTLPHQTMQRESDYRWPSNSRIGKRDAFQFLGV
FT GEENITLAGVLYPELTGGKLTMTTLRLMAEEGRAWPLLDGTGMIYGMYVISRVSETGSI
FT FFADGTPRKIDFTLSLTRVDESLAALYGDIGKQAESLIGKAGSMATRFTGMTGAG"
FT variation 22363
FT /note="Uam25 mutation"
FT /replace="t"
FT /gene="U"
FT variation 22501
FT /note="Uam77 and Uam92 mutations"
FT /replace="t"
FT /gene="U"
FT CDS 22791..23954
FT /codon_start=1
FT /db_xref="SWISS-PROT:P10312"
FT /transl_table=11
FT /gene="D"
FT /function="essential tail protein"
FT /product="gpD"
FT /protein_id="AAD03295.1"
FT /translation="MLDALTFDAGSTLTPDYMLMLDSRDITGNISDRLMSMTLTDNRGF
FT EADQLDIELNDADGQVGLPVRGAVLTVYIGWKGFALVCKGKFTVDEVEHRGAPDVVTIR
FT ARSADFRGTLNSRREGSWHDTTLGAIVKAIATRNRLEASVAPSLAGIKIPHIDQSQESD
FT AKFLTRLAERNGGEVSVKMGKLLFLKAGQGVTASGKKIPQVTITRSDGDRHHFAIADRG
FT AYTGVTAKWLHTKDPKPQKQKVKLKRKKKEKHLRALEHPKAKPVRQKKAPKVPEAREGE
FT YMAGEADNVFALTTVYATKAQAMRAAQAKWDKLQRGVAEFSISLATGRADIYTETPVKV
FT SGFKRVIDEQDWTITKVTHFLNNSGFTTSLELEVRLSDVEYETEDDE"
FT variation 23592
FT /note="Dam6 mutation"
FT /replace="t"
FT /gene="D"
FT -35_signal 23973..23975
FT -10_signal 23996..24002
FT prim_transcript 24008..24288
FT /note="putative"
FT CDS 24036..24254
FT /codon_start=1
FT /db_xref="SWISS-PROT:P08762"
FT /transl_table=11
FT /gene="ogr"
FT /product="Ogr"
FT /protein_id="AAD03296.1"
FT /translation="MFHCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYESV
FT QRYIVKPGEVHAVRPHPLPSGQQIMWM"
FT variation 24148..25274
FT /note="del15 deletion"
FT /replace=""
FT variation 24160
FT /note="ogr1 and ogr52 mutations"
FT /replace="g"
FT /gene="ogr"
FT terminator 24265..24288
FT /evidence=EXPERIMENTAL
FT /note="rho-independent terminator for ogr transcript and F
FT operon"
FT protein_bind 24293..24320
FT /note="P arm"
FT /bound_moiety="Int"
FT protein_bind 24324..24357
FT /bound_moiety="IHF"
FT misc_feature complement(24356..24382)
FT /note="attP"
FT protein_bind 24356..24383
FT /note="attP core"
FT /bound_moiety="Int"
FT variation 24372
FT /note="saf mutation; altered integration site specificity"
FT /replace="g"
FT variation 24376
FT /note="left end del3 deletion/insertion"
FT variation 24378..25065
FT /note="del6 deletion"
FT /replace=""
FT variation 24378..25927
FT /note="vir22 deletion/insertion"
FT variation 24381..26340
FT /note="vir94 deletion/insertion"
FT protein_bind 24399..24472
FT /bound_moiety="Cox"
FT CDS complement(24462..25475)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P36932"
FT /transl_table=11
FT /gene="int"
FT /function="integrase"
FT /product="Int"
FT /protein_id="AAD03297.1"
FT /translation="MAIKKLDDGRYEVDIRPTGRNGKRIRRKFDKKSEAVAFEKYTLYN
FT HHNKEWLSKPTDKRRLSELTQIWWDLKGKHEEHGKSNLGKIEIFTKITNDPCAFQITKS
FT LISQYCATRRSQGIKPSSINRDLTCISGMFTALIEAELFFGEHPIRGTKRLKEEKPETG
FT YLTQEEIALLLAALDGDNKKIAILCLSTGARWGEAARLKAENIIHNRVTFVKTKTNKPR
FT TVPISEAVAKMIADNKRGFLFPDADYPRFRRTMKAIKPDLPMGQATHALRHSFATHFMI
FT NGGSIITLQRILGHTRIEQTMVYAHFAPEYLQDAISLNPLRGGTEAESVHTVSTVE"
FT protein_bind 24470..24496
FT /note="P' arm"
FT /gene="int"
FT /bound_moiety="Int"
FT variation complement(24539)
FT /note="intam150 mutation"
FT /replace="a"
FT /gene="int"
FT variation complement(25130)
FT /note="intam239 mutation"
FT /replace="a"
FT /gene="int"
FT variation complement(25454)
FT /note="nip1 mutation"
FT /replace="t"
FT /gene="int"
FT variation 25492..25839
FT /note="vir 79 deletion"
FT /replace=""
FT CDS complement(25591..25890)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P04132"
FT /transl_table=11
FT /gene="C"
FT /function="immunity repressor"
FT /product="gpC"
FT /protein_id="AAD03298.1"
FT /translation="MSNTISEKIVLMRKSEYLSRQQLADLTGVPYGTLSYYESGRSTPP
FT TDVMMNILQTPQFTKYTLWFMTNQIAPESGQIAPALAHFGQNETTSPHSGQKTG"
FT variation complement(25637)
FT /note="sly1 mutation"
FT /replace="t"
FT /gene="C"
FT variation complement(25682)
FT /note="cts7 mutation"
FT /replace="t"
FT /gene="C"
FT variation complement(25686..25702)
FT /note="cam11 and cam13 mutations"
FT /replace="a"
FT /gene="C"
FT variation complement(25702)
FT /note="cts6 mutation"
FT /replace="a"
FT /gene="C"
FT variation complement(25731)
FT /note="cam10 and cam12 mutations"
FT /replace="a"
FT /gene="C"
FT variation complement(25772)
FT /note="cts9 mutation"
FT /replace="t"
FT /gene="C"
FT variation complement(25802)
FT /note="vir1 mutation"
FT /replace="t"
FT /gene="C"
FT variation complement(25829)
FT /note="cts8 mutation"
FT /replace="g"
FT /gene="C"
FT variation complement(25844)
FT /note="cts5 mutation"
FT /replace="a"
FT /gene="C"
FT -35_signal 25884..25889
FT /note="early promoter Pe"
FT misc_feature 25894..25901
FT /note="O1 repressor binding site"
FT variation 25899..25955
FT /note="vir24 deletion"
FT /replace=""
FT variation 25900..25916
FT /note="vir3 deletion"
FT /replace=""
FT variation 25904..25920
FT /note="vir65 deletion"
FT /replace=""
FT -10_signal 25907..25912
FT /note="early promoter Pe"
FT variation 25909..25983
FT /note="vir40 deletion"
FT /replace=""
FT variation 25913
FT /note="c1 mutation"
FT /replace="c"
FT misc_feature 25916..25923
FT /note="O2 repressor binding site"
FT variation 25922
FT /note="vir6 mutation"
FT /replace=""
FT -10_signal complement(25962..25967)
FT /note="Pc promoter"
FT -35_signal complement(25982..25987)
FT /note="Pc promoter"
FT CDS 26005..26280
FT /codon_start=1
FT /db_xref="SWISS-PROT:P07695"
FT /transl_table=11
FT /gene="cox"
FT /function="repressor of Pc; required for prophage
FT excision; inhibits integration; activates P11 promoter of
FT satellite phage P4"
FT /product="Cox"
FT /protein_id="AAD03299.1"
FT /translation="MSKQVTLMTDAIPYQEFAKLIGKSTGAVRRMIDKGKLPVIDMTDP
FT QSASGRAGEYWVYLPAWNNGLKLAYESRPKEIRDGWLMWLGLGEPR"
FT variation 26069
FT /note="cox3 mutation"
FT /replace="a"
FT /gene="cox"
FT variation 26129
FT /note="cox2 mutation"
FT /replace="c"
FT /gene="cox"
FT variation 26164
FT /note="cox4 mutation"
FT /replace="a"
FT /gene="cox"
FT CDS 26291..26461
FT /codon_start=1
FT /db_xref="SPTREMBL:Q38498"
FT /transl_table=11
FT /gene="orf78"
FT /product="Orf78"
FT /protein_id="AAD03300.1"
FT /translation="MNEPRCIAQLLRNESPRAIDFTITHGKGRKGIIIRTKKQSPLKKA
FT LTFLKSRRVWK"
FT CDS 26458..26958
FT /codon_start=1
FT /db_xref="SWISS-PROT:P07696"
FT /transl_table=11
FT /gene="B"
FT /function="essential protein; DNA replication; required
FT for lagging strand synthesis"
FT /product="gpB"
FT /protein_id="AAD03301.1"
FT /translation="MTVMTLNLVEKQPAAMRRIIGKHLAVPRWQDTCDYYNQMMERERL
FT TVCFHAQLKQRHATMCFEEMNDVERERLVCAIDELRGAFSKRRQVGASEYAYISFLTVS
FT QRRTLFMHAGLTEKEFNQPYWRINEESCYWRDALFRALRELFSLFEYAPTILTSVKPEQ
FT YLH"
FT variation 26525
FT /note="rlb1 mutation"
FT /replace="g"
FT /gene="B"
FT variation 26611
FT /note="Bam213 mutation"
FT /replace="t"
FT /gene="B"
FT variation 26722
FT /note="Bam116 mutation"
FT /replace="t"
FT /gene="B"
FT variation 26762
FT /note="Bts6 mutation"
FT /replace="t"
FT /gene="B"
FT variation 26914
FT /note="Bts40 mutation"
FT /replace="t"
FT /gene="B"
FT terminator 26980..27007
FT /note="putative rho-independent terminator"
FT CDS 27022..27246
FT /codon_start=1
FT /db_xref="SWISS-PROT:Q06422"
FT /transl_table=11
FT /gene="orf80"
FT /product="Orf80"
FT /protein_id="AAD03302.1"
FT /translation="MHTVSENQCGIYALLLQQARTEAQADAATRFSSHLDAMIRHITKA
FT ELSRVEIVELLSQESEKFHNIGLSRGEVL"
FT CDS 27246..27548
FT /codon_start=1
FT /db_xref="SWISS-PROT:Q06423"
FT /transl_table=11
FT /gene="orf81"
FT /product="Orf81"
FT /protein_id="AAD03303.1"
FT /translation="MFCSRAVVLLNNALKIAVMKNGDLSLIQLGLDKEKREITESVIAI
FT YQSELNLLSDVVNLLVKRAVFHKQISSVDELTKLTTEIASYCADEFKKLNDKRNW"
FT CDS 27548..27772
FT /codon_start=1
FT /db_xref="SWISS-PROT:Q06424"
FT /transl_table=11
FT /gene="orf82"
FT /product="Orf82"
FT /protein_id="AAD03304.1"
FT /translation="MPDNVDFIQEQQAELLERQINAARVKHCGASALVCEECDAPIPAA
FT RRAAYPSATRCVSCQSVFEAKNKHYRRTA"
FT CDS 27769..28044
FT /codon_start=1
FT /db_xref="SWISS-PROT:Q06425"
FT /transl_table=11
FT /gene="orf83"
FT /product="Orf83"
FT /protein_id="AAD03305.1"
FT /translation="MSIRIEIGERYVVTSDSFQFILHEKKRAESGKNAGQEWLAVVGYY
FT PKLSQLVSGLMHHDILTGSAKSFADLNVQVEQLSKRCSEAFGSYGR"
FT CDS 28034..30319
FT /codon_start=1
FT /db_xref="SWISS-PROT:Q06419"
FT /transl_table=11
FT /gene="A"
FT /function="essential protein; DNA replication; makes
FT site-specific nick at origin of replication"
FT /product="gpA"
FT /protein_id="AAD03306.1"
FT /translation="MAVKASGRFVPPSAFAAGTGKMFTGAYAWNAPREAVGRERPLTRD
FT EMRQMQGVLSTINRLPYFLRSLFTSRYDYIRRNKSPVHGFYFLTSTFQRRLWPRIERVN
FT QRHEMNTDASLLFLAERDHYARLPGMNDKELKKFAARISSQLFMMYEELSDAWVDAHGE
FT KESLFTDEAQAHLYGHVAGAARAFNISPLYWKKYRKGQMTTRQAYSAIARLFNDEWWTH
FT QLKGQRMRWHETLLIAVGEVNKDRSPYASKHAIRDVRARRQANLEFLKSCDLENRETGE
FT RIDLISKVMGSISNPEIRRMELMNTIAGIERYAAAEGDVGMFITLTAPSKYHPTRQVGK
FT GESKTVQLNHGWNDEAFNPKDAQRYLCHIWSLMRTAFKDNDLQVYGLRVVEPHHDGTPH
FT WHMMLFCNPRQRNQIIEIMRRYALKEDGDERGAARNRFQAKHLNQGGAAGYIAKYISKN
FT IDGYALDGQLDNDTGRPLKDTAAAVTAWASTWRIPQFKTVGLPTMGAYRELRKLPRGVS
FT IADEFDERVEAARAAADSGDFALYISAQGGANVPRDCQTVRVARSPSDEVNEYEEEVER
FT VVGIYAPHLGARHIHITRTTDWRIVPKVPVVEPLTLKSGIAAPRSPVNNCGKLTGGDTS
FT LPAPTPSEHAAAVLNLVDDGVIEWNEPEVVRALRGALKYDMRTPNRQQRNGSPLKPHEI
FT APSARLTRSERLQITRIRVDLAQNGIRPQRWELEALARGATVNYDGKKFTYPVADEWPG
FT FSTVMEWT"
FT variation 28649
FT /note="Aam127 mutation"
FT /replace="t"
FT /gene="A"
FT variation 29528
FT /note="Ats54 mutation"
FT /replace="a"
FT /gene="A"
FT rep_origin 29892
FT /evidence=EXPERIMENTAL
FT /note="nick site at ori"
FT CDS 30316..30645
FT /codon_start=1
FT /db_xref="SWISS-PROT:Q06426"
FT /transl_table=11
FT /gene="orf91"
FT /product="Orf91"
FT /protein_id="AAD03307.1"
FT /translation="MMAKIHEVKLHAKYFDLVLEGKKRAEFRKKDRNYERGDTLILHEW
FT VQGVFTGRKVEARITDVTDLSDWLEDYVLLHRILGEILPLTVKLAVSSTFFINLRRRTV
FT AIYLL"
FT CDS complement(30684..31445)
FT /codon_start=1
FT /db_xref="SPTREMBL:P79670"
FT /transl_table=11
FT /gene="tin"
FT /function="nonessential protein; lysogenic conversion;
FT blocks growth of T-even phages"
FT /product="Tin"
FT /protein_id="AAD03308.1"
FT /translation="MNNMDIVKAVKDGMKKSADATYLMDFRSGAKINTEYVATVSIGLS
FT LLEIKSFRHGDYKVIFEYHTNKFINATVPLSKRSDPQKIFSKKTVRKNTNTTRSGRIDI
FT AILDSRPFFDIPICAIEVKGNAPCKSLLFSDIRRNLEYFKHTGPTGNSSLGLALNCSFH
FT SYNDSTKKNYCTTIHHKEDMIRKLKNKYKKYISELNEEIPDDISVTIDVFTAAEHLLSP
FT DADQYEYESHIDDLHLTLGVMVIFERKSILN"
FT variation 30992..33334
FT /note="del4 deletion"
FT /replace=""
FT variation 31022..33454
FT /note="del1 deletion"
FT /replace=""
FT CDS complement(31620..33380)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P13520"
FT /transl_table=11
FT /gene="old"
FT /function="nonessential protein; lysogenic conversion;
FT exonuclease; blocks growth of phage lambda"
FT /product="Old"
FT /protein_id="AAD03309.1"
FT /translation="MTVRLASVSISNFRSCKSTSAILRPFTALVGYNNAGKSNIILAIK
FT WLLDGSLISESDVYDPTHPVSVEGVIQGITDDTLSLLTEENQQKIAPFIIDGTLTFARR
FT QEFNKETGKAKKSLDVYDGTTWKKNPGGIDGAISNIFPEPIHIPAMSDAVEDSTKCKNT
FT TTIGKILSAIVSEIKQEHEEKFSKNISEIGKYLSHNGENRLESLNKIDSGVNKKVNQFF
FT PDVSVKLHFPTPTLDEIFKSGTLKVFESREDEPVMRDISRFGHGTQRSIQMALIQYLAE
FT IKKENSESKKSNTLIFIDEPELYLHPSAINSVRESLVTLSESGYQVIISTHSASMLSAK
FT HAANAIQVCKDSNGTIARKTISEKIEELYKSSSPQLHSAFTLSNSSYLLFSEEVLLVEG
FT KTETNVLYALYKKINGHELNPSKICIVAVDGKGSLFKMSQIINAIGIKTRILADCDFLS
FT NILLTEHKDLLSTECDNLLTALIESINSGELSLNTKVTTFESFKSISSKDFIKICNHEK
FT TQKHIHEIHQKLKDNGIYIWKSGDIEAVYGFGKKQTEWDSLLDCLCDESKDVRAVIKKY
FT DEMEDFIKWI"
FT variation complement(31991)
FT /note="oldam11 mutation"
FT /replace="a"
FT /gene="old"
FT variation complement(32576)
FT /note="old1 mutation"
FT /replace="t"
FT /gene="old"
FT misc_feature complement(33424)
FT /note="transcript start 1; old-tin mRNA"
FT misc_feature complement(33426)
FT /note="transcript start 2; old-tin mRNA"
FT misc_feature 33575..33593
FT /note="cosR; right cohesive end"
SQ Sequence 33593 BP; 8398 A; 7983 C; 8870 G; 8342 T; 0 other;
ggcgaggcgg ggaaagcact gcgcgctgac ggtggtgctg attgtatttt ttcagcgtct 60
cagcgcgtcg tgacggcact tagtctgccc gttgaggcgt tgtgtgtctg cggggtgttt 120
tgtgcggtgg tgagcgtgtg aggggggatg acggggtgta aaaaagccgc ccgcaggcgg 180
cgatgttcag tcgttgtcag tgtccagtga gtagttttta aagcggatga cctcctgacc 240
gagccagccg tttatctcgc ggatcctgtc ctgtaacggg ataagctcat tgcggacaaa 300
gacctttgcc actttctcaa tatcacccag cgacccgacg ttctccggct tgccacccat 360
caactgaaag gggatgcggt gcgcgtccag caggtcagcg gcgctggctt ttttgatatt 420
aaaaaaatcg tccttcgtcg ccacttcact gagggggata attttaatgc cgtcggcttt 480
cccctgtggg gcatagagaa acaggttttt aaagttgttg cggcctttcg acttgaccat 540
gttttcgcga agcatttcga tatcgttgcg atcctgcacg gcatcggtga catacatgat 600
gtatccggca tgtgcgccat tttcgtaata cttgcggcgg aacaacgtgg ccgactcatt 660
cagccaggca gagttaaggg cgctgagata ttccggcagg ccgtacagct cctgattaat 720
atccggctcc agcaggtgaa acacggagcc gggcgcgaag gctgtcggct cgttgaagga 780
cggcacccac cagtaaacat cctcttccac gccacggcgg gtatattttg ccggtgaggt 840
ttccagtctg atgaccttac cggtggtgct gtaacgcttt tccagaaacg cattaccgaa 900
caccagaaaa tccagcacaa agcggctgaa atcctgctgg gaaagccatg gatgcgggat 960
aaatgtcgag gccagaatat tgcgtttgac gtaaatcggc gagctgtgat gcacggcagc 1020
ccgcaggctt tttgccagac cggtaaagct gaccggtggc tcataccatc tgccgttact 1080
gatgcactcg acgtaatcca gaatgtcacg gcggtcgagt accggcaccg gctcaccaaa 1140
ggtgaatgcc tccattttcg ggccgctggc ggtcattgtt tttgccgcag gttgcggtgt 1200
tttccctttt ttcttgctca tcagtaaaac tccagaatgg tggatgtcag cggggtgctg 1260
ataccggcgg tgagtggctc atttaacagg gcgtgcatgg tcgcccaggc gaggtcggcg 1320
tggctggctt cctcgctgcg gctggcctca taggtggcgc tgcgtccgct gctggtcatg 1380
gtcttgcgga tagccataaa cgagctggtg atgtcggtgg cgctgacgtc gtattccaga 1440
cagccacggc ggataacgtc ttttgccttg agcaccattg cggttttcat ttccggcgtg 1500
tagcggatat cacgcgcggc gggatagaac gagcgcacga gctggaacac gccgacaccg 1560
aggccggtgg catcaatacc gatgtattcg acgttgtatt tttcggtgag tttgcggatg 1620
gattccgcct gggtggcaaa gtccatgcct ttccactggt gacgctcaag tattctgaat 1680
ttgccaccgg ccaccaccgg cggtgccagt accacgcatc cggcgctgtc gccacggtgt 1740
gacgggtcgt aaccaatcca taccgggcgg gagccgaacg gattggcggc aaacggcgca 1800
tagtcttccc attcttccag cgtgtcgacc atgcagcgtt gcagctcctc gaacgggaac 1860
accgatgcct tgtcgtcaac aaattcacac atgaacaggt ttttaaaatc gtcggcgctg 1920
ttttcgcgtt tgagctgctc aatgtcgaac agcgtgcagc cgcctttcag ggcgtcctca 1980
atggtgacaa tctgtcgcca ctggccgtcc gcacagagaa gcccaccggc aagggcgtta 2040
tgactgacgt cgatttccac gcgttcggcg gcgctggcgc gtccccggtt aaacagttca 2100
cccgaccaga acgggtaggc gtcgtgcgcc agcgtggacg gggtggagaa ataggtcgag 2160
cgcaggtgac tctgtgaggc catacctgat gccaccttac gcagtacctg aaaattcggg 2220
atccagaaaa tctcatcgac gtacaggtcg ccgttatgac tctgcgcggt gttggagttg 2280
gtgccgagaa aaatcagttt tgcgccgtta ttgcccagga caatcgggtc accggtcagg 2340
tcaacgtcaa ccagacgggc aaaggcgatg atgtattcgc ggaacacata cgcctgtgtt 2400
ttactggccg acagaaaaat ctggttatga ccggttttca gggcacgcag cagcgcctcg 2460
cgggaaaaat aaaacgtcgc gccaatctgg cgggatttca ggatatcgcg gatgcggtgc 2520
tcaagcccgg cacgatacca gtgcagctga tagtcgaaag actgctcaaa gaaaatctgc 2580
tccagctttt cgatggcctc gtcactgaaa aaattctttt tcggtttgcg ccgtccgcct 2640
ttgttacggt tagcgacgtt cggattaagg tctgcctcgt tgccggtctg gctgtagcgg 2700
ttgacccgtg ccagtcgttc aatctggcgt cccagcaggt caatttcctt gaagtcaccg 2760
ccggttttct gtggtttgat gatgagctgg gtcagccgcg cttccagact catttcgaca 2820
cggctgatgg gggcaacgct gtcccagccg tcgcgctgtt tccagctctg cactgtcggg 2880
cgtttcatct gcaacatggc ggcaatctgc ggcacggaaa acccctgcca gtacagcagc 2940
gccgcctgac gacgcgggtc gtgtaaaaga gtggtgtctg tggtgatggt catgaatacc 3000
tcgccgtgat gaatacacgg caaggctact gagtcgcgcc ccgcgattcg ctaaggtgct 3060
gttgtgtcag tgataagcca tccgggactg atggcggagg atgcgcatcg tcgggaaact 3120
gatgccgaca tgtgactcct ctaatcacta ttcaggactc ctgacaatgg caaaaaaagt 3180
ctcaaaattc tttcgtatcg gcgttgaggg tgacacctgt gacgggcgtg tcatcagtgc 3240
gcaggatatt caggaaatgg ccgaaacctt tgacccgcgt gtctatggtt gccgcattaa 3300
cctggaacat ctgcgcggca tcctgcctga cggtattttt aagcgttatg gcgatgtggc 3360
cgaactgaag gccgaaaaga ttgacgatga ttcggcgctg aaaggcaaat gggcgctgtt 3420
tgcgaaaatc accccgaccg atgaccttat cgcgatgaac aaggccgcgc agaaggtcta 3480
cacctcaatg gaaattcagc cgaactttgc caacaccggc aaatgttatc tggtgggtct 3540
ggccgtcacc gatgacccgg caagcctcgg cacggaatac ctggaattct gccgcacggc 3600
aaaacacaac cccctgaacc gcttcaaatt aagccctgaa aacctgattt cagtggcaac 3660
gcctgttgag ctggaatttg aagacctgcc tgaaaccgtg ttcaccgccc tgaccgaaaa 3720
ggtgaagtcc atttttggcc gcaaacaggc cagcgatgat gcccgtctga atgacgtgca 3780
tgaagcggtg accgctgttg ctgaacatgt gcaggaaaaa ctgagcgcca ctgagcagcg 3840
cctcgctgag atggaaaccg ccttttctgc acttaagcag gaggtgactg acagggcgga 3900
tgaaaccagc caggcattca cccgcctgaa aaacagtctc gaccacaccg aaagtctgac 3960
ccagcagcgc cgcagcaaag ccaccggcgg tggcggtgac gccctgatga cgaactgctg 4020
accggcgtca gtcagtccgg gaaaaccttc acgattaacc cttaatttca ggaaaaacta 4080
tgcgccagga aacccgcttt aaatttaatg cctacctgtc ccgtgttgcc gaactgaacg 4140
gcatcgacgc cggtgatgtg tcgaaaaaat tcaccgttga accgtcggtc acccagaccc 4200
tgatgaacac catgcaggag tcctctgact ttctgacccg catcaatatt gtgccggtca 4260
gcgaaatgaa aggggaaaaa attggtatcg gtgtcaccgg ctccatcgcc agcactaccg 4320
acactgccgg tggtaccgag cgtcagccga aggacttctc gaagctggcg tcaaacaagt 4380
acgaatgcga ccagattaac ttcgattttt atatccgcta caaaacgctg gacctgtggg 4440
cgcgttatca ggatttccag ctccgtatcc gtaacgccat tatcaaacgc cagtcccttg 4500
atttcatcat ggccggtttt aacggcgtga agcgtgccga aacctctgac cgcagcagca 4560
atccgatgtt gcaggatgtg gcggtcggct ggctgcagaa ataccgcaat gaagcaccgg 4620
cgcgcgtgat gagcaaggtc actgacgagg aaggccgcac cacctctgag gttatccgcg 4680
tgggtaaggg cggtgattat gccagccttg atgcactggt gatggatgcg accaacaacc 4740
tgattgaacc gtggtatcag gaagaccctg accttgtggt gattgtgggg cgtcagctac 4800
tggcggacaa gtatttcccc atcgtcaaca aggagcagga caacagcgaa atgctggccg 4860
ctgacgtcat catcagccag aaacgcatcg gtaacctacc agcggtacgc gtcccgtact 4920
tcccggcgga tgcgatgctc atcacgaagc tggaaaacct gtccatctac tacatggatg 4980
acagccatcg ccgcgtgatt gaggaaaacc cgaaactcga ccgcgtggag aactacgagt 5040
caatgaacat tgattacgtg gtggaagact acgccgccgg ttgtctggtg gaaaaaatca 5100
aggtcggtga cttctccaca ccggctaagg cgaccgcaga gccgggagcg taaccgatga 5160
cgagtcccgc acagcgccac atgatgcggg tctcggcagc gatgaccgcg cagcgggaag 5220
ccgccccgct gcgacatgca actgtctatg agcagatgct ggttaagctc gccgcagacc 5280
agcgcacact gaaagcgatt tactcaaaag agctgaaggc cgcaaaaaaa cgcgaactgc 5340
tgccgttctg gttgccgtgg gtgaacggcg tgctggagct gggcaaaggt gcacaggatg 5400
acattctgat gacggtcatg ctgtggcgtc tggataccgg cgatattgcc ggtgcgctgg 5460
agattgcccg ttatgccctg aagtacggtc tgaccatgcc gggtaaacac cgccgtaccc 5520
cgccgtacat gttcaccgag gaggtagcgc ttgcggccat gcgcgctcac gctgccggtg 5580
agtctgtgga tacccgcctg ctgacggaga cccttgaact gaccgccacg gctgacatgc 5640
ctgatgaagt gcgcgcaaag ctgcacaaaa tcaccggtct gtttctgcgt gacggtggtg 5700
atgccgccgg tgcgctggcg cacctgcaac gtgcgacaca gctcgactgt caggcaggcg 5760
tcaaaaaaga gattgaacga ctggagcggg agctgaaacc gaagccggag ccgcagccca 5820
aagcggccac ccgcgccccg cgtaagaccc ggagcgtgac accggcaaaa cgtggacgcc 5880
cgaaaaagaa agccagttaa caaccgaatg cgccccgcgc cagggcggca cgccggtcag 5940
tgacggtgaa tcacctgaca ctgcaccggc gtccaccgcc cgacttttca gaggtagtca 6000
tgatgacgct gattattccg cgaaaggagg ctcccgtgtc cggtgagggt acggtggtca 6060
tcccgcaacc ggcaggcgac gagccggtga ttaaaaacac gttctttttt cccgatatcg 6120
acccgaagcg cgtccgggaa cgtatgcgcc ttgagcagac cgtcgccccc gcccgtctgc 6180
gtgaggccat caagtcaggc atggctgaaa cgaatgcgga gctgtacgag taccgcgaac 6240
agaaaattgc cgccggtttt acgcgtctgg ctgacgtccc ggcggacgat atcgacggtg 6300
aaagcatcaa ggttttttac tacgagcgcg ccgtgtgtgc gatggcgacc gcgtcgcttt 6360
atgagcgtta tcgcggtgtg gatgccagtg cgaaaggcga caagaaggct gacagcattg 6420
acagcaccat tgatgagctg tggcgggata tgcgctgggc ggtggcgcgc atccagggca 6480
agccgcgctg catcgtgagt caaatctgat gaagaccttt gcgctacagg gcgacacgct 6540
cgacgccatt tgtgtccgct attacgggcg cactgagggc gtggttgaga ccgtgctcgc 6600
cgcaaatccg ggactggctg aactgggggc ggtgctgcca cacggcaccg ccgtcgaact 6660
gcccgacgtt cagaccgcgc ccgtggctga aactgtcaat ctgtgggagt aacgcatgac 6720
agcagaagaa aaaagcgtcc tgtcgctttt catgattggg gtgctgattg ttgtcggcaa 6780
ggtgcttgcc ggtggtgaac ctatcacccc gcgtctgttt atcgggcgca tgttgctcgg 6840
tggttttgtc tcgatggttg ccggtgttgt tctggtgcag tttcctgacc tgtcactgcc 6900
agcggtgtgc ggcatcggct ccatgctggg tatcgccggt tatcaggtga ttgagattgc 6960
cattcagcgc cgctttaagg gcagggggaa acagtaatgc cggtaattaa cacgcatcag 7020
aatatcgccg cctttctcga catgctggcc gtgtccgaag ggacggcgaa tcatccactg 7080
acgaaaaacc ggggctatga cgtgatagtc accggactgg acgggaagcc ggaaattttc 7140
accgactaca gtgaccaccc gttcgcacat ggccgaccgg cgaaggtgtt taaccgtcgc 7200
ggtgaaaaat ccacggcctc cggtcgctat cagcagcttt acctgttctg gccgcattac 7260
cgcaaacagc ttgccctgcc ggatttcagt ccgttgtcac aggacagact cgccattcag 7320
ttgatccgcg aacgcggagc actggatgac atccgggcgg gacgcattga gcgcgccatt 7380
tcacgctgtc gcaatatctg ggcgtccctg ccgggtgccg gttacggtca gcgtgagcat 7440
tcactggaaa aactggtcac cgtctggcgt accgctggcg gcgtaccggc ttaaacggag 7500
taaataccat gaagaaatta tccctttcac tgatgctgaa cgtgtcgctg gcgctgatgc 7560
tggcactgtc cctgatttac ccgcagagcg tggccgtcaa ttttgtcgct gcctgggcga 7620
ttctggcgac ggttatctgt gtggttgccg gtggtgtggg cgtgtatgcc actgagtatg 7680
tgctggaacg ctacgggcgg gagctgccgc cggaatcgct ggccgtgaag attgtcacgt 7740
cgctgttttt gcagccggtg ccgtggcgca gacgggcggc ggctctggta gtggtggtgg 7800
cgacgtttat ctcgctggtc gctgccgggt ggatttttac cgcgctgatt tatcttgtgg 7860
tgtcgctgtt tttccggctg atacgtaaag cctgtcgtca gcgtcttgag gggcgggaac 7920
catgtcaagg ctgatgattg tgctggtcgt gttgttatcg ctggcggtgg ccggtctgtt 7980
tctggtgaaa cacaaaaatg ccagcctgcg cgcctcgctg gacagggcga acaacgtcgc 8040
cagcggtcag cagacgacca tcaccatgct gaaaaatcag cttcatgttg cgctcaccag 8100
ggcagataaa aacgagctgg cgcaggtggc actgcgtcag gaactggaga acgccgcgaa 8160
acgtgaagca cagcgcgaga aaaccatcac gaggttactt aatgagaacg aagattttcg 8220
ccgctggtac ggtgctgacc tgcctgatgc tgtgcgccgg ttgcaccagc gccccgcctg 8280
caccgacgcc agtgattgtc cccaacgcat gcccgaaagt gagcctttgc ccgatgccgg 8340
gcagtgaccc gcagacgaac ggcgatttaa gtgccgatat ccggcagctt gagaacgcgc 8400
tggcacgctg tgccagccag gtaaaaatga ttaaacactg tcaggacgaa aacgatgctc 8460
aaacccgaca gcctgcgcag ggcgctgact gatgccgtca cggtgctgaa aactaacccc 8520
gatatgctgc ggatattcgt ggataacggg agtattgcct ccacactggc ggcgtcgctg 8580
tcattcgaaa agcgttacac gctcaatgtg attgtgaccg actttaccgg tgattttgac 8640
ctgctcattg tgccggtgct ggcgtggctg cgggaaaatc agcccgacat catgaccacc 8700
gacgaaggcc agaaaaaggg cttcacgttt tatgcagaca tcaacaatga cagcagcttt 8760
gatatcagta tcagcctgat gctgaccgag cgcacgctgg tcagtgaggt ggacggcgca 8820
ctgcatgtga agaatatctc ggaacccccg ccgccggagc cggtcacccg cccgatggag 8880
ctgtatatca atggcgaact ggtgagtaag tgggatgaat gagtttaagc gttttgaaga 8940
ccggctgacc ggactgattg aatcgctgtc accgtcaggg cgtcggcgac tgagtgccga 9000
actggcgaaa cgtctgcggc agagtcagca gcgtcgggtg atggcacaga aagccccgga 9060
cggcacaccc tacgcgccac gccagcagca gagcgtcaga aaaaagaccg gtcgcgttaa 9120
gcgaaaaatg tttgcgaaac ttattaccag tcgttttttg catatccgtg ccagcccgga 9180
gcaggcatca atggaatttt acggcgggaa gtcgccgaaa atcgccagtg tgcatcagtt 9240
tggtctgtcg gaagaaaacc ggaaagacgg taagaaaatt gattatccgg cgcgtcccct 9300
gctcggcttt accggtgagg atgtgcagat gattgaagag attatcctgg ctcaccttga 9360
gcgttagttt tatccaggca gaggctgatg cgcaattaaa cattgagcgg ccatgctggt 9420
cgctcaatgt ttagaggttt atgagtgatt tttatttgat gctttgtatt ctaaaacctt 9480
cttattggcg taaaagaatt ttgtatatga caggaatata accagacctg aagtgaaata 9540
gacgagggat agtattaata atgctttttt gtgactgtta ttatctttaa tctcctggct 9600
taaccattcg gagtcctcct cgtttagctg taagagctta ttgcaggcga tctcaggaag 9660
tgtgtctttt ataaatacgt tttgcagtct cttgcaatcg gcaaggctat aagttttatt 9720
aaattcaact gctttatttt tgaaggataa aagaactttg tcactataaa catagtacat 9780
catgttttta tatggtatgc ctgtggcatc ccttactata acggattgtt cgttgtgtat 9840
gtaacatgcg aggagaatgt aaaaaatact ggccagaatt acaattattg ttttaattat 9900
gtgtggtggt tttgttatgt caccccagat acgagtaagg aaaaaatacg atgtttttag 9960
ttttccatca atcagtccct gctgtatcat tctcacattt tcaatgcctg atacattgat 10020
tccgttaatt attttaaata gttgaatgtc gcgccactcg cggtcaagtc tttttaattt 10080
tttgtctgaa tatccaaaat tgaaataatg tgcaataagc ctcataaggt tacttttacc 10140
aaagctaaaa aatgctaata ctgcaaagct acaaaggaaa aaaacgatta gcccccacac 10200
attagtcaca ttatagctga ccattacgct ctccttgaat gttgtctggt agttctacaa 10260
atgaatccag atagcataac ttttatatat tgtgcaatct cacatgcatg aacactctcg 10320
caaatattca ggaactcgcg cgcgcactgc gcaacatgat tcgcactggc attatcgtcg 10380
aaaccgacct taacgccggt cgctgccgcg tgcagaccgg cggcatgtgc accgactggc 10440
ttcagtggct gacccatcgc gcaggacgtt cgcgcacatg gtgggcacct tccgtggggg 10500
aacaggtgct gattctggcc gtgggtggtg aactcgacac ggcgttcgtt ctgccgggga 10560
tttattccgg cgataacccc tcgccgtctg tgtcggcgga tgccctgcat atccgtttcc 10620
ctgacggggc ggtgattgaa tatgaacccg aaaccagtgc actcacggta agcggaatta 10680
aaacggccag cgtgacggct tccggttctg ttactgccac ggtgccggtg gtcatggtga 10740
aagcatcaac ccgcgtcacc ctggacaccc cggaggtggt ctgcaccaac aggctgatta 10800
ccggcacgct ggaagtgcag aaaggcggga cgatgcgcgg caacattgaa cacaccggcg 10860
gtgaactctc atcaaacggt aaggtactgc atacccataa acaccccggc gacagcggcg 10920
gcacaaccgg gagtccttta tgacagcgcg ttatctcgga atgaatcgca gtgatggcct 10980
gactgtcact gaccttgagc atatcagcca gagtatcggc gatatcctgc gcacaccggt 11040
cggctcacgg gtgatgcgtc gtgattacgg ctcgttgctg gcgtcaatga ttgaccagcc 11100
gcagaccccg gcgcttgagt tgcagattaa agtcgcctgt tacatggcag tgctgaaatg 11160
ggaaccccgc gtcaccctgt catccgtcac cacggcgcgc agttttgacg ggcgaatgac 11220
ggtcacgtta accggccagc acaacgacac cggccagcca ctttcattaa ccatccctgt 11280
gagttgaaac catgccgatt atcgacctga accagctacc cgcaccggat gtggtcgagg 11340
agctggactt tgaaagcatt ctcgctgaac gcaaggcgac actgatttcc ctttacccgg 11400
aagatcagca ggaggcggtc gcccgtaccc tgacactgga atctgagcct ctcgtcaaac 11460
tgctggaaga aaatgcttat cgtgagctta tctggcgtca gcgtgtgaat gaggccgcac 11520
gggcggtgat gctggcctgt gccgccggta atgaccttga tgtgattggt gccaattaca 11580
acaccacgcg cctgactatc accccggcag atgattcgac catcccgccg acaccggcag 11640
tgatggaatc tgacaccgat tatcgtctgc gtattcagca ggcttttgag ggcttaagcg 11700
tcgccgggtc agtgggagcc tatcagtatc atggtcgcag tgctgacggg cgtgtcgcgg 11760
atatttctgt caccagtccg tctccggcct gtgtcaccat ctctgtgctg tcacgtgaaa 11820
ataacggcgt cgcatccgaa gacctgctgg ctgtggtgcg taacgccctt aatggcgagg 11880
acgtcaggcc ggtggccgac cgcgtgaccg tgcagtctgc cgccatcgtt gaataccaga 11940
taaacgccac gctttacctt taccctggtc ccgaaagcga acccatccgc gctgccgctg 12000
tgaaaaagct ggaagcgtat atcacggcac agcaccggct ggggcgcgac atccgtctgt 12060
ctgccattta tgccgctttg catgtggaag gtgtgcagcg tgtcgaactg gctgcaccac 12120
tggccgacat cgtgctcaac agtacgcagg cgtctttctg taccgaatac cgcgtcgtga 12180
ccggaggctc ggatgagtga ttcgcgactg ctgccgaccg gctcatcacc gcttgaggtc 12240
gccgccgcaa aagcctgtgc ggaaattgaa aaaacgccgg tcagtattcg tgaactgtgg 12300
aacccggaca cctgtccggc aaatctgctg ccgtggctgg cgtgggcgtt ttcggtcgac 12360
aggtgggatg aaaagtggcc ggaagcgaca aaacgcgccg ttatccgcga tgcctatttc 12420
atccactgtc ataagggcac gataggtgca atccggcgtg tggtggagcc gctcggctat 12480
ctcatcaacg tgacggagtg gtgggaaaac agtgacccgc ccggcacctt ccggcttgat 12540
attggtgtac tggaaagcgg tatcacagag gcaatgtatc aggaaatgga acggctgatt 12600
gctgatgcca aacctgcaag ccgtcacctt attggcctga acattacccg ggacattccc 12660
ggctatctgt tcgccggtgg tgtggcttac gacggcgatg taattacggt ttaccccgga 12720
taagtgagga ataatgagca taaaattcag aaccgttatc accactgccg gtgcagcaaa 12780
gctggcagcg gcaaccgcgc cgggaaggcg gaaggtcggc attaccacga tggccgtcgg 12840
ggatggcggt ggtaaattgc ctgtcccgga tgccggacag accgggctta tccatgaagt 12900
ctggcgacat gcgctgaaca aaatcagcca ggacaaacga aacagtaatt atattatcgc 12960
cgagctggtt attccgccgg aggtgggcgg tttctggatg cgtgagcttg gcctgtacga 13020
tgatgcggga acgttaattg ccgtggcgaa catggccgaa agctataagc cagcccttgc 13080
cgaaggctca ggacgttggc agacctgtcg catggtcatc atcgtcagca gtgtggcctc 13140
agtggagctg accattgaca ccacaacggt gatggcgacg caggattacg ttgatgacaa 13200
aattgcagag cacgaacagt cacgacgtca cccggacgcc tcgctgacag caaaaggttt 13260
tactcagtta agcagtgcga ccaacagcac gtctgaaaca ctggccgcaa cgccgaaagc 13320
ggtaaaggcc gcgtatgacc tggctaacgg gaaatatacc gcacaggacg ccaccacagc 13380
gcgaaaaggc cttgtccagc ttagtagcgc caccaacagc acgtctgaaa cgctcgccgc 13440
aacaccaaaa gccgttaaga cggtaatgga tgaaacgaac aaaaaagcgc cattaaacag 13500
ccctgcactg accggaacgc caacgacgcc aactgcgcga cagggaacga ataatactca 13560
gatcgcaaac acggctttcg ttatggccgc gattgccgcc cttgtagact cgtcgcctga 13620
cgcactgaat acgctgaacg agctggcggc ggcgctgggc aatgacccga attttgctac 13680
caccatgact aatgcgcttg cgggtaagca accgaaagat gctaccctga cggcgctggc 13740
ggggcttgct actgcggcag acaggtttcc gtattttacg gggaatgatg ttgccagcct 13800
ggcgaccctg acaaaagtcg ggcgggatat tctggctaaa tcgaccgttg ccgccgttat 13860
cgaatatctc ggtttacagg aaacggtaaa ccgagccggg aacgccgtgc aaaaaaatgg 13920
cgataccttg tccggtggac ttacttttga aaacgactca atccttgcct ggattcgaaa 13980
tactgactgg gcgaagattg gatttaaaaa tgatgccgat ggtgacactg attcatacat 14040
gtggtttgaa acgggggata acggcaatga atatttcaaa tggagaagcc gccagagtac 14100
cacaacaaaa gacctgatga cgttgaaatg ggatgcacta aatattcttg ttaatgccgt 14160
cattaatggc tgttttggag ttggtacgac gaatgcacta ggtggtagct ctattgttct 14220
tggtgataat gataccggat ttaaacagaa tggagacggt attcttgatg tttatgctaa 14280
cagtcagcgt gtattccgtt ttcagaatgg agtggctatt gcttttaaaa atattcaggc 14340
aggtgatagt aaaaagttct cgctatccag ctctaataca tccacgaaga atattacctt 14400
taatttatgg ggtgcttcca cccgtccagt ggttgcagag ttaggcgatg aggccggatg 14460
gcatttctat agccagcgaa atacagataa ctcggtaata tttgctgtta acggtcagat 14520
gcaacccagc aactggggaa attttgattc ccgctatgtg aaagatgttc gcctgggtac 14580
gcgagttgtt caattgatgg cgcgaggtgg tcgttatgaa aaagccggac acacgattac 14640
cggattaaga atcattggtg aagtagatgg cgatgatgaa gccatcttca ggccgataca 14700
aaaatacatc aatggcacat ggtataacgt tgcgcaggtg taagttatgc agcatttaaa 14760
gaacattaag tcaggtaatc caaaaacaaa agagcaatat cagctaacaa agaattttga 14820
tgttatctgg ttatggtccg aagacggaaa aaactggtat gaggaagtga agaactttca 14880
gccagacaca ataaagattg tttacgatga aaataatatt attgtcgcta tcaccagaga 14940
tgcttcaacg cttaatcctg aaggttttag cgttgttgag gttcctgata ttacctccaa 15000
ccgacgtgct gacgactcag gtaaatggat gtttaaggat ggtgctgtgg ttaaacggat 15060
ttatacggca gatgaacagc aacaacaggc agaatcacaa aaggccgcgt tactttccga 15120
agcggaaaac gttattcagc cactggaacg cgctgtcagg ctgaatatgg cgacggatga 15180
ggaacgtgca cgactggagt catgggaacg ttacagcgtt ctggtcagcc gtgtggatcc 15240
tgcaaatcct gaatggccgg aaatgccgca ataagttgta tgacctctgt tgtgaactta 15300
catatctatg gcacagagta aagcctaatc tgaagtccac tctgtgccaa aagcggacct 15360
tataaacaag aacaatggtc atatcagtgt gttttgattg catagctaac gtgcgtcttc 15420
ctgtacagaa tcataagatg atagggcata ggagatgatt attatcgcgt gttttaaaaa 15480
tagctttctg catcaagtgt cacttgcgaa gaggtattgg cgctatgatt ggcatcactc 15540
agttcagata atattttaaa tatttggtaa atgttcagat tacacaattc ggtctgcgtc 15600
ccgttaaaat tatctactat tagttattac tatgaggtga atggcaagtg ttttccactc 15660
gccatttttg ttttttattt ttttaaagcc tttccgacgt ttaaggattt tgccaagcca 15720
taaaatattt gatatttcat tcctgttttt atttttggtg agatatttgc gtaacttctt 15780
tctctaaaac accaacgtat aaacctatta ttatcttcgg ttgtttctat atagcatatt 15840
acattgagac caaaaagaaa ctgaaggaag tcatttgcag ttgtcatgaa ttttggtttt 15900
gttgtggaaa tggaactaat atgagtttca agttgtttat atgctaagag gtattcagcg 15960
taatcaaaag tatcttttcc agagaggaat tcaaagaact ttaaaaaaat ctcataatgt 16020
tcacttccat aataaaatga taaatgatct tttatttctc caagtaaata gttagagtaa 16080
tctctttgca tgctaggact ttcaaagtca tctagactaa attgattttt cccatcatca 16140
ccgctggcgt gtgatttgat aatttcgagc atccgtaata tatctcttgg gcgataatat 16200
gaccagcgaa ggaaattaat aaatgatgtg gggtggttat aattatcatg gacgttgggt 16260
gaatcccaag ggaaataatg gtcccatgcc tgtccctttt taagggccat gtcttgctga 16320
gtcctaagca gatgatctaa tacctcaaat aattgagagc tacggtggtt aacatattct 16380
gtccgccagt ccaagaatac tgaattatct ctgatttttg cgttttgatt ttgtaatcct 16440
atggattcaa atatatctgg cctgatcaag agaacggcct tcattctccc ttttcctccc 16500
tttatacttg ggaagaaatc gttgttaatc tcccagactg cgtgagctaa tccttttata 16560
cattctagat aatcatcgta tggaattgag gaagggcgga tatcaatacc atcgataaat 16620
aaaatatgat tttgagataa acgtatttgg ctaaaggcct cttcaaattt tttttgtata 16680
taaaataaat ttatctgaaa tctgctctca gaaaaagata aagactctct ttcttcacct 16740
tttaaggttg catgcttatg aagtagttcg gctgcaactt ttgactcttg aacaaaactg 16800
agggcttgaa ttatttctgg tgaaaatgcc ttaagataat actcatctat tgcatcatta 16860
agtgatgaga attttgaata atttagtaac tttgaaattt tcccttcttt atctaatact 16920
tgttttgata ttaataaata tagaataact ttccatatgc cagagaagtc agacaaattt 16980
aaatgctttt cagatttaag agtgataaat ttttgatatt ctgtctctct tatatattta 17040
gttgtagcta gcgtattgtt aatattgtta tttgagagat agatagagta tgcggtttta 17100
ccagtacctt tctctcctac aagaaacgat atatttggtt cacataatct agataggtga 17160
ttatcacgta tgaacacttt gttaagtaat tctttattct cccttctctt ataattttca 17220
gcatcagcat agccaagagt tagatctttg attggtatca ttattacctc aactaaagca 17280
attgaaaaac atatggttat aaaaacatag cgctgctctg tcgcatattg tggatatcaa 17340
catatgaaat gtaaaggaac tatttgtgga tgaatgaacc gaatcgctgt agcttcggta 17400
gtcatctttc agacttgtat aaatgaacaa cttccgcttc tcgctcaaag gaaactgtca 17460
gatttgatag cttttgggct atgtaaactg tcagtcggaa aatgagtgag tacaaatcag 17520
ggcaggtgag cgaattgccc gccttttctt taccggtggt tgtgctgtcg attagccaac 17580
cgggacaaat agcctgacat ctccggcgca actgaaaata ccactcaccc attaaccacg 17640
gagttaaacg gatgagtgac tatcatcacg gcgtgcaggt gctggagatt aacgagggca 17700
cccgcgtcat ttccaccgta tccacggcca ttgtcggcat ggtctgcacg gccagcgatg 17760
cagatgcgga aaccttcccc ctcaataaac ctgtgctgat taccaatgtg cagagcgcaa 17820
tttcaaaggc cggtaaaaaa ggcacgctgg cggcatcgtt gcaggccatc gctgaccagt 17880
caaaaccggt caccgttgtc atgcgcgtgg aagacggcac cggtgatgac gaggaaacga 17940
aactcgcgca gaccgtttcc aatatcatcg gcaccaccga tgaaaacggt cagtacaccg 18000
gactaaaagc catgctggcg gcggagtcgg taaccggtgt taaaccgcgt attctcggcg 18060
tgccgggact ggataccaaa gaggtggctg ttgcactggc atcagtctgt cagaagctgc 18120
gtgctttcgg gtatatcagc gcatggggct gtaaaaccat ttccgaggtg aaagcctatc 18180
gtcagaattt cagccagcgt gagctgatgg tcatctggcc ggatttcctc gcatgggata 18240
cggtcaccag taccaccgcc accgcgtatg ccaccgcccg tgcgctgggg ctgcgcgcta 18300
aaatcgacca ggagcagggc tggcataaaa cgctgtccaa tgtcggggtg aacggtgtta 18360
ccggcatcag cgcatctgta ttctgggatt tgcaggagtc cggcaccgat gctgacctgc 18420
ttaacgagtc aggcgtcact acgctgattc gccgcgacgg tttccgcttc tggggtaacc 18480
gtacctgctc tgatgacccg ctgttcctct ttgaaaacta cacccgcacc gcgcaggtcg 18540
tggccgacac gatggctgag gcgcacatgt gggcggtgga caagcccatc actgcaacgc 18600
tgattcgcga catcgttgac ggcatcaatg ccaaattccg tgagctgaaa acaaacggct 18660
atatcgtgga tgcgacctgc tggttcagcg aagaatccaa cgatgcggaa accctcaagg 18720
ccggaaaact gtatatcgac tacgactata caccggtgcc tcctctcgaa aacctgaccc 18780
tgcgccagcg tattaccgat aaatacctgg caaatctggt cacctcggtt aacagcaatt 18840
aaggagcctg accgatggca atgccgcgca aactcaagtt aatgaacgtc tttctgaacg 18900
gctacagcta tcagggcgtt gcaaagtccg tcacgctgcc aaaactgacc cgtaagctcg 18960
aaaactatcg cggtgcgggg atgaacggca gcgcaccggt agacctcggc cttgatgacg 19020
atgcgctgtc aatggagtgg tcgctcggtg gcttcccgga ttcggttatc tgggagcttt 19080
acgccgcaac cggtgtggat gccgtgccga ttcgttttgc aggctcttac cagcgcgacg 19140
ataccggcga aacggtggcc gtcgaagtgg tcatgcgtgg acgtcagaaa gaaatcgaca 19200
ccggcgaggg taaacaggga gaagacactg agtcgaaaat ctccgtggtc tgcacctatt 19260
tccggctgac gatggacggt aaggagctgg tcgaaattga caccatcaac atgattgaga 19320
aggtgaacgg cgtcgatcgg ctggagcaac accgccgcaa tatcggcctg tgattttcat 19380
ccggtcagcc tggctggccg gttaaccctg attcagaagt gagaaaacca tgaacaaaga 19440
aaatgtcatt accctggaca atccggtcaa acgtggtgag caggttatcg aacaggtcac 19500
gctgatgaaa cccagtgccg ggacgctacg cggtgtcagt ctggctgcgg ttgcaaactc 19560
cgaagtcgat gcactgatta aggtgctgcc gcgcatgacg gcaccgatgc tgaccgagca 19620
ggaagtcgcc gcgctggaac tgcctgacct tgtggcgctg gccggtaagg tggtcggttt 19680
tttgtcgccg aactcggtgc agtgacgttt ccgaaaaatc tctcggtcga tgacctgatg 19740
gcggatgtgg cagtgatatt tcactggccg ccatcagaac tgtatcccat gagcctgacc 19800
gaactcatca catggcgcga aaaggcgctc cggcgaagcg gaaacacgaa tgagtaacaa 19860
tgtaaaatta caggtattgc tcagggctgt tgaccaggca tcccgcccgt ttaaatccat 19920
ccgcacagcg agcaagtcgc tgtcggggga tatccgggaa acacaaaaat cactgcgcga 19980
gctgaacggt cacgcatccc gtattgaggg attccgcaag accagtgcac agctcgccgt 20040
gactggtcat gcacttgaaa aggcacggca ggaggccgaa gcccttgcca cacagtttaa 20100
aaacaccgaa cgtccgaccc gtgctcaggc gaaagtcctg gaatccgcaa agcgtgcggc 20160
ggaggactta caggcgaaat ataaccgcct gacagattcc gttaaacgcc agcagcggga 20220
actggccgct gtgggaatta atacccgcaa tcttgcacat gatgagcagg gactgaaaaa 20280
ccgtatcagt gaaaccaccg cacagcttaa ccgtcagcgt gatgcgctgg tgcgtgtcag 20340
tgcgcaacag gcaaaactta acgcagtaaa acagcgttat caggccggaa aggaactggc 20400
cggaaatatg gcctcagtgg gcgctgccgg tgtggggatt gcggcggcgg gaacgatggc 20460
cggtgttaag ctactgatgc ccggttatga gtttgcgcag aaaaactcag aattacaggc 20520
tgtgatcgga gtggcaaaag actccgccga aatggccgca ctccgcaagc aggcgcgcca 20580
gctcggcgac aataccgccg cctcggcaga tgatgcagcc ggtgcgcaga ttattattgc 20640
gaaagccggt ggggatgttg atgccattca ggcggcaacg ccggtcacgc tgaacatggc 20700
gctggcgaac cgtcgcacaa tggaagaaaa cgccgccctg ctgatgggga tgaaatccgc 20760
ctttcagctt tcaaacgata aggtcgctca tatcggggat gttctctcca tgacgatgaa 20820
caaaaccgcc gccgattttg acggcatgag cgatgcgctg acctatgccg cacctgtggc 20880
aaaaaatgcc ggtgtcagca ttgaagaaac cgccgcaatg gtcggggcgc tgcatgatgc 20940
aaaaatcaca ggctcaatgg cggggacggg aagccgtgcc gtgttaagcc gcctgcaggc 21000
accgacggga aaagcatggg atgcactcaa agagcttgga gtgaaaacct cagacagcaa 21060
aggaaacacc cggccaatat ttaccattct gaaagaaatg caggccagtt ttgagaaaaa 21120
ccggctcggt actgcccagc aggctgaata catgaaaact attttcgggg aggaggccag 21180
ctcagccgct gccgtgctga tgactgccgc ctcaaccgga aagctggaca aactgaccgc 21240
tgcgtttaaa gcctcagacg ggaagaccgc cgagctggta aatatcatgc aggacaacct 21300
aggcggtgac tttaaagcgt ttcagtccgc ttatgaggcg gtggggactg acctgtttga 21360
ccagcaggaa ggcgcgctgc gtaagctcac gcagacggcc acaaagtatg tgttaaaact 21420
cgacggctgg atacagaaaa acaaatcact ggcgtcaacc atcggcatca ttgccggcgg 21480
tgcactggcg cttactggca tcatcggtgc cattggcctc gtagcctggc cggttatcac 21540
cggcatcaat gccatcatcg cggcagcagg cgcaatgggg gcagtcttca cgacggttgg 21600
cagtgctgtt atgaccgcca tcggggctat tagctggccg gttgtggccg tggtggctgc 21660
cattgtcgcc ggtgcgttgc ttatccgtaa atactgggag cctgtcagcg cattctttgg 21720
tggtgtggtt gaagggctga aagcggcatt tgcgccggtg ggggaactgt tcacgccact 21780
taaaccggtt tttgactggc tgggcgaaaa gttacaggcc gcgtggcagt ggtttaaaaa 21840
cctgattgcc ccggtcaaag ccacccagga caccctgaac cgttgccgtg acacgggcgt 21900
catgttcggg caggcactgg ctgacgcgtt gatgctgccg cttaatgcgt tcaacaaact 21960
gcgcagtggt attgactggg tactggaaaa actcggtgtt atcaacaaag agtcagacac 22020
acttgaccag accgccgcca gaactcatac cgccacgtat ggtaccggtg actatattcc 22080
ggcgaccagc tcttatgcag gctatcaggc ttatcagccg gtcacggcac cggctggccg 22140
ctcttatgta gaccagagta aaaacgaata tcacatcagc ctgacggggg ggactgcgcc 22200
ggggacacag cttgaccgcc agttacagga tgcgctcgaa aaatacgagc gggataaacg 22260
tgcgcgcgcc cgtgccagca tgatgcatga cggttaagga ggtgacgaaa aatgatgctc 22320
gcgttaggta tgtttgtttt tatgcgccag acgctgccac accagaccat gcagcgtgaa 22380
tcagattatc gctggccgtc aaattcccgt atcggtaaac gggatgcctt tcagtttctc 22440
ggtgtgggtg aggaaaacat cacgctggcc ggtgtgcttt atcccgaact gaccggcggc 22500
aagctgacga tgaccacgct caggctgatg gcagaggagg ggcgggcgtg gccgttgctg 22560
gatggcaccg gcatgattta cggcatgtat gtcatcagca gggtgagtga aacagggagt 22620
attttctttg cagacggcac accccggaaa attgatttta cgctgtcact cacccgcgtt 22680
gatgaatcac tggccgcgct ttatggcgat atcggtaaac aggcggaatc gctcatcggt 22740
aaggccggca gtatggcgac cagattcaca ggtatgacgg gggcgggata atgctggatg 22800
cgctgacatt tgatgcaggc agtacgctga cgccggatta catgctgatg ctcgacagca 22860
gggatattac cggcaatatc agcgaccgtc tgatgagcat gaccctgacg gataaccggg 22920
gctttgaggc tgaccagctt gatattgaac tgaacgatgc cgacgggcag gtcgggctgc 22980
cggttcgtgg cgctgtcctg acggtgtata tcggctggaa aggttttgcc ctggtatgca 23040
aagggaaatt taccgttgat gaggttgaac accggggcgc accggatgta gtcaccatcc 23100
gcgcccggag tgcagatttt cgcgggacgc tcaattcccg ccgggaaggc tcctggcatg 23160
acaccacgct cggtgcgatt gttaaggcga tagccacccg taacaggctg gaagccagtg 23220
tcgctccgtc actggccgga ataaaaattc cacacatcga ccagtcgcag gagtctgatg 23280
cgaaattcct gacccgtctt gcagaacgca acggcggtga ggtgtcggta aaaatgggaa 23340
aactgttgtt tctcaaagcg gggcagggag tgacggccag cggtaaaaaa atcccgcagg 23400
tcaccataac ccgcagcgac ggcgaccgcc atcattttgc gattgctgac cgtggagcct 23460
acaccggtgt aacggcaaaa tggctacaca ctaaagaccc gaagccgcaa aagcagaagg 23520
taaaactgaa acgcaaaaag aaagagaaac acctgcgcgc actggagcac ccgaaagcga 23580
aaccggtcag gcagaagaaa gcgcctaaag taccggaagc gcgtgaaggt gaatacatgg 23640
ccggtgaggc tgacaacgtt tttgccctga ccacggtata tgccacgaaa gcgcaggcca 23700
tgcgcgccgc tcaggcgaag tgggataaac tgcaacgggg cgttgcggag ttctctatca 23760
gcctggctac cggtcgggca gatatttaca cggaaacacc ggtcaaagtg tctggcttta 23820
agcgcgtcat agacgagcag gactggacaa tcactaaggt gacacatttt ctgaataata 23880
gcggcttcac gacgtcctta gagcttgagg tcaggctttc tgatgtggag tacgaaacag 23940
aagatgatga gtgatgtttt tgttttatct gtttgttttg taaggataaa ttaactaaaa 24000
tggcaccatc aacaaaaccg gaagaggtgc tcgcgatgtt tcattgtcct ttatgccagc 24060
atgccgcaca tgcgcgtaca agtcgctata tcactgacac gacaaaagag cgttatcatc 24120
agtgccagaa cgtgaattgc agcgccacgt tcatcactta tgagtcggta cagcgataca 24180
tcgtgaagcc gggagaagtc cacgccgtaa ggccgcaccc gttgccatca gggcagcaaa 24240
ttatgtggat gtaattacaa acagaaagcc cctcagtcga ggggcttttt tgtcgatgtg 24300
gtcaatgtgt ggacgtgacc agaaataaat ccttttattt caatttattg tacgtaaaaa 24360
ataagcccgt gtaagggaga tttagggtgt caccagtagg ggctttcaac ggtacaatgc 24420
gggtttgagc ggcataaatt accactgaaa gcccttaaac gttactctac tgtggacact 24480
gtgtggacac tctcggcctc agtaccacct cttagcggat taagagaaat ggcgtcctga 24540
aggtactctg gcgcaaaatg agcgtaaacc atagtttgct caatccgcgt gtgacctagt 24600
atccgttgta gcgtgataat acttcctcca ttaatcatga aatgagtggc aaagctgtgc 24660
cttagtgcat gtgtggcttg ccccattggc aaatccggtt ttattgcttt cattgttcgt 24720
ctgaagcgag ggtaatcagc atcagggaat aaaaaacctc gtttgttatc cgcgatcatt 24780
ttggcaacag cctctgagat cgggacggtg cgtggtttgt ttgttttcgt tttaacaaac 24840
gtgacgcggt tatggatgat attttctgct ttcaaacgag ctgcttctcc ccaacgtgct 24900
cctgtactca ggcaaagaat cgcaatcttt ttattgtcgc cgtcaagtgc tgcaagcagt 24960
aaggcaattt cttcctgtgt tagatagcct gtttctggtt tttcctcctt aagccttttt 25020
gtccctctga tagggtgctc accaaagaat aactccgctt caatcagggc tgtaaacatg 25080
ccgctaatac atgttaaatc acgattgata ctcgaaggtt taataccctg acttcttcgg 25140
gtggcgcagt actggctgat aagcgatttc gtaatttgaa atgcgcatgg gtcattcgtt 25200
atttttgtga agatttcaat ttttccaaga ttagatttcc catgctcttc gtgtttaccc 25260
tttaaatccc accagatctg tgtcagctcc gacagacgtc gcttgtctgt tggttttgat 25320
agccattctt tattgtggtg gttgtacaac gtgtatttct cgaaagcgac agcttcgctt 25380
ttcttatcaa acttcctacg gatgcgtttt ccattacgtc cagtagggcg gatgtccact 25440
tcatatcgac catcatcgag ttttttgatt gccatcagaa aaccctccga gtggtgtgtt 25500
tttttgcgac tactaatcgc ttttttcgtg gtggctgaaa tttagccacc aatagtaggc 25560
acttgtgatg aatatattca cgatgaattg ttaaccagtc ttttgaccgg agtggggcga 25620
cgttgtttcg ttttgcccaa agtgtgcgag agcgggcgca atttgcccgg actcaggagc 25680
gatctgattg gtcatgaacc ataaagtgta tttggtgaat tgtggggtct gcaggatgtt 25740
catcatgaca tctgttggag gtgttgaacg accactttca tagtaactca gcgtgccata 25800
cggaacccct gttaaatcag caagttgttg tctgctcaaa tactctgatt ttcgcattaa 25860
gactatcttc tcgcttatcg tgtttgacat ggtgtttaga tctcaatagt atttagttta 25920
gatgtagatt gtttagtgct tggatgtggg cactaaaagg cattataaga cattaaacgc 25980
aattcatgag ggctagagga cgacatgagc aagcaagtaa cactcatgac tgatgcgatt 26040
ccttatcagg agttcgcaaa actaatagga aaatcgacag gagcggttcg tcggatgatc 26100
gataaaggaa agctgcctgt aattgatatg accgatccac aatcagcttc aggtcgtgca 26160
ggtgaatatt gggtatacct tccggcatgg aataacggac taaaactggc ttatgaaagc 26220
cgccctaaag agattcgtga cggctggttg atgtggttag gtctcggtga accacgttaa 26280
ggagaaccgt atgaatgagc ctcgttgtat tgctcagtta ctgcgtaacg aaagccccag 26340
ggcgattgac ttcaccatca cccacggtaa ggggcgtaag ggaatcatta tccgcaccaa 26400
aaaacagagt ccgttaaaaa aggctctgac ctttctgaaa agccggaggg tatggaaatg 26460
acagtgatga cgctcaatct cgttgaaaaa cagccagcag ctatgcgccg gataattggt 26520
aagcatcttg ccgttcctcg ctggcaggat acatgtgatt attataatca gatgatggag 26580
cgcgaacggt taacggtttg cttccatgct cagttaaaac agcgtcacgc aacgatgtgt 26640
tttgaagaaa tgaacgacgt cgaacgtgaa cgactggtat gtgcaattga tgaattgcgt 26700
ggtgcattct caaaacgccg tcaggttggc gcaagtgagt atgcatatat tagtttttta 26760
acagtcagtc agcgtcgtac tttatttatg catgccggat tgactgaaaa agaattcaac 26820
cagccatact ggcgaattaa tgaagagtca tgttactggc gtgatgcttt attccgtgca 26880
ttacgtgaat tattcagtct gtttgagtat gcaccgacaa ttctgacgtc ggtaaaaccg 26940
gagcaatatc tgcattaagt aattaaccag agtttttaac gcacttaatt gtgcggggct 27000
tctttttgcc tggagaaagt tatgcataca gtttctgaaa atcagtgcgg tatatacgca 27060
ttactgctgc aacaggccag aaccgaagca caggccgacg ctgcgacgcg cttttcttct 27120
catcttgatg ccatgattcg ccacatcaca aaggcggagt tatcccgcgt ggagatagtc 27180
gagctgctca gtcaggagtc ggaaaaattt cacaatatcg gattgtctcg cggggaggtg 27240
ctttgatgtt ctgttctcgt gcagttgtat tactgaataa cgccttaaaa atcgccgtta 27300
tgaaaaatgg cgatttgtct cttattcaac ttggtcttga taaagaaaaa cgcgaaataa 27360
ctgaatctgt tatcgcgatt tatcagagtg aattaaacct cctgtctgat gtggtcaatt 27420
tacttgttaa acgcgctgta tttcacaagc aaatttcctc cgtggatgaa ctgacgaaat 27480
taacgacaga aatcgccagc tattgcgctg atgaatttaa aaaactgaac gacaaaagga 27540
actggtaatg ccggacaacg tagattttat tcaggaacaa caggctgaat tactggagcg 27600
ccagattaac gcggcaaggg taaaacattg cggtgcttct gcgctggttt gcgaagagtg 27660
tgacgcgcca atacctgctg cccgtcgtgc ggcttacccg tcagccacgc gttgtgtttc 27720
ctgtcagtca gtctttgaag caaaaaacaa acattaccgg agaacggcat gagtattcgt 27780
attgaaattg gcgaacgtta tgtcgttacc agtgacagct ttcagtttat tctccacgag 27840
aaaaagagag cggaaagcgg taaaaacgcc ggtcaggaat ggctggcggt ggttggttat 27900
tacccgaaat taagccagct cgtttcaggc ctgatgcatc acgatattct gaccggaagc 27960
gcaaagtctt ttgctgattt aaacgtgcag gttgagcaac tcagcaagcg ttgttcagag 28020
gcttttggct catatggccg ttaaagcctc cgggcgtttt gtccctccgt cagcatttgc 28080
cgcaggcacc ggtaagatgt ttaccggtgc ttatgcatgg aacgcgccac gcgaggccgt 28140
cgggcgcgaa agacccctta cacgtgacga gatgcgtcag atgcaaggtg ttttatccac 28200
gattaaccgc ctgccttact ttttgcgctc gctgtttact tcacgctatg actacatccg 28260
gcgcaataaa agcccggtgc acgggtttta tttcctcaca tccacttttc agcgtcgttt 28320
atggccgcgc attgagcgtg tgaatcagcg ccatgaaatg aacaccgacg cgtcgttgct 28380
gtttctggca gagcgtgacc actatgcgcg cctgccggga atgaatgaca aggagctgaa 28440
aaagtttgcc gcccgtatct catcgcagct tttcatgatg tatgaggaac tcagcgatgc 28500
ctgggtggat gcacatggcg aaaaagaatc gctgtttacg gatgaggcgc aggctcacct 28560
ctatggtcat gttgctggcg ctgcacgtgc tttcaatatt tccccgcttt actggaaaaa 28620
ataccgtaaa ggacagatga ccacgaggca ggcatattct gccattgccc gtctgtttaa 28680
cgatgagtgg tggactcatc agctcaaagg ccagcgtatg cgctggcatg agacgttact 28740
gattgctgtc ggggaggtga ataaagaccg ttctccttat gccagtaaac atgccattcg 28800
tgatgtgcgt gcacgccgcc aagcaaatct ggaatttctt aaatcgtgtg accttgaaaa 28860
cagggaaacc ggcgagcgca tcgaccttat cagtaaggtg atgggcagta tttctaatcc 28920
tgaaattcgc cggatggagc tgatgaacac cattgccggt attgagcgtt acgccgccgc 28980
agagggtgat gtggggatgt ttatcacgct taccgcgcct tcaaagtatc acccgacacg 29040
tcaggtcgga aaaggcgaaa gtaaaaccgt ccagctaaat cacggctgga acgatgaggc 29100
atttaatcca aaggatgcgc agcgttatct ctgccatatc tggagcctga tgcgcacggc 29160
attcaaagat aatgatttac aggtctacgg tttgcgtgtc gtcgagccac accacgacgg 29220
aacgccgcac tggcatatga tgcttttttg taatccacgc cagcgtaacc agattatcga 29280
aatcatgcgt cgctatgcgc tcaaagagga tggcgacgaa agaggagccg cgcgaaaccg 29340
ttttcaggca aaacacctta accagggcgg tgctgcgggg tatatcgcga aatacatctc 29400
aaaaaacatc gatggctatg cactggatgg tcagctcgat aacgataccg gcagaccgct 29460
gaaagacact gctgcggctg ttaccgcatg ggcgtcaacg tggcgcatcc cacaatttaa 29520
aacggttggt ctgccgacaa tgggggctta ccgtgaacta cgcaaattgc ctcgcggcgt 29580
cagcattgct gatgagtttg acgagcgcgt cgaggctgca cgcgccgccg cagacagtgg 29640
tgattttgcg ttgtatatca gcgcgcaggg tggggcaaat gtcccgcgcg attgtcagac 29700
tgtcagggtc gcccgtagtc cgtcggatga ggttaacgag tacgaggaag aagtcgagag 29760
agtggtcggc atttacgcgc cgcatctcgg cgcgcgtcat attcatatca ccagaacgac 29820
ggactggcgc attgtgccga aagttccggt cgttgagcct ctgactttaa aaagcggcat 29880
cgccgcgcct cggagtcctg tcaataactg tggaaagctc accggtggtg atacttcgtt 29940
accggctccc acaccttctg agcacgccgc agcagtgctt aatctggttg atgacggtgt 30000
tattgaatgg aatgaaccgg aggtcgtgag ggcgctcagg ggcgcattaa aatacgacat 30060
gagaacgcca aaccgtcagc aaagaaacgg aagcccgtta aaaccgcatg aaattgcacc 30120
atctgccaga ctgaccaggt ctgaacgatt gcagatcacc cgtatccgcg ttgaccttgc 30180
tcagaacggt atcaggcctc agcgatggga acttgaggcg ctggcgcgtg gagcaaccgt 30240
aaattatgac gggaaaaaat tcacgtatcc ggtcgctgat gagtggccgg gattctcaac 30300
agtaatggag tggacatgat ggcaaaaatt cacgaggtaa agctgcacgc aaaatatttc 30360
gaccttgtac tggaaggaaa gaaacgcgca gagtttcgga aaaaagatcg taattatgag 30420
cgcggggaca cgttgatttt gcatgaatgg gtgcagggtg tgtttacggg gcgaaaggtt 30480
gaagcccgga taacagatgt tactgacctg tcagactggc tggaagatta tgtcttgctg 30540
cacagaatac taggtgagat actgccgctg actgtcaagc tggcagtatc ctccacattt 30600
tttataaatc taaggcgaag aacggtggca atatatttgc tttaaattgt aaataagcaa 30660
attattctaa gccacaaatg atatcaattg agtatcgatt ttcgttcgaa tataaccata 30720
acgccaagcg tcaaatgtaa gtcatctata tgtgattcgt attcatattg gtcagcatca 30780
ggagatagta aatgctctgc tgctgtaaaa acatcaattg taacagatat atcgtctgga 30840
atttcttcat ttaattcgga tatgtatttt ttatatttgt tttttaattt ccttatcatg 30900
tcttccttat ggtggattgt agtgcagtaa ttttttttag ttgaatcatt gtatgaatgg 30960
aatgaacagt ttaatgctag gccaagactt gaatttcctg tagggcctgt gtgtttaaag 31020
tattcaagat ttcttcttat gtcagaaaat aaaagacttt tacagggggc atttccttta 31080
acttctattg cacatattgg aatgtcgaaa aatggtctgc tgtccaatat ggcaatatca 31140
attctgcctg atcttgttgt gtttgtgttt tttctgacag ttttttttga gaatattttt 31200
tgggggtcag accgtttcga taaaggaact gttgcattaa tgaatttatt tgtatggtac 31260
tcaaatataa ctttgtaatc accatggcga aaagatttta tttctaacaa cgatagacct 31320
atagatacgg tagctacata ttcagtgttt atttttgcac cagacctgaa atccattaaa 31380
taagttgcgt cggctgactt tttcattcca tcttttacag ctttcacaat atccatgtta 31440
ttcatatcaa caccttttat attccagaat tataaatctt aatgattgat ttgtttgtgt 31500
gtttaggtta ctagattgac gtacttatag cacattctga ttttgaaatc accatccttg 31560
ggtaaagcac agcctatcac tattggttta gtactgtgct gtaatagtat cagattaagt 31620
taaatccatt ttatgaaatc ttccatttca tcatattttt ttattactgc tctaacatct 31680
ttgctttcat cacataaaca atctaaaaga ctatcccatt cagtttgttt tttaccaaat 31740
ccataaacag cctctatatc accggatttc catatataga ttccgttatc tttcaatttt 31800
tgatgtattt catgtatatg cttttgtgtt ttttcatggt tacatatttt gatgaagtct 31860
ttgcttgaaa tgcttttgaa tgactcaaaa gtagtaactt ttgtatttaa actaagctct 31920
cctgagttga ttgattcaat caaagcagtc aatagattat cacattcagt actaagtaag 31980
tctttatgct ctgttaatag aatatttgat aagaaatcac aatcagctag aatccttgtt 32040
tttatgccga tggcattgat gatttgtgac atcttaaata aactaccctt accgtcaacg 32100
gcaacaatgc agattttact cgggttgagt tcatgtccgt taattttttt ataaagtgca 32160
tatagaacgt ttgtctctgt tttcccttca acaagcaaaa cttcttcaga aaataaaagg 32220
tatgatgaat tagaaagcgt gaatgctgag tgcaattgcg gtgatgaaga tttatataat 32280
tcttcgattt tttcagatat agtcttcctt gctatggttc cattagaatc cttacaaacc 32340
tgaatcgcat ttgctgcatg ctttgcagaa agcatactgg ctgagtgagt tgatattata 32400
acctgatacc ctgattcact taatgtgaca agtgattctc tgacagaatt aatggctgaa 32460
gggtgtaaat ataactcagg ttcatcaatg aaaatcaaag tgtttgattt ttttgattcg 32520
ctgttttctt tttttatttc ggccaggtat tgaattaatg ccatttgaat ggaacgttgt 32580
gttccgtgac caaatcggct gatatctctc attaccggtt catcttcccg agactcaaaa 32640
actttcagag tgccggattt aaatatctca tctaatgtcg gtgtgggaaa gtgtaacttt 32700
acacttacgt caggaaaaaa ttggtttact tttttattta cacctgagtc tattttatta 32760
aggctttcta atctgttctc accgttgtga gaaagatatt tacctatttc tgatatgttt 32820
tttgaaaatt tttcttcgtg ttcttgtttt atttcagaaa caattgcgga aagtatcttt 32880
cctattgtgg tcgtgttttt gcattttgtt gagtcttcga cagcgtcaga cattgcaggg 32940
atatgaattg gttccggaaa tatattggag attgcaccat ctatgccgcc agggtttttc 33000
ttccacgtgg taccgtcata tacatccaga ctttttttgg cttttcctgt ttccttatta 33060
aattcctgtc ttcttgcaaa ggtaagagtc ccgtcaatta taaacggagc tattttttgt 33120
tgattctctt ctgttaacaa agacagagta tcatctgtta taccttgaat aacgccttca 33180
acggatacgg ggtgtgtagg atcgtacaca tctgattctg aaatcaaaga gccatctaac 33240
agccacttaa ttgctaagat aatatttgat tttcctgcgt tattataacc aactaaagca 33300
gtgaaggggc gcaaaatagc cgatgttgac ttacaagaac gaaagttgct aattgaaact 33360
gaagcaagac gtacagtcat tatttttcct taaatgtgct atttgtatgc aatgagttca 33420
tacgaaacgc ttttttacat tttatagtcg ttgcattcaa gggtgcatga gattgcatta 33480
agggaaactg tgatatggct tggcttttga ctggaaatac tgatggctca ttagttttat 33540
taaggtgcat taaaaccgcc ccgtgaagcg ggcgggcgag gcggggaaag cac 33593
//