Permalink
Find file
Fetching contributors…
Cannot retrieve contributors at this time
1513 lines (1512 sloc) 86.3 KB
ID B132222 standard; DNA; PHG; 30624 BP.
XX
AC U32222; U51471; X04449; X53318;
XX
SV U32222.1
XX
DT 27-OCT-1995 (Rel. 45, Created)
DT 09-SEP-1998 (Rel. 56, Last updated, Version 6)
XX
DE Bacteriophage 186, complete sequence.
XX
KW .
XX
OS Enterobacteria phage 186
OC Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae;
OC P2-like Viruses.
XX
RN [1]
RP 20315-23876
RX MEDLINE; 87112711.
RA Kalionis B., Dodd I.B., Egan J.B.;
RT "Control of gene expression in the P2-related template coliphages. III. DNA
RT sequence of the major control region of phage 186";
RL J. Mol. Biol. 191(2):199-209(1986).
XX
RN [2]
RP 23435-24666
RX MEDLINE; 89199647.
RA Richardson H., Puspurs A., Egan J.B.;
RT "Control of gene expression in the P2-related temperate coliphage 186. VI.
RT Sequence analysis of the early lytic region";
RL J. Mol. Biol. 206(1):251-255(1989).
XX
RN [3]
RP 22430-23430
RX MEDLINE; 90317829.
RA Dodd I.B., Kalionis B., Egan J.B.;
RT "Control of gene expression in the temperate coliphage 186. VIII. Control
RT of lysis and lysogeny by a transcriptional switch involving face-to-face
RT promoters";
RL J. Mol. Biol. 214(1):27-37(1990).
XX
RN [4]
RP 12142-14054
RX MEDLINE; 95407087.
RA Xue Q., Egan J.B.;
RT "DNA sequence of tail fiber genes of coliphage 186 and evidence for a
RT common ancestor shared by dsDNA phage fiber genes";
RL Virology 212(1):128-133(1995).
XX
RN [5]
RP 14042-15941
RX MEDLINE; 95407099.
RA Xue Q., Egan J.B.;
RT "Tail sheath and tail tube genes of the temperate coliphage 186";
RL Virology 212(1):218-221(1995).
XX
RN [6]
RP 11442-18696
RA Xue Q.;
RT "Studies on the tail region of the temperate coliphage 186 genome";
RL Thesis (1993), University of Adelaide
XX
RN [7]
RP 1-20866
RX MEDLINE; 98371265.
RA Portelli R., Dodd I.B., Xue Q., Egan J.B.;
RT "The late-expressed region of the temperate coliphage 186 genome";
RL Virology 248(1):117-130(1998).
XX
RN [8]
RP 1-30624
RA Dodd I.B., Egan J.B.;
RT "Bacteriophage 186 complete genome";
RL Unpublished.
XX
RN [9]
RP 11442-18696
RA Xue Q., Egan J.B.;
RT ;
RL Submitted (25-JUL-1995) to the EMBL/GenBank/DDBJ databases.
RL Department of Biochemistry, University of Adelaide, Adelaide, SA 5005,
RL Australia
XX
RN [10]
RP 1-30624
RA Xue Q., Egan J.B.;
RT ;
RL Submitted (15-MAY-1998) to the EMBL/GenBank/DDBJ databases.
RL Department of Biochemistry, University of Adelaide, Adelaide, SA 5005,
RL Australia
XX
DR SPTREMBL; O80303; O80303.
DR SPTREMBL; O80304; O80304.
DR SPTREMBL; O80305; O80305.
DR SPTREMBL; O80306; O80306.
DR SPTREMBL; O80307; O80307.
DR SPTREMBL; O80308; O80308.
DR SPTREMBL; O80309; O80309.
DR SPTREMBL; O80310; O80310.
DR SPTREMBL; O80311; O80311.
DR SPTREMBL; O80312; O80312.
DR SPTREMBL; O80313; O80313.
DR SPTREMBL; O80314; O80314.
DR SPTREMBL; O80315; O80315.
DR SPTREMBL; O80316; O80316.
DR SPTREMBL; O80317; O80317.
DR SPTREMBL; Q01088; Q01088.
DR SPTREMBL; Q37840; Q37840.
DR SPTREMBL; Q37841; Q37841.
DR SPTREMBL; Q37842; Q37842.
DR SPTREMBL; Q37843; Q37843.
DR SPTREMBL; Q37844; Q37844.
DR SPTREMBL; Q37845; Q37845.
DR SPTREMBL; Q37846; Q37846.
DR SPTREMBL; Q37848; Q37848.
DR SPTREMBL; Q37850; Q37850.
DR SPTREMBL; Q37851; Q37851.
DR SPTREMBL; Q9T0R3; Q9T0R3.
DR SWISS-PROT; P06723; VINT_BP186.
DR SWISS-PROT; P08685; CP69_BP186.
DR SWISS-PROT; P08707; RPC1_BP186.
DR SWISS-PROT; P08711; VPB_BP186.
DR SWISS-PROT; P15236; VFIL_BP186.
DR SWISS-PROT; P21678; RPC2_BP186.
DR SWISS-PROT; P21679; VPD_BP186.
DR SWISS-PROT; P21680; VDHR_BP186.
DR SWISS-PROT; P21681; VAPL_BP186.
DR SWISS-PROT; P21682; CP79_BP186.
DR SWISS-PROT; P41059; CP80_BP186.
DR SWISS-PROT; P41060; CP81_BP186.
DR SWISS-PROT; P41061; CP83_BP186.
DR SWISS-PROT; P41062; CP84_BP186.
DR SWISS-PROT; P41063; TUM_BP186.
DR SWISS-PROT; P41064; VPA_BP186.
XX
CC On Jul 23, 1998 this sequence version replaced gi:14895 gi:15549
CC gi:1262241 gi:974436.
XX
XX
FH Key Location/Qualifiers
FH
FT source 1..30624
FT /db_xref="taxon:29252"
FT /organism="Enterobacteria phage 186"
FT misc_recomb 1..19
FT /evidence=EXPERIMENTAL
FT /note="cos; cohesive end; top strand cut at 5' end and
FT bottom strand cut at 3' end"
FT /organism="Enterobacteria phage 186"
FT terminator complement(164..187)
FT /evidence=NOT_EXPERIMENTAL
FT /note="tW"
FT /gene="W"
FT CDS complement(196..1218)
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37851"
FT /note="Orf2; P2 Q homolog"
FT /transl_table=11
FT /gene="W"
FT /product="capsid portal protein"
FT /protein_id="AAC34146.1"
FT /translation="MSKRKPRKQVAMTASAPQKMEAFTFGEPVPVLDKRDILDYVECIS
FT NGKWYEPPVSFSGLAKSLRSAVHHSSPIYVKRNVLASTYIPHPLLSRQDFSRFALDYLV
FT FGNAFLEQRHSVTGQLIKLLASPAKYTRRGVDDSVFWFVENFTLPHEFAPDTVFHLLEP
FT DINQEIYGLPEYLSALNSAWLNESATLFRRKYYQNGAHAGYIMYVTDPAQSATDVESLR
FT EAMRNSKGLGNFKNLFFYAPNGKPDGIKIVPLSEVATKDDFFNIKKASAADLMDAHRVP
FT FQLMGGKPENIGSLGDVEKVAKVFVRNDLSPLQDRFREVNDWLGMEVIRFKEYTLDNPE
FT "
FT CDS complement(1215..1961)
FT /codon_start=1
FT /db_xref="SPTREMBL:O80303"
FT /note="similar to Orf12"
FT /transl_table=11
FT /gene="W"
FT /product="W protein"
FT /protein_id="AAC34147.1"
FT /translation="MKNNVFSQSQIQAMADILHNDSFDYQATWLRVGKLNIDRSITKSR
FT QIGATQLFSREALLDALTTGDNHVWFAHTIEHARVALMYMSNLSARVGVSLTSNGHSLQ
FT LDDGAVISFVGEESHCAALAGNVYLDEFGWFNNPLRAAKVAAGIACHKRHSLTMFTSPS
FT DNYDAFRVWNGTTRRHRPSPLINTGDSVFCTDGVWRQSVTLDAACQRGCNLFAPDEIKH
FT EYSDDDYRLLFGCDWSFAVAAGEVAA"
FT CDS complement(1961..3730)
FT /codon_start=1
FT /db_xref="SPTREMBL:Q9T0R3"
FT /note="Orf12; P2 P homolog; contains putative
FT helix-turn-helix DNA-binding motif"
FT /transl_table=11
FT /product="terminase subunit"
FT /protein_id="AAC34148.1"
FT /translation="MTISTDTTLLHDPRRQASLLYWQGFSVPQIAEMLQVKRPTVQSWK
FT QRDGWDGIAPISRVESSLEARLIQLIAKPQKSGGDFKEIDLLGRQIERLARVNRYSQTG
FT NEADLNPNVANRNKGERKKPKKNFFSDEAIEKLEELFFDQSFEYQLQWYRAGLAHRIRD
FT ILKSRQIGATFYFSREALLRALKTGHNQIFLSASKTQAYVFREYIIQFARLVDVDLTGD
FT PIVIGNNGAKLIFLGTNSNTAQSHNGDLYVDEIFWIPNFQKLRKVASGMASQKHLRSTY
FT FSTPSTLAHGAYPFWSGELFNKGRSRIADRIEIDISHRALAGGQLCDDGQWRQIVTIED
FT ALAGGCTLFDLDQLKRENSDEDFKNLFMCEFVDDKASVFPFEELQRCMVDVMEEWEDFA
FT PFADHPFGSRPVWIGYDPSHTGDSAGCVVLAPPVVSGGKFRMLERHQWKGMDFAAQADG
FT IRKLTEKYSVEYIGIDATGLGLGVFQLVRSFYPAARGIRYTPEMKTAMVLKAKDTIRRG
FT CLEYDAGATDVTQSFMSIRKTMTSSGRSATYEASRTEEASHADIAWATMHALLNEPLSA
FT GSGIQPKSILEFN"
FT promoter complement(3753..3790)
FT /evidence=EXPERIMENTAL
FT /note="p12"
FT /function="B-dependent transcription of orf12 operon"
FT protein_bind 3798..3817
FT /evidence=EXPERIMENTAL
FT /bound_moiety="B protein"
FT /function="activation of pV and p12 promoters"
FT promoter 3828..3865
FT /evidence=EXPERIMENTAL
FT /note="pV"
FT /gene="V"
FT /function="B-dependent transcription of V operon"
FT CDS 3896..4750
FT /codon_start=1
FT /db_xref="SPTREMBL:Q01088"
FT /note="presumed capsid scaffold; P2 O homolog"
FT /transl_table=11
FT /gene="V"
FT /product="V protein"
FT /protein_id="AAC34149.1"
FT /translation="MAKKVSKFFRIGVEGDTCDGRIISASDIQEMAETYDPRVYGCRIN
FT LEHLRGLLPDGIFKRYGDVVELKAEKIDDDSALNGKWALFAKITPTDDLIAMNKAAQKV
FT YTSMEIQPNFANTGKCYLVGLAVTDDPASLGTEYLEFCRTAKHNPLQRFKAHPENVFSA
FT ATLAELEFEDVPDTVLNSLADKVKAIFSRKQVSDDARLNDVHEAVTAVSEHVQTNLTAQ
FT DKRLSDMETAFATFKQELTGKVEETSQAFSVLKTTLDKTESFSQPRRTKASGGGGDELL
FT TDC"
FT variation 3980
FT /note="Vam38; glutamine to amber"
FT /replace="t"
FT /gene="V"
FT CDS 4826..5893
FT /codon_start=1
FT /db_xref="SPTREMBL:O80304"
FT /note="T protein; P2 N homolog"
FT /transl_table=11
FT /gene="T"
FT /product="major capsid protein"
FT /protein_id="AAC34150.1"
FT /translation="MRQETRFKFNAYLTQLAKLNGISVDDVSKKFTVEPSVTQTLMNTV
FT QASSAFLQMINILPVAEMKGEKIGVGVTGTIASTTDTSGDKERQTADFTALESNKYECN
FT QINFDFHLTYKRLDLWARFQDFQRRIRDAIVQRQALDFIMAGFNGTTRADTSDRVKNPM
FT LQDVAVGWLQKYRNEAPARVMSNITDADGKVVSAVIRVGKNGDYENLDALVMDGTNTLI
FT DEIYQDDPKLVAIVGRKLLADKYFPLVNKQQENTESLAADIIISQKRIGNLPAVRVPYF
FT PANAVFVTTLENLSIYFMDESHRRSIDENPKKDRVENYESMNIDYVVEAYAAGCLLENI
FT TLGDFTAPAAPEGGE"
FT CDS 5898..6647
FT /codon_start=1
FT /db_xref="SPTREMBL:O80305"
FT /note="terminase subunit; P2 M homolog"
FT /transl_table=11
FT /gene="R"
FT /product="R protein"
FT /protein_id="AAC34151.1"
FT /translation="MTSPAQRHMMRVSASQAAQREQAPLRHATAYEQMLVKLADDRRTL
FT KNIRSNERKAEKKRELLPFYAPWVAGVLTDGRGAQDDIVMTVMLWRLDAGDIAGALEIA
FT PYALKYGLTSDHRRTTPYMLVEEVALAAQRLRDAGESVDLSWLQATIDLTDGADVPDMV
FT RARLHKVTGLTLRDAGMNAEALAQFQRAMQLDRNAGVRKEIERLERALKPKTEAAPRKT
FT TKPRTRKPATKPAAKRGRPPKAAKTAG"
FT CDS 6740..7246
FT /codon_start=1
FT /db_xref="SPTREMBL:O80306"
FT /note="capsid completion protein; P2 L homolog"
FT /transl_table=11
FT /gene="Q"
FT /product="Q protein"
FT /protein_id="AAC34152.1"
FT /translation="MTTVILNQPDEPQDVPGVVIPAPETGGAVIKNTFFFPDVDPKRVR
FT ELMRLEQTVSDARLRNAIKTGMAETNAELYDYRLRQTAAGFKQLADVPAEEIDGENVRV
FT FHYLSAVTAMATATLYERYRGVEATGKGDKKADSVETTIDDLWRDMRWSVARLQDKPRC
FT IVGQL"
FT CDS 7246..7449
FT /codon_start=1
FT /db_xref="SPTREMBL:O80307"
FT /note="Orf23; P2 X homolog; tail protein"
FT /transl_table=11
FT /protein_id="AAC34153.1"
FT /translation="MKVRSMQGDTLDTICARYYGRTEGVVETVLQANPGLSELGVILPN
FT GTEIDLPDVASSPVTKTINLWE"
FT CDS 7452..7748
FT /codon_start=1
FT /db_xref="SPTREMBL:O80308"
FT /note="Orf24; P2 Y homolog; holin"
FT /transl_table=11
FT /protein_id="AAC34154.1"
FT /translation="MTEGEKGVLSLFVIGVMIVVGKVLAGGEPITPRLFIGRMLLGGFV
FT SMVAGVVLVQFPDMSLPAVCGIGSMLGIAGYQVVEIAIQRRFKSQKGESDAGH"
FT CDS 7735..8232
FT /codon_start=1
FT /db_xref="SPTREMBL:O80309"
FT /note="endolysin; P2 K and lambda S homolog"
FT /transl_table=11
FT /gene="P"
FT /product="P protein"
FT /protein_id="AAC34155.1"
FT /translation="MPVINTHQNIAAFLDMLAYSEGTANHPLTKNRGYDVIVTGLDGRP
FT EIFTDYSDHPFAHGRPPKVFNRRGEKSTASGRYQQLYLFWPHYQKQLALPDFSPLSQDK
FT LAIQLIRERGALDDIRAGRIERAVSRCRNIWASLPGAGYGQREHGLEKLVTIWRTAGGV
FT VA"
FT variation 7999
FT /note="Pam65"
FT /replace="t"
FT /gene="P"
FT CDS 8229..8642
FT /codon_start=1
FT /db_xref="SPTREMBL:O80310"
FT /note="Orf27; P2 LysB homolog; control of lysis"
FT /transl_table=11
FT /protein_id="AAC34156.1"
FT /translation="MKVLITLLVMAVLGLLWLHHENGNLSRSFETANRVASEQKTTIGM
FT LKNQLSVAGQLARRNESAQVTLREQLAKASAEASRREQTITRLLNENEAFRRWYNAALP
FT DAVRRLHTRTACASAGDCGQRMPEGEPLPYAGK"
FT CDS 8497..8787
FT /codon_start=1
FT /db_xref="SPTREMBL:O80311"
FT /note="Orf28; homologs present in other phages, e.g. P2,
FT HP1"
FT /transl_table=11
FT /product="unknown"
FT /protein_id="AAC34157.1"
FT /translation="MKMKPFAAGITLLCLMLCVGCTPEQPAPVPVIVVNGCPRVSLCPM
FT PGSDPKTNGDLSADIRRLEGALTACALQVKTVKHCQDELDAEAQKPAQSAD"
FT CDS 8750..9217
FT /codon_start=1
FT /db_xref="SPTREMBL:O80312"
FT /note="P2 R homolog; tail completion protein"
FT /transl_table=11
FT /gene="N"
FT /product="N protein"
FT /protein_id="AAC34158.1"
FT /translation="MQKHKSLRKALINAVPQLRNNPDMLRLFADNGHTDSRLASSLSFE
FT KVYVLNVVVTDFTGDLDLIFVPVQAWLREHQPDIMTTDDGREKGFTWIIDINNDDSLDI
FT SISLRLTERTLVKEVGGALHVSYAPEPPLPELVKRPVAMYANGELVSQWDE"
FT variation 8877
FT /note="Nam47"
FT /replace="a"
FT /gene="N"
FT CDS 9210..9659
FT /codon_start=1
FT /db_xref="SPTREMBL:O80313"
FT /note="P2 S homolog; tail completion protein"
FT /transl_table=11
FT /gene="O"
FT /product="O protein"
FT /protein_id="AAC34159.1"
FT /translation="MSELTALQERLAGLIASLSPAARRKMAAEIAKKLRTSQQQRIKRQ
FT QAPDGTPYAARKRQPVRSKKGRIKREMFAKLRTSRFMKAKGSDSAAVVEFTGKVQRMAR
FT VHQYGLKDRPNRNSRDVQYEARPLLGFTRDDEQMIEDVIISHLGK"
FT variation 9324
FT /note="Oam61"
FT /replace="t"
FT /gene="O"
FT variation 9345
FT /note="Oam62"
FT /replace="t"
FT /gene="O"
FT CDS 9729..10370
FT /codon_start=1
FT /db_xref="SPTREMBL:O80314"
FT /note="Orf32; P2 V homolog; baseplate protein"
FT /transl_table=11
FT /protein_id="AAC34160.1"
FT /translation="MNTLSTIQELARAIRNLIRSGVVTEVDTVQGLCRVQSGGIQTTWL
FT NWLTTRAGRSRTWWAPSLGEQVLLLAIGGELDTAFVLPGIFSDDNPAPSASADAWHVVF
FT PDGAVIEYEPETSALTVRGIKTADVTASESITATVPVVLVKAETRITLDTPEVVCTNKL
FT TTATLEVQKGGEMRGDIVHNGGTFKSNGVQLDDHGHGGVQRGGAWTEDTK"
FT CDS 10367..10714
FT /codon_start=1
FT /db_xref="SPTREMBL:O80315"
FT /note="P2 W homolog; putative baseplate protein"
FT /transl_table=11
FT /gene="M"
FT /product="M protein"
FT /protein_id="AAC34161.1"
FT /translation="MTARYMGMNRNTGLGISDTEHISQSMRDILLTPVGSRVMRREYGS
FT LLSALIDMPQNPALRLQIMVACYSAIQKWEPRIRLTSISFETGDAGEMYVDITGMRTDT
FT GASVSTTVSLS"
FT CDS 10721..11629
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37840"
FT /note="P2 J homolog; baseplate or base of tail fibre"
FT /transl_table=11
FT /gene="L"
FT /protein_id="AAC34162.1"
FT /translation="MATVDLSLLPVPDVVEELDFETILAERIATLISLYPEDQQEAVAR
FT TLALESEPIVKLLQENAYREVIWRQRVNEAARAGMLAYARDSDLDNLGANFNVERLVVR
FT PADDTTIPPTPAEMELDADFRLRIQQAFEGMSVAGSTGAYEFHGRSADGRVADISVISP
FT SPACVTISVLSRENNGAASDELQSIVRNALNAEDVRPVADRVTVQSAQIIDYQIRATLF
FT VYPGPENEPIRAAAEAKLKAYISAQHRLGRDIRLSAIYAALHVEGVQRVELAAPVADIV
FT LDKTQASFCTDYQIVIGGSDE"
FT variation 10818
FT /note="Lam21"
FT /replace="a"
FT /gene="L"
FT CDS 11622..12152
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37841"
FT /note="Orf38; P2 I homolog; tail protein"
FT /transl_table=11
FT /protein_id="AAC34163.1"
FT /translation="MSDVRLLPVGSSPLEVAAARACADIENTPVPLRRLWSPDTCPANL
FT LPWLAWAFSVDRWDENWPEKTKRDVIRSAYFTHCHKGTIGAVRRVIEPLGYIINVTEWW
FT ETGDPAGTFRLDIGVLESGITEEMYLEMERLIADAKPASRHLIGLNIIQDIPGYMYTGG
FT VSCDGDIITVYPG"
FT CDS 12163..13551
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37842"
FT /note="similar to P2 tail fiber protein H, PIR Accession
FT Number B42291"
FT /transl_table=11
FT /gene="K"
FT /protein_id="AAC34164.1"
FT /translation="MSTKFKTIITTAGAEKLAAATVPGGKKVNITVMAVGDGGGKLPVP
FT DAGQVQLVNEVWRHALNKISQDNRNSNYIVAELVIPPEVGGFWMRELGLYDDEGTLIAV
FT ANMAESYKPELAEGSGRAQTCRMVIIVSSIASVELSIDSTMVMATQEYVDDRIAEHEKS
FT RRHPDATLKEKGFTQLSSATDSASEVLAATPKAVKAAYDLANAKYTAQDASTAQKGIVR
FT LSSAADSTSEAEAATPKAVKIAMDNANARLAKDRNGADIPNPPLFVQNIGLKPTVDKAA
FT NAVDKNGDTMNGNLTLKGDYRLSFIIQNEDGSIRAYIFKDKGGDGIRISNGDDGGGDFV
FT FGKNGQFYCPDIMHVGNTIVWGDGNIEGARWGGLLSDWLTAQLVARDNNINLRAPYEWV
FT NQNFVNRAQRGAQASMTMDGGLVEAPWGCFLTGGNGNEGNQVGVALYRPLQILRNNTWV
FT TIEN"
FT misc_recomb 12962..12987
FT /note="Mu-like inversion crossover site"
FT /organism="Enterobacteria phage 186"
FT /gene="K"
FT CDS 13554..14054
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37843"
FT /note="unnamed protein product"
FT /transl_table=11
FT /protein_id="AAC34165.1"
FT /translation="MKLINLQRYILMNYFLGDGIQYFIDATGKDWYKSLPKFTKKYSLA
FT IENDTGVIRSISEDASRLYPGGLTVVDVDSIPAGCDIFGGWVFDGEKVIPREYTLAEQQ
FT RQSDEKKKTLLAEAEATISTLERAVRLGMATGEEIRRLEAWERYSVLVSRVKQSDDWPQ
FT KPE"
FT terminator 14058..14081
FT /evidence=NOT_EXPERIMENTAL
FT /note="t45"
FT protein_bind 14091..14110
FT /evidence=NOT_EXPERIMENTAL
FT /bound_moiety="B protein"
FT /function="activation of transcription from pJ"
FT promoter 14122..14159
FT /evidence=EXPERIMENTAL
FT /note="pJ"
FT /function="B-dependent transcription of J operon"
FT promoter 14159
FT /note="initiation point of late promoter pJ"
FT CDS 14183..15361
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37844"
FT /note="similar to P2 tail sheath protein FI, Swiss-Prot
FT Accession Number P22501"
FT /transl_table=11
FT /gene="J"
FT /protein_id="AAC34166.1"
FT /translation="MSDFHHGTKVIEINDGTRVISTVATAIVGMVWTASDADAETFPLN
FT EPVLITNVQSAIAKAGKKGTLSASLQAIADQSKPVTVVVRVAEGTGDDAEAQTTSNIIG
FT GTDENGKYTGIKALLTAEAVTGVKPRILGVPGLDTQEVATALASVCISLRAFGYVSAWG
FT CKTISEAMAYRENFSQRELMVIWPDFLAWDTTANATATAYATARALGLRAYIDQTIGWH
FT KTLSNVGVQGVTGISASVFWDLQASGTDADLLNEAGVTTLVRKDGFRFWGNRTCSDDPL
FT FLFENYTRTAQVLADTMAEAHMWAVDKPITASLIRDIVDGINAKFRELKSNGYIVDGEC
FT WFDEESNDKETLKAGKLYIDYDYTPVPPLESLTLRQRITDKYLVNLAESVNS"
FT CDS 15377..15898
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37845"
FT /note="similar to P2 tail tube protein FII, Swiss-Prot
FT Accession Number P22502"
FT /transl_table=11
FT /gene="I"
FT /protein_id="AAC34167.1"
FT /translation="MALPRKLKYLNMFNDGLSYMGVVESVTLPKLTRKLENYRGGGMNG
FT AAAIDLGLDDDALTVEWSVGGLPDVALWAQYAAPGADAVPLRFAGSYQRDDTGEIVAVE
FT VVMRGRHKEIDGGENKQGENTSTKLSTVCTYYRLTIDGSDIIEIDTVNMVEKVNGVDRL
FT EQHRRAIGLL"
FT terminator 15906..15932
FT /note="tI; partial terminator of pJ transcript"
FT CDS 15960..16295
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37846"
FT /note="Orf51; P2 E homolog; tail protein"
FT /transl_table=11
FT /gene="H"
FT /protein_id="AAC34168.1"
FT /translation="MAKAPRKTPEFIDTAGNEIDTVNPNVVTLDKPIKRAGQTIEKVTL
FT IEPNAGTLRGVSLAAVAQSEVDALIKVLPRMTYPALTTQELTAMNLPDMLSLAAKVIGF
FT LSPASAE"
FT CDS <16271..16447
FT /codon_start=1
FT /db_xref="SPTREMBL:O80316"
FT /note="Orf52; tail protein; probably produced by a
FT translational frameshift from orf51 into orf52"
FT /transl_table=11
FT /gene="H"
FT /protein_id="AAC34169.1"
FT /translation="FVTGFGGIDFPPGLSTDDLMADIAVIFHWPPSELYSLSLTELITW
FT REKALQRSGNHNE"
FT variation 16314
FT /note="Ham50"
FT /replace="a"
FT /gene="H"
FT variation 16421
FT /note="Ham56"
FT /replace="t"
FT /gene="H"
FT CDS 16440..18878
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37848"
FT /note="P2 T homolog; tail protein"
FT /transl_table=11
FT /gene="G"
FT /product="G protein"
FT /protein_id="AAC34170.1"
FT /translation="MSNNLRLEVLLKAVDQATRPLKSIQTASKSLSGDIRDTQKGLRDL
FT NGQASKIDGFRKASAQLAVTSQALDKAKREAGELAVQFKNTTNPTRAQAQALEAARRAA
FT SELQTKYNSLRTSVQRQRSELMQAGINTRTLSADERRLKTSISETTAHVNRQREALARV
FT SAQQAKLSRVKERYKSGKELAGNMAAAGAAGSVSRHGTMAGVKLLMPGYDFTQKNSELQ
FT AVLGVDKQSPEMQALRKQARHVGDNTAASADDAASAQIIIAKSGGDAAAIQARRRVTLN
FT MALSNRRTMEENAALLTGMKSAFQLSNDKIAHIGDVLSMTMNKTAADFDGLSDALTYAA
FT PVAKNAGVSIEQTAAMVGALHDAKITGSMAGTGSRAILSRLQLPPEKAFEAIKELGVKT
FT SDSKGNTRPIFSILKEMQRSFEKNNLGTSQRGEYMKTIFGEEASSAAAVLMEAASSGKL
FT DRLTAAFKASDGKTEELVKVMQDNLGGDFKEFQSAYEAVGTDLFDQQEGSLRKLTQTAT
FT QYVLKLDGWIQKNKGLATTIGIIAGGALALIGIIGGIGLVAWPVVMGINAIIAAAGVLG
FT TVFTVTGSAIVTALGAITWPIVAVGAAIVAGALLIRKYWEPISAFFSGVIEGIMSAFAP
FT VAEMFAPLAPIFDGLGEKLRGVWQWFKDLIAPVKATQETLDSCKNVGVIFGQALASALM
FT RPLNVFNKLRSGVDWLLEKLGIINKESDNLDQTAAKTNAATQGNSYIPATSTYGGYQAY
FT QPVTAPAGRSYIDQSKSEYKITLPGGAAPGHQLDRQLRDTLEQIEREKRARQRASMSHD
FT "
FT CDS 18891..19376
FT /codon_start=1
FT /db_xref="SPTREMBL:O80317"
FT /note="P2 U homolog; tail protein"
FT /transl_table=11
FT /gene="F"
FT /product="F protein"
FT /protein_id="AAC34171.1"
FT /translation="MMLALGMFVFERRTLPYQSMQHSKDYRWASNDRVGKPPAYQFLGE
FT GETSIQLAGTLYPAITGGWISLKAVEVMANEGRAWPLIEGTGNILGMYIVDKVSTTHAE
FT FFSDGAARKIDFTLSLKRVDESLTAMFGDLNKQASELLGSAGNLTDKLQSALGGLTA"
FT CDS 19373..20542
FT /codon_start=1
FT /db_xref="SWISS-PROT:P21679"
FT /note="P2 D homolog; tail protein"
FT /transl_table=11
FT /gene="D"
FT /product="D protein"
FT /protein_id="AAC34172.1"
FT /translation="MITGMTIDAGTSLAPAFMLTLNSQDITSNFSDRLISLTMTDNRGF
FT EADQLDIELDDTDGKVELPLRGAVLTLWLGWQGSALLNKGDFTVDEIEHRGAPDILTIR
FT ARSADFRGTLNSRREESWHDTTIGELVSTIAKRNKLTASVADSLKKIPVPHIDQSQESD
FT AVFLTRLADRNGATVSVKAGKLLFLKAGSAMTASGKPVPQMTLTRNDGDRHQFAIADRG
FT AYTGVTAKWLHTKDPKPQKQKVTLKRKPKEKHLRALEHPKAKPVSKKTKAKKEPEAREG
FT EYMAGEADNVLALTTVYASKAQAMRAAQAKWDKLQRGVAEFSITLALGRADLFPETPVR
FT VSGFKRVIDEQAWLISKVTHNLNNSGFTTGLELEVKLSDVEYNAESDDE"
FT variation 20378
FT /note="Dam23"
FT /replace="t"
FT /gene="D"
FT variation 20492
FT /note="Dam14"
FT /replace="t"
FT /gene="D"
FT protein_bind 20548..20596
FT /evidence=EXPERIMENTAL
FT /note="two CI binding sites for repression of pB"
FT /gene="B"
FT /bound_moiety="CI"
FT -35_signal 20549..20554
FT /gene="B"
FT promoter 20549..20584
FT /evidence=EXPERIMENTAL
FT /note="pB; repressed by CI"
FT /gene="B"
FT /function="transcription of B gene"
FT -10_signal 20572..20577
FT /gene="B"
FT CDS 20609..20827
FT /codon_start=1
FT /db_xref="SWISS-PROT:P08711"
FT /note="C4 Zn finger protein; P2 Ogr and P4 Delta homolog"
FT /transl_table=11
FT /gene="B"
FT /function="activate late gene promoters"
FT /product="B protein"
FT /protein_id="AAC34173.1"
FT /translation="MFHCPKCHHAAHARTSRYLTENTKERYHQCQNINCSCTFMTMETI
FT ERFIVTPGAIDPAPPHPTVGGQRPLWL"
FT variation 20690
FT /note="Bam57"
FT /replace="t"
FT /gene="B"
FT variation 20744
FT /note="Bam17"
FT /replace="t"
FT /gene="B"
FT terminator 20845..20866
FT /note="tB; termination of transcription from pB and late
FT promoter"
FT protein_bind 20889..21147
FT /note="predicted Int arm-type recognition sequences;
FT consensus = YAYCGCCAYTY; 3 sites to left of attP and 2
FT sites to right"
FT /bound_moiety="Int"
FT terminator complement(20930..20957)
FT /note="predicted terminator of lysogenic operon"
FT protein_bind 20959..20985
FT /evidence=EXPERIMENTAL
FT /note="IHF DNase I footprint location"
FT /bound_moiety="IHF"
FT tRNA 20985..21030
FT /note="truncated"
FT /product="tRNA-Ile"
FT misc_feature 20995..21030
FT /note="in common with attB in Escherichia coli, which is
FT in the 3' end of ileY"
FT misc_feature 21023..21029
FT /note="attP; predicted crossover region with attB"
FT variation 21030..22865
FT /note="del1 deletion"
FT protein_bind 21057..21086
FT /evidence=EXPERIMENTAL
FT /note="IHF DNase I footprint location"
FT /bound_moiety="IHF"
FT protein_bind 21075..21121
FT /note="five binding sites for Apl excisionase at attP"
FT /bound_moiety="Apl"
FT CDS complement(21157..21408)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P08685"
FT /note="Orf69"
FT /transl_table=11
FT /protein_id="AAC34174.1"
FT /translation="MSVRLAPDGTYVYGQPMLAPNGTYVGGGAPRLAPDGTYVGGVPRL
FT APNGSYVAGRPTLAPDGTYVGGRYHLAPDGTYVGDGSE"
FT CDS complement(21423..22433)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P06723"
FT /note="integrase"
FT /transl_table=11
FT /gene="int"
FT /product="Int"
FT /protein_id="AAC34175.1"
FT /translation="MTVRKNPAGGWICELYPNGAKGKRIRKKFATKGEALAFEQYTVQN
FT PWQEEKEDRRTLKELVDSWYSAHGITLKDGLKRQLAMHHAFECMGEPLARDFDAQMFSR
FT YREKRLKGEYARSNRVKEVSPRTLNLELAYFRAVFNELNRLGEWKGENPLKNMRPFRTE
FT EMEMTWLTHDQISQLLGECNRHDHPDLETVVRICLATGARWSEAESLRKSQLAKYKITY
FT TNTKGRKNRTVPISKELYESLPDDKKGRLFSDCYGAFRSALERTGIELPAGQLTHVLRH
FT TFASHFMMNGGNILVLQRVLGHTDIKMTMRYAHFAPDHLEDAVKLNPLVHITNSK"
FT CDS complement(22433..23011)
FT /codon_start=1
FT /db_xref="SWISS-PROT:P08707"
FT /note="immunity repressor; DNA-binding protein; has
FT positive and negative autoregulation by control of pL"
FT /transl_table=11
FT /gene="cI"
FT /function="maintenance of lysogeny; repress pB and pR"
FT /product="CI repressor"
FT /protein_id="AAC34176.1"
FT /translation="MRIDSLGWSNVDVLDRICEAYGFSQKIQLANHFDIASSSLSNRYT
FT RGAISYDFAAHCALETGANLQWLLTGEGEAFVNNRESSDAKRIEGFTLSEEILKSDKQL
FT SVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIEGAISIRELTKLPGRKLH
FT VAGGKVPFECGIDDIKTLGRVVGVYSEVN"
FT variation 22684..22685
FT /note="cI10"
FT /replace="g"
FT /gene="cI"
FT protein_bind 22726..22742
FT /note="FL; unknown function"
FT /gene="cI"
FT /bound_moiety="CI"
FT variation 22989
FT /note="cIam461"
FT /replace="t"
FT /gene="cI"
FT protein_bind 23011..23067
FT /note="locus of vir mutations; 3 binding sites for CI
FT repressor"
FT /bound_moiety="CI"
FT /function="repression of pR"
FT -35_signal 23026..23031
FT /note="pR"
FT promoter 23026..23063
FT /evidence=EXPERIMENTAL
FT /note="pR; repressed by CI and Apl"
FT /function="transcription of early lytic operon"
FT -10_signal 23049..23054
FT /note="pR"
FT protein_bind 23056..23123
FT /note="7 binding sites for Apl; locus of goa mutations"
FT /bound_moiety="Apl"
FT /function="repression of pR and pL"
FT promoter complement(23125..23159)
FT /evidence=EXPERIMENTAL
FT /note="pL; repressed by Apl; inhibited by convergent pR
FT promoter; activated by CI repression of pR"
FT /function="transcription of lysogenic operon"
FT -10_signal complement(23131..23136)
FT /note="pL"
FT CDS 23141..23404
FT /codon_start=1
FT /db_xref="SWISS-PROT:P21681"
FT /note="contains putative helix-turn-helix DNA binding
FT motif"
FT /transl_table=11
FT /gene="apl"
FT /function="excisionase; binds to attL"
FT /function="repressor: binds between and represses pR and
FT pL"
FT /function="appears to assist derepression during prophage
FT induction"
FT /product="Apl"
FT /protein_id="AAC34177.1"
FT /translation="MASEIAIIKVPAPIVTLQQFAELEGVSERTAYRWTTGDNPCVPIE
FT PRTIRKGCKKAGGPIRIYYARWKEEQLRKALGHSRFQLVIGA"
FT -35_signal complement(23154..23159)
FT /note="pL"
FT /gene="apl"
FT variation 23205..23219
FT /note="apl11 deletion"
FT /gene="apl"
FT variation 23236
FT /note="aplam"
FT /replace="g"
FT /gene="apl"
FT promoter complement(23400..23462)
FT /evidence=EXPERIMENTAL
FT /note="pE; activated by CII, allowing transcription of
FT lysogenic operon"
FT /function="transcript for establishment of lysogeny"
FT protein_bind 23404..23420
FT /note="FR"
FT /bound_moiety="CI"
FT /function="probably responsible for CI repression of pE
FT promoter"
FT CDS 23435..23944
FT /codon_start=1
FT /db_xref="SWISS-PROT:P21678"
FT /note="DNA binding protein; has putative helix-turn-helix
FT motif"
FT /transl_table=11
FT /gene="cII"
FT /function="required for establishment of lysogeny"
FT /function="activates pE, alternative lysogenic operon
FT promoter"
FT /product="CII"
FT /protein_id="AAC34178.1"
FT /translation="MFDFQVSKHPHYDEACRAFAQRHNMAKLAERAGMNVQTLRNKLNP
FT EQPHQFTPPELWLLTDLTEDSTLVDGFLAQIHCLPCVPVNELAKDKLQSYVMRAMSELG
FT ELASGAVSDERLTTARKHNMIESVNSGIRMLSLSALALHARLQTNPAMSSVVDTMSGIG
FT ASFGLI"
FT protein_bind 23435..23462
FT /gene="cII"
FT /bound_moiety="CII"
FT /function="activate pE"
FT variation 23440
FT /note="prevents CII binding to pE; cIV476"
FT /replace="a"
FT /gene="cII"
FT variation 23657
FT /note="cIIam475"
FT /replace="t"
FT /gene="cII"
FT CDS 23952..24179
FT /codon_start=1
FT /db_xref="SWISS-PROT:P15236"
FT /evidence=EXPERIMENTAL
FT /note="overexpression blocks cell division"
FT /transl_table=11
FT /gene="fil"
FT /product="Fil"
FT /protein_id="AAC34179.1"
FT /translation="MLKSEPSFASLLVKQSPGMHYGHGWIAGKDGKRWHPCRSQSELLK
FT GLKTKSPKSSGFLIIRIVHFVIKGVKHVTR"
FT variation 24112
FT /note="CP77am; filam"
FT /replace="a"
FT /gene="fil"
FT CDS 24166..24366
FT /codon_start=1
FT /db_xref="SWISS-PROT:P21680"
FT /transl_table=11
FT /gene="dhr"
FT /function="inhibits host DNA replication"
FT /product="Dhr"
FT /protein_id="AAC34180.1"
FT /translation="MSRDELRIVLGAMIPNMEEGFEIKTRDGAILRVDPEWECCKEFKD
FT GLKAEIIKQLKSKPAVVFGYS"
FT variation 24194
FT /note="CP78am; dhram"
FT /replace="a"
FT /gene="dhr"
FT terminator 24384..24412
FT /note="tR1; one of a number of transcription terminators
FT in this region that are anti-terminated during early lytic
FT development by an unknown mechanism"
FT CDS 24433..24666
FT /codon_start=1
FT /db_xref="SWISS-PROT:P21682"
FT /note="unknown function; not essential"
FT /transl_table=11
FT /product="Orf79"
FT /protein_id="AAC34181.1"
FT /translation="MSRTIYLSTPSGAGDHLLESLFKEAKKEERKDRRLAVSIRLEDLA
FT VHITNSDMTGKEAAELLRREATRFENESQELH"
FT CDS 24666..24893
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41059"
FT /note="unknown function; not essential"
FT /transl_table=11
FT /product="Orf80"
FT /protein_id="AAC34182.1"
FT /translation="MADAMDLAQLREQEDRERHISNARSRRHEVSAFICEECDAPIPEA
FT RRRAIPGVQCCVTCQEILELKSKHYNGGAL"
FT CDS 24890..25474
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41060"
FT /note="unknown function; not essential"
FT /transl_table=11
FT /product="Orf81"
FT /protein_id="AAC34183.1"
FT /translation="MSITNATISQRAKKWLEDDRIFIDTETTGLGDDAEIVEICLIDSA
FT GFIMLNTLVKPTKPIPAEATAIHGITDEMVMYAPTWKDIHGAVASLFFEYGFVIYNADY
FT DTRLIYQTAKLYGLENDGFCYFLNERSACAMMLYAEYRGEPGRFKGYKWHKLVDAAAHE
FT GVSVEGKAHRALADCRMTLGIIDALAKGGAA"
FT CDS 25471..25746
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41061"
FT /note="unknown function; not essential"
FT /transl_table=11
FT /product="Orf83"
FT /protein_id="AAC34184.1"
FT /translation="MSIRIEIGDKWVITSDQYQFILNEKKVVKTGNKAGEEWLDTIGYY
FT PKINQLISGLVHHHIHTAMIISLSAMAEEIEKLSFICEEAFKAVKK"
FT CDS 25743..26747
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41062"
FT /note="unknown function; not essential. translation to end
FT of orf84 appears necessary for translation of A protein"
FT /transl_table=11
FT /product="Orf84"
FT /protein_id="AAC34185.1"
FT /translation="MIDSRCFAESTINIVSVSGGKDSLAQWILAVENDVPRTTVFADTG
FT HEHSQTMEYLDYLESRLGPVIRVKADFTRRIEGKRKFIAEKWPVSLVEECGMSHEQAAE
FT RIAKALEILKPTGNPFLDLCMWKGRFPSTKARFCSLELKHDSVRDKIVLPALEKYDEVI
FT LWQGVRAQESPARAALPMWEEDADNTPGLHVYRPILNWTHEDVFALAKRHGIKPNPLYQ
FT QGCSRVGCMPCIHARKSELAEIFARWPEEIARVAEWERLVAACSRRGNSTFFPSTHDPR
FT RAEKRIEVVTVEEYGIASYRDWAMTTRGGSQYDLLAATNDKTVCSSVYAGVCE"
FT variation 25803
FT /note="am43"
FT /replace="t"
FT /phenotype="lethal due to polarity on A"
FT variation 25845..26288
FT /note="del444"
FT /replace=""
FT variation 26460
FT /note="am11"
FT /replace="t"
FT /phenotype="lethal due to polarity on A"
FT CDS 26744..28828
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41064"
FT /note="rolling circle replicase; putative endonuclease;
FT similar to P2 A protein"
FT /transl_table=11
FT /gene="A"
FT /product="A protein"
FT /protein_id="AAC34186.1"
FT /translation="MTGVVYAFPWNAPRSAIASSYLTYDQQHRRDRMFAALLHARKVLF
FT LQPECVRFDVYRTAAVLEQNQGSQRANAFLISFCKKALPRLELVAKKYECSGINSNVSA
FT AVFDGHFDTQLMQYLASRMVNMVARFNRLPDMSRADIDLLAADIANFIRAELADIDDTG
FT FSELKTLYTWYMRAGFISLQFNVTPPKWERVTKKYFCEDEIAPAVMRMFNEVWWRGRLR
FT RIAAAWREHLQIAVGNVSKKRHAYASKNCVTDWREQKRRTREFLKGLDLEDEEGNRISL
FT IEKYDGSVANPAIRRCELMARIRGFENICNELGYVGEFYTLTAPSKYHATTKAGYRNSK
FT WNGASPSDTQSYLTGLWARIRAKLHREEIRIFGIRVAEPHHDGTPHWHMLMFMLPEDVE
FT RVRLIIRDYAWEEDHYELRSDKAKKARFHAEAIDPEKGSATGYVAKYISKNIDGYALDG
FT ETDDESGELLKETAPAVSAWAARWHIRQFQFIGGAPVTVYRELRRMADPETARALSVEF
FT AAVHDAAHYGRWADYVNAQGGPFVRRDDLQVRTLYEPRTEFNQYGEETVCIKGVYDASI
FT GAGSPILTRLTQWKIVPKRAVDLAVDVKGASAPSRSSVNNCTGSESDPPILDLTKPLSR
FT RERRELTNRLRKKKPTTRRKFIHGTDKQNVAITKTIDEIHSDNRHHNQPGRSPAPDGRW
FT "
FT terminator 26829..26856
FT /note="tM1; expected terminator for lytic transcripts in
FT absence of translation of A gene"
FT /gene="A"
FT variation 27542
FT /note="Aam24"
FT /replace="t"
FT /gene="A"
FT rep_origin 28576
FT /note="located by similarity with P2; consistent with
FT electron microscopy mapping"
FT /gene="A"
FT -35_signal 29020..29025
FT /note="p95"
FT promoter 29020..29056
FT /evidence=EXPERIMENTAL
FT /note="p95"
FT /function="SOS-dependent transcription of SOS operon"
FT -10_signal 29044..29049
FT /note="p95"
FT protein_bind 29044..29063
FT /note="putative"
FT /bound_moiety="LexA"
FT variation 29053..29055
FT /note="cIII"
FT /replace="tt"
FT variation 29074
FT /note="tum9"
FT /replace="a"
FT CDS 29082..29522
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41063"
FT /note="expression repressed by LexA"
FT /transl_table=11
FT /gene="tum"
FT /function="inhibits CI DNA binding"
FT /product="Tum"
FT /protein_id="AAC34187.1"
FT /translation="MDRELNEHVMIERVEMIARLTAEGTCQERDREIALNLIAEIARGN
FT LMKNNNFSVVFSAPPVGETFAKEGKVKVNITLDKDQKIGQPVIDAFQCELTKRIQSVFP
FT STRVTVKKGSMTGVELMGFDKDSDREALDSILQEVWEDESWR"
FT CDS 29109..29522
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41063"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="tum"
FT /function="modulates SOS induction"
FT /product="truncated Tum95.2"
FT /protein_id="AAC34188.1"
FT /translation="MIERVEMIARLTAEGTCQERDREIALNLIAEIARGNLMKNNNFSV
FT VFSAPPVGETFAKEGKVKVNITLDKDQKIGQPVIDAFQCELTKRIQSVFPSTRVTVKKG
FT SMTGVELMGFDKDSDREALDSILQEVWEDESWR"
FT variation 29115
FT /note="tum16"
FT /replace="a"
FT /gene="tum"
FT variation 29182
FT /note="tum13"
FT /replace="t"
FT /gene="tum"
FT variation 29199
FT /note="tum17"
FT /replace="a"
FT /gene="tum"
FT CDS 29220..29522
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41063"
FT /evidence=EXPERIMENTAL
FT /transl_table=11
FT /gene="tum"
FT /function="modulates SOS induction"
FT /product="truncated Tum95.4"
FT /protein_id="AAC34189.1"
FT /translation="MKNNNFSVVFSAPPVGETFAKEGKVKVNITLDKDQKIGQPVIDAF
FT QCELTKRIQSVFPSTRVTVKKGSMTGVELMGFDKDSDREALDSILQEVWEDESWR"
FT variation 29245..29251
FT /note="tum14"
FT /replace="ttttt"
FT /gene="tum"
FT CDS 29292..29522
FT /codon_start=1
FT /db_xref="SWISS-PROT:P41063"
FT /evidence=EXPERIMENTAL
FT /note="truncated Tum - modulates SOS induction of 186
FT prophage. GTG start codon."
FT /transl_table=11
FT /gene="tum"
FT /product="bacteriophage 186 Tum95.5"
FT /protein_id="AAC34190.1"
FT /translation="MKVNITLDKDQKIGQPVIDAFQCELTKRIQSVFPSTRVTVKKGSM
FT TGVELMGFDKDSDREALDSILQEVWEDESWR"
FT variation 29391
FT /note="tum2"
FT /replace="t"
FT /gene="tum"
FT terminator 29545..29576
FT /evidence=EXPERIMENTAL
FT /note="t95a; partial termination of p95 transcript"
FT CDS 29604..30335
FT /codon_start=1
FT /db_xref="SPTREMBL:Q37850"
FT /note="expression from plasmid blocks 186 infection"
FT /transl_table=11
FT /gene="orf97"
FT /product="Orf97"
FT /protein_id="AAC34191.1"
FT /translation="MDTVIAFLSLALFIAFIVGLIKPSLVRMPSRKRSSAVYLGGCLAL
FT GVIGSILWPTEKTQPVAKTDVPAVKAEPATPTFEYADKTLKEYRNEPKETRHEIVKDYV
FT GFKGVQASATDVFYACMSEYTFTKDDALKLSDVLGWCFNDFEKDPQSLNNKINLDEFQG
FT NFSGWDGSYRPLEKLIKASMNDDSSYKHVSTVYHLILNKDPHAVVKTTFRGTNAYGGVV
FT KQTVAARVNVRTGEVDSILDN"
FT variation 29691..30304
FT /note="del97"
FT /replace=""
FT /gene="orf97"
FT terminator 30436..30463
FT /note="t95b; p95 transcript terminator"
SQ Sequence 30624 BP; 7461 A; 7801 C; 8456 G; 6906 T; 0 other;
ggcgtggcgg ggaaagcatt gcgcgccaga ggtggcgcgt gaatgataaa aattatcgtc 60
tgagcgcctc gtaatggcgc tatcgtggtg ctgttggttc gttggtggtc gtgtgtgttt 120
gtgcgcgtgt ggcgcgtctg agacgtgatg gtggcggggt atgaaaaagc cgccatgctg 180
gcggcttgag agggattatt ccgggttgtc gagggtgtac tctttgaacc tgatgacctc 240
catgccgagc cagtcgttta cctccctgaa cctgtcctgc agcggcgaca ggtcgttacg 300
cacaaatacc tttgccactt tctcaacgtc accgagcgag ccgatattct cgggcttgcc 360
gcccatgagc tggaacggta cgcggtgcgc gtccatcagg tcggcggcgc tggctttctt 420
gatgttgaaa aagtcatcct ttgtggcgac ctcgctcagt ggcacgattt taatgccgtc 480
cggttttcca ttgggagcgt agaaaaacag gtttttaaaa ttgccgagcc ctttcgagtt 540
gcgcatcgcc tcgcgcagcg attcgacgtc ggtcgcgctc tgcgccgggt cggtcacata 600
catgatgtaa cccgcatgcg cgccgttctg gtaatacttg cggcggaaca gcgttgcgga 660
ttcattcagc caggcggaat taagcgcgct gagatattcg ggcaggccgt aaatctcctg 720
attaatgtcg ggctccagca ggtgaaacac ggtatcaggc gcgaattcat gcggcagagt 780
gaagttttcc acaaaccaga aaaccgaatc gtcgaccccg cggcgggtgt atttggccgg 840
tgaggccagt agcttgatta gctggccggt aacgctgtgg cgctgctcaa gaaaggcgtt 900
gccgaatacc agatagtcga gcgcaaagcg gctgaaatcc tgacgggaca gcagcgggtg 960
cgggatgtag gtgctcgcga gcacgttgcg cttaacgtaa atcggtgagc tgtgatgtac 1020
agcagagcgc aggctctttg ccagcccgga gaagctgacc ggcggctcgt accatttgcc 1080
gttactgatg cactcgacat aatccagaat gtcgcgctta tcgagtaccg gcactggctc 1140
gccaaaggtg aacgcctcca ttttttgcgg ggcgctggcg gtcatggcta cctgtttgcg 1200
tggcttgcgc ttgctcatgc tgccacctca cccgctgcaa cagcgaaaga ccagtcgcag 1260
ccaaacagca ggcgataatc atcgtcgctg tattcgtgtt taatttcatc gggcgcaaag 1320
agattgcacc cgcgctggca tgctgcatcc agagtgaccg actgacgcca gacaccatct 1380
gtacaaaata cgctgtcgcc ggtattgatg agcggtgacg gtcggtgcct gcgggttgtg 1440
ccgttccata ccctgaaagc gtcataatta tcagagggcg aggtaaacat cgtcaggctg 1500
tggcgtttat ggcaggcgat acccgccgcg actttcgcag ctcttagcgg gttattgaac 1560
catccgaact catcaagata gacattaccc gccagtgcgg cgcaatggga ttcctcgccg 1620
acaaagctga taaccgcacc gtcgtcgagc tgcaggctgt ggccgttact cgtaagactg 1680
acgccgacgc gcgccgaaag gttactcatg tacatcagcg ccacgcgcgc atgctcaata 1740
gtgtgagcaa accagacatg attatcgcct gttgtcagcg catcgagcag cgcctcacgg 1800
ctaaagagct gcgttgcgcc aatctggcgc gatttggtga tgctgcggtc gatattgagt 1860
ttcccgacac gcaaccatgt tgcctgatag tcaaagctgt cattgtgcag aatatcggcc 1920
attgcctgaa tctggctttg tgagaaaacg ttatttttca ttaattaaac tccagaatgg 1980
atttaggctg tatgccgcta ccggcggaaa gcggttcgtt taacagggcg tgcatggtcg 2040
cccatgcaat atcggcgtga ctggcttcct cggtgcggct ggcctcgtag gtggcgctgc 2100
gcccgctgct ggtcatggtt ttgcggatgg acataaacga ctgcgtgacg tcggttgctc 2160
cggcgtcgta ctccagacag ccgcggcgaa tggtgtcttt tgccttgagt accattgcgg 2220
ttttcatttc aggcgtgtaa cggatgccgc gtgcggccgg gtagaatgag cgcaccaact 2280
ggaacacgcc gaggccgagg ccggttgcgt caatgccgat gtattcgacg ctgtatttct 2340
cggtcagttt gcggatgcca tctgcctgcg cggcaaagtc catgcccttc cactggtggc 2400
gctccagcat gcggaacttg ccaccagaaa ccaccggcgg cgcgagcacg acgcacccgg 2460
cgctgtcgcc agtgtgtgac gggtcgtagc caatccagac ggggcgagag ccgaacggat 2520
ggtcggcgaa cggggcgaag tcctcccatt cttccatcac gtcgaccatg cagcgctgca 2580
gctcctcgaa cgggaatacc gacgctttat cgtcgacaaa ctcgcacata aacaggtttt 2640
taaagtcctc atcactgttt tcgcgtttga gttggtcgag gtcgaacagg gtgcagccac 2700
cggcaagggc gtcctcaatg gtgacaatct gccgccactg gccatcgtcg cagagctggc 2760
caccggcgag cgcgcggtga ctgatgtcaa tttcgatgcg gtcggcaata cggctgcgcc 2820
ccttgttgaa cagctcgcca gaccagaagg gataagcgcc gtgcgccagc gttgagggtg 2880
tcgaaaagta ggttgagcgc agatgcttct gcgaggccat gcccgaggcg actttgcgca 2940
gcttctgaaa attcgggatc cagaatattt catcgacata caggtcgccg ttatggctct 3000
gagccgtgtt ggagttggta ccgagaaaaa tcagctttgc gccgttgttg ccaatgacaa 3060
tcgggtcgcc ggtcaggtcg acgtcaacca gtcgcgcaaa ctgtatgatg tattcgcgga 3120
acacgtaagc ctgcgtttta ctggccgaca gaaaaatctg gttatggccg gtcttgagtg 3180
ctcgcagcag tgcctcacgg gaaaaataga acgtcgcgcc aatctggcgg gatttgagaa 3240
tgtcgcgaat acggtgtgcc agtcctgcgc ggtaccactg caactggtac tcgaaagact 3300
ggtcgaaaaa taattcctcc agcttttcga tagcctcgtc gctgaaaaaa ttctttttcg 3360
gcttcttgcg ctcacccttg ttgcggttgg cgacgttggg gttaaggtcg gcctcgttgc 3420
cggtctggct gtagcggtta acgcgtgcca gtcgttcaat ctgccgcccg agcaggtcaa 3480
tctctttgaa gtcaccgcct gacttttgcg gcttggcgat gagctgaatc aggcgcgcct 3540
caaggctgct ttcaacgcgg gaaatcggtg cgatgccatc ccagccgtcg cgctgtttcc 3600
agctctgcac ggtcgggcgc ttgacctgca gcatttcggc aatctgcggc acggaaaaac 3660
cctgccagta aagcagcgat gcctgtcgtc gcgggtcatg caacaaggtt gtatcggtgg 3720
aaatggtcat tgatgcctcg ccgtaatgga ttcagggcaa ggctacttaa tggccgtcag 3780
tgattcgcta aggtgctgtt gtgtgggcgg ttgtccagtc gtcattggtg gtctggcgtg 3840
tcctgagtct ggaaactggc ggtgaccagt aaccccaacc tcaggactcc tgacaatggc 3900
aaaaaaagtc tcaaaattct ttcgaatcgg cgtcgagggt gatacctgcg acgggcgcat 3960
tatcagcgcc agtgatattc aggaaatggc cgaaacctat gacccgcgtg tttacggttg 4020
ccgtatcaac cttgaacacc tgcgcggcct gttgcccgat ggcatattca agcgttacgg 4080
cgatgtggtc gagctgaaag ccgagaagat tgacgacgat tctgcgctta acggcaagtg 4140
ggcgttgttc gctaaaatca ccccgaccga tgaccttatc gcgatgaata aagccgcgca 4200
gaaggtctac acctcaatgg aaattcagcc gaattttgcc aataccggca aatgctacct 4260
cgtcggcctt gctgtcaccg atgacccggc gagcctcggc actgaatatc tcgaattctg 4320
ccgcactgcg aagcacaacc cgctgcagcg ctttaaagcc caccctgaaa acgtcttttc 4380
cgccgccacg ctggccgaac tggaatttga agacgttccc gacacggtgc tcaacagcct 4440
ggccgataag gtgaaagcca ttttcagccg taagcaggtc agcgacgatg cgcgcctgaa 4500
tgatgtacat gaagcggtga ccgccgtcag cgagcatgtg cagaccaacc tcactgcaca 4560
ggataagcgt ctttccgata tggaaaccgc gtttgccacc ttcaaacagg aactgaccgg 4620
caaggttgaa gaaaccagcc aggcattttc cgtcctgaaa accactctcg acaaaaccga 4680
aagtttcagc cagccgcgac gcacgaaagc cagcggcggt ggtggcgatg agctgctgac 4740
tgactgctga taaaccgcag accgaaaccg ggcggaaccc ccgcccgatg ctgtgactaa 4800
ccgattaaat caaacaggaa atactatgcg tcaggaaacc cgttttaagt tcaatgccta 4860
tctgacccag ctcgccaaac tgaacggcat cagcgttgat gacgtcagca aaaaattcac 4920
cgtcgagccg tccgtcacgc aaacgctgat gaacaccgtg caggcgtcat ccgcgtttct 4980
gcagatgatt aacattctgc cggtcgcaga aatgaagggt gagaaaatcg gtgtcggtgt 5040
gaccggcacc atcgccagca cgaccgacac ctcgggcgac aaagagcgcc agaccgcaga 5100
ttttaccgcg cttgagtcca acaagtacga gtgcaaccag attaactttg acttccacct 5160
gacctataaa cgcctcgacc tgtgggcgcg ttttcaggac tttcagcgtc gtattcgcga 5220
cgccattgtc cagcgtcagg cactggattt catcatggcc gggtttaacg gtaccacccg 5280
cgctgacacc tctgaccgtg ttaaaaaccc gatgctgcag gatgtggccg ttggctggct 5340
gcagaaatac cgcaatgaag ccccggcgcg tgtgatgagc aacatcaccg acgctgacgg 5400
taaagtcgtt tcggcagtga ttcgcgtcgg taaaaacggc gactatgaga acctcgacgc 5460
actggtgatg gatggtacca ataccctgat tgacgagatt tatcaggatg acccgaaact 5520
cgttgccatc gttggccgta agctgctggc cgacaaatat tttccgctgg tcaacaaaca 5580
gcaggaaaac accgagtcgc tcgcggcgga tatcatcatc agccagaagc gcatcggcaa 5640
cctgccagcc gtacgtgtgc cgtacttccc ggcgaacgcg gtgttcgtga ccacgctgga 5700
aaacctctct atctatttca tggatgagag ccaccgccgc agcattgatg aaaacccgaa 5760
aaaagaccgc gtggaaaact acgagtcgat gaacatcgac tatgtggtcg aggcgtatgc 5820
cgccgggtgc ctgctggaaa acatcaccct gggcgatttc accgcacctg cagcaccgga 5880
aggcggagag taaacccatg acgagccccg cacagcgtca catgatgcgg gtctcggcct 5940
ctcaagccgc gcagcgggaa caagccccgc tgcgccatgc aaccgcctat gagcagatgc 6000
tggttaagct ggccgatgac cgccgcacgt taaaaaacat ccgttcaaac gaacgtaaag 6060
ccgagaaaaa gcgcgagctg ctgccgttct atgcgccgtg ggtcgccggt gtgctgactg 6120
atggtcgtgg tgcgcaggat gacattgtta tgaccgtcat gctgtggcgt ctcgatgccg 6180
gtgatatcgc tggcgcgctg gaaattgccc cctacgcgct gaagtacggc ctcacctctg 6240
accatcgccg cacgacacct tacatgctgg tcgaggaagt ggcacttgcc gcgcagcgcc 6300
tgcgcgatgc cggtgagtct gtcgaccttt cctggctgca ggccactatc gacctgaccg 6360
acggcgctga cgttcccgat atggtgcgcg cccgtctgca taaggtgaca ggcctgaccc 6420
tgcgtgatgc cggtatgaat gcagaggcgc tggcgcagtt tcagcgcgcg atgcagctcg 6480
accgcaatgc cggtgtgcgc aaggagattg agcgactgga acgggcattg aagccaaaga 6540
cagaggccgc gccccgtaaa acgactaaac cgcgcacgcg taaacctgcc accaaaccgg 6600
cagcaaagcg cgggcgtcca ccaaaggcgg caaaaaccgc cggttaactg aacgctcccc 6660
gagccgggcg gcacgccggt caaagcaggc aaagacctga cggcgaccgg cgtccaccgc 6720
ccaacctgat gaggttgtca tgacgacagt gatactgaac cagcccgacg aaccgcagga 6780
cgtaccgggc gtggtgattc ccgcaccgga gacgggcggt gcagtgatta aaaacacgtt 6840
ctttttccct gatgtggatc cgaagcgcgt gcgcgaactg atgcgccttg agcagacggt 6900
ttccgatgcg cgcctgcgca atgccatcaa gaccggcatg gccgagacca atgcggagct 6960
ttacgactac cggctgcgcc agactgccgc cgggtttaag caactggccg acgtgcctgc 7020
cgaggaaatc gacggcgaga atgtacgtgt tttccactat ctgagtgctg tgacggcaat 7080
ggcaaccgcc accctgtatg agcgctatcg cggcgttgag gccaccggca aaggtgacaa 7140
aaaagccgac agcgtggaaa ccaccattga tgacctgtgg cgggatatgc gctggtcagt 7200
tgcgcgtctg caggacaagc cgcgctgcat tgtggggcag ctctgatgaa agtcaggtcg 7260
atgcagggcg ataccctcga cacgatttgc gccaggtatt acgggcgcac tgagggcgtg 7320
gttgagacgg tgctgcaggc taatccgggt ctgtctgagc tgggtgtcat tctgccgaat 7380
ggtacagaga ttgacctgcc cgatgtggca tcgtcacccg taactaaaac tatcaacctt 7440
tgggagtaac catgacagaa ggtgaaaaag gcgtcctgtc actgtttgtg attggcgtga 7500
tgattgttgt tgggaaagtg ctggcaggcg gtgaacccat caccccgcgt ctgtttattg 7560
gccgcatgct gctcggtggt tttgtttcaa tggtcgccgg tgttgttctg gtgcagtttc 7620
ctgacatgtc actgcccgcc gtgtgcggga ttggatccat gctcggtatt gccggttatc 7680
aggtggttga aatcgccata cagcgccgct ttaagtcaca aaagggggaa agtgatgccg 7740
gtcattaaca ctcaccagaa tatcgctgcg tttctggaca tgctggcgta ttccgaagga 7800
acagcgaacc atccgctgac gaaaaatcgt ggctacgacg tcattgtcac tggccttgat 7860
ggcagaccag agattttcac cgattacagc gaccaccctt tcgcgcatgg ccgaccaccg 7920
aaagtgttta atcgccgtgg cgagaaatcc acagcctcgg gacgttacca gcagctttat 7980
ctgttctggc cgcactatca gaaacagctc gcattgcctg atttcagccc actgtcgcag 8040
gataagctcg cgatccagtt aatccgggag cgcggtgctc ttgacgatat ccgggcgggg 8100
cgtattgagc gtgctgtttc acgttgtcgc aatatctggg cgtcattacc gggggccggt 8160
tacggccagc gcgagcacgg tctcgaaaag ctggtcacca tctggcgcac ggctggcggg 8220
gtggtggcat gaaagtcctg ataacgctgc ttgtgatggc cgtgctcggg ttgctgtggc 8280
tgcaccatga gaacggcaat ttatcccgct catttgagac ggcaaaccgc gtcgcgagcg 8340
agcaaaagac gacgattggg atgctgaaaa atcagctcag tgttgccggt cagctcgccc 8400
gacgtaatga atccgcgcag gtgacactgc gcgaacagct cgcaaaggca agtgcagaag 8460
ccagccgccg tgagcagacg ataacgaggt tacttaatga aaatgaagcc tttcgccgct 8520
ggtataacgc tgctctgcct gatgctgtgc gtcggctgca cacccgaaca gcctgcgcca 8580
gtgccggtga ttgtggtcaa cggatgcccg agggtgagcc tttgccctat gccgggaagt 8640
gacccgaaaa ccaatggtga cctgagcgca gatatccgcc gtcttgaggg ggcgctgact 8700
gcctgcgcgc tgcaggtcaa aaccgtcaaa cactgtcagg atgaactcga tgcagaagca 8760
caaaagcctg cgcaaagcgc tgattaacgc cgtgccgcag ctccgaaata accccgatat 8820
gctgcgcctt tttgccgaca acggccacac cgattcccga ctggcgagct cgctgtcgtt 8880
tgaaaaggtg tatgtgctta acgtggtggt gaccgacttt actggcgacc tcgatttgat 8940
attcgtgccg gtgcaggcat ggctgcgtga acatcagccg gacattatga ccaccgacga 9000
cgggcgggaa aaaggattca cctggattat tgatatcaat aacgacgatt cgctcgatat 9060
cagtatcagc ctgaggctca ccgagcgcac gctcgtcaaa gaggtcgggg gcgcgctgca 9120
tgtcagttat gcaccagaac cgccactgcc tgagctggtg aagcgcccgg ttgctatgta 9180
tgcaaacggt gaattagtga gccagtggga tgagtgaatt aaccgcgctg caggagcgcc 9240
tcgccggtct gattgccagc ctgtcaccgg cggcacgtcg caaaatggcg gctgagattg 9300
cgaaaaagct gcgtaccagt cagcagcagc gcatcaagcg ccagcaggca cccgacggca 9360
ccccgtatgc cgcacgaaag cgccagccgg tacggagcaa gaaaggccgc attaagcgcg 9420
aaatgttcgc caaactgcgc accagtcgct ttatgaaagc caaaggcagc gatagtgcgg 9480
cggtggtgga gtttaccggc aaggtgcagc gcatggcgcg ggtgcatcag tacggcctca 9540
aagaccgccc aaaccgcaac agccgggatg tgcagtacga ggcgcgcccg ttgctcggtt 9600
tcacccgcga cgatgagcaa atgattgaag acgtcattat cagccacctc ggcaaataaa 9660
tattgtgtga accaccaccg gaggcgcgtg atttggcgcg gctaaagacc agaggcattc 9720
tttgcactat gaatacgtta tccacgatac aggagctcgc gcgtgcgatt cgtaacctca 9780
tccgctcagg tgtggtgacg gaggtcgata ccgtgcaggg gctgtgccgc gtacaaagcg 9840
gcgggatcca gacgacatgg ctgaactggc tgaccacccg cgccggtcgt tcgcgcacat 9900
ggtgggctcc ctcgctcggt gagcaggtgc tgctgctggc aatcggtggc gagcttgata 9960
ccgctttcgt gctgccgggg attttctccg acgataaccc cgctccgtct gcctcggcgg 10020
atgcgtggca tgtggttttt cctgatggcg cggtcattga gtacgagccg gagaccagtg 10080
cactgacggt cagaggcatc aaaactgctg acgtgaccgc gtcggaatcc atcacggcca 10140
ctgtgcctgt ggtgctggtg aaagcagaaa cccgcatcac cctcgacacc ccggaggtgg 10200
tatgcaccaa caaactgacg acggcaacgc ttgaggtgca gaaaggcggg gagatgagag 10260
gcgacattgt ccacaacggc ggcacattta aatcaaacgg tgtgcagctc gacgaccacg 10320
gtcacggtgg tgtgcaaaga ggcggtgcct ggacggagga caccaaatga cggcgcgcta 10380
tatggggatg aaccgcaaca ccggtctcgg tatcagtgac actgaacaca tcagccagag 10440
catgcgcgac attctgctga cgccggtcgg ctcgcgggtg atgcgtcgtg aatatggctc 10500
gctcctgtct gcgctgattg atatgccgca aaacccggcg ctcaggctgc aaatcatggt 10560
ggcgtgctat tcggccatcc agaagtggga gccgcgtatc aggcttacat ccatcagctt 10620
tgagactggt gatgctggcg agatgtatgt cgatattacc gggatgcgta ccgatacggg 10680
tgcgtcagtt tcaaccactg tttcactgag ttaaatcact atggcaactg ttgacctgag 10740
cctgttaccc gttcccgatg tggttgagga actggatttt gaaaccatcc ttgcggaacg 10800
cattgcgacg ctaatttcgc tataccccga agaccagcag gaagctgtag cccggacgct 10860
cgcacttgag tctgaaccaa ttgttaaatt gctgcaggaa aacgcctacc gtgaggttat 10920
ctggcgtcag cgtgttaatg aagctgctcg cgcaggcatg ctggcttatg ccagagatag 10980
cgacctcgat aatctcgggg cgaatttcaa tgttgagcgc ctggtcgtca ggcctgctga 11040
tgacaccacc atccccccga cccccgctga aatggagctt gatgccgatt ttcgtctgcg 11100
tatacagcag gcatttgaag ggatgagcgt tgcgggatcc accggagctt atgaatttca 11160
tggccgcagt gctgacgggc gtgtcgcaga tatttctgtt atcagccctt ccccagcatg 11220
tgtcacgata tctgtgcttt cgcgtgagaa taacggtgcg gcgtctgatg agcttcagag 11280
catcgtgcgc aatgcgctga atgctgagga cgtgaggccg gttgctgacc gggttacagt 11340
gcagtcagct cagattattg actaccagat acgcgcaaca cttttcgttt atccggggcc 11400
ggaaaatgag ccgattcgtg cggcggctga ggcgaagctc aaagcttata tcagtgcaca 11460
gcacaggttg gggcgggata ttcgcctgtc agcaatttat gccgcgttgc atgttgaggg 11520
ggtgcaacgt gtcgaactgg ctgcacctgt ggccgacatt gtgcttgata aaacgcaggc 11580
atctttttgc acagactatc agatagtgat tggtggctcc gatgagtgat gtccgcctgt 11640
tacctgtagg gtcatcacct cttgaggtgg ctgctgccag agcctgcgca gatattgaaa 11700
atacacctgt tccgttacgc cgcctgtgga gtcctgacac ctgtcctgca aatcttttgc 11760
cgtggctggc gtgggcgttt tccgttgacc gctgggatga gaactggccg gaaaaaacaa 11820
agcgcgatgt tattcgcagc gcgtatttca ctcactgcca caaaggcacg ataggcgctg 11880
tcaggcgagt tattgagccg ctcggataca taatcaacgt tacggaatgg tgggagacag 11940
gtgacccggc gggaacgttt cgtcttgata tcggtgtgct ggaaagcggt attaccgaag 12000
aaatgtattt agaaatggag cggttgattg ctgatgcgaa acctgcgagc cgtcatttga 12060
ttggcctgaa tattatccag gatattcccg gttatatgta tacaggtggt gtgagctgtg 12120
acggcgacat tattacagtt taccccggat aagtgaggaa taatgagcac gaaatttaaa 12180
actattatca ccactgccgg agccgaaaaa ctggcagcgg ctactgtgcc gggtggtaaa 12240
aaagtgaata tcaccgtgat ggccgttggt gacggaggcg gaaaactgcc agtgccggac 12300
gccggtcagg tgcagctcgt gaatgaggtc tggcgccatg ccctgaataa aatcagccag 12360
gacaaccgga acagcaatta cattgtagcc gagctggtta ttccgcccga ggtgggagga 12420
ttctggatgc gcgagttggg tctttatgat gacgagggca ctctcattgc tgttgccaat 12480
atggcagaaa gctacaagcc agaacttgcc gagggctcag gccgtgcgca gacatgtcgc 12540
atggtcatta ttgtcagcag tattgcctca gttgaattat ccattgattc gacaatggta 12600
atggcgacgc aggaatatgt tgatgacagg attgcggaac atgagaagtc acgtcgacat 12660
cctgacgcca cactgaaaga aaaaggcttt actcaactca gtagcgcaac agacagcgcg 12720
tctgaggtgc ttgcggcgac gccgaaagcg gttaaagcgg cgtatgacct tgctaatgct 12780
aaatataccg ctcaggacgc gagcacagcg caaaaaggca ttgtgaggct gagtagtgcg 12840
gcagacagta ccagtgaagc tgaggccgca acaccgaaag ctgtcaaaat tgcgatggat 12900
aatgcgaatg cgaggctggc aaaagaccgg aacggcgctg atattccgaa tccgccgttg 12960
tttgtccaga atatcggttt aaaacccacg gtcgataaag ctgctaatgc cgttgataaa 13020
aatggcgaca cgatgaacgg aaacctgaca ctcaagggtg attaccggct gagttttatt 13080
atccagaatg aagacggttc tattcgtgct tatatcttca aggacaaagg tggcgacggt 13140
attcgcatca gtaatggcga tgacggcggc ggtgattttg tttttggtaa aaatggacag 13200
ttttactgcc cggatattat gcatgttggt aatacgattg tatggggtga cggaaatatc 13260
gagggggcgc gatggggcgg tttgttgagc gactggttaa ctgctcaact ggttgcccgt 13320
gacaataata ttaacttgcg agcaccctat gaatgggtta accaaaactt tgtcaaccgt 13380
gcacagcgcg gcgcacaggc cagcatgact atggacggcg gacttgtaga ggctccatgg 13440
ggatgttttc ttacgggggg gaacggtaac gagggtaatc aggttggagt ggctttatac 13500
cgtccattgc agattcttcg caataatact tgggtaacga tagagaactg aaaatgaaac 13560
tgattaattt gcaacgctac attctgatga attatttttt aggtgatggc attcagtatt 13620
ttatagatgc cacaggtaag gactggtata aatcactgcc caaattcaca aagaaataca 13680
gccttgctat cgaaaatgat acgggcgtta ttcgtagtat cagcgaagat gcatcccggc 13740
tttatcccgg tggtttgacc gttgttgatg ttgacagtat tccggcaggt tgtgacattt 13800
tcggcggatg ggtatttgac ggagagaaag tcattcctcg tgagtacaca ttggccgaac 13860
agcaacgcca gtcagatgaa aagaaaaaaa cacttcttgc tgaggcggag gcaacaattt 13920
ccacgcttga gcgtgcggta aggttaggca tggctaccgg ggaagaaata aggcgactcg 13980
aagcatggga gcgttacagc gtattggtga gcagggttaa gcagtcagat gactggccgc 14040
aaaaacctga ataacccggc ggcatttgcc cgcttctttc tcatccatta gttgtgccag 14100
acatcatcca gccctgacaa atagcccctc acaagaccag ccaggacaat aacactcgcc 14160
cactaactac ggagttaacc ggatgagtga ttttcaccac ggcacgaagg tcatcgaaat 14220
aaatgacggt acgcgtgtta tttccacggt cgcaaccgca atcgtcggca tggtctggac 14280
agccagcgat gcggatgccg agacatttcc cctcaacgag ccggtactga ttaccaatgt 14340
gcagagcgcc attgcgaaag ccggtaaaaa aggcactctg tcagcttccc tgcaggccat 14400
cgccgaccag tcaaagcctg tcaccgttgt cgtgcgcgtt gccgaaggta ccggagacga 14460
tgcagaagcg cagaccacgt ccaacattat cggcggcacg gatgagaacg gtaaatacac 14520
cggtatcaag gcgctgctaa ctgccgaagc ggtcaccggc gttaagccgc gcattctcgg 14580
tgtgccgggt ctcgatacgc aggaagtcgc aaccgcactt gcatcggtct gtatcagcct 14640
gcgtgcgttt ggttacgtca gcgcatgggg ctgtaagacc atttccgagg cgatggcata 14700
tcgcgagaat ttcagccagc gcgagctgat ggtcatctgg cctgatttcc tcgcatggga 14760
taccaccgcg aacgccaccg ccacggcata cgccaccgcc cgcgcactcg gtctgcgtgc 14820
ctacatcgac cagactatcg gctggcacaa aacgctgtct aacgttggcg tgcagggcgt 14880
taccggcatc agcgcctcag tcttttggga tttgcaggca tccggcacag atgctgacct 14940
gctcaacgag gccggagtca ccacgctggt gcgcaaggat ggtttccgtt tttgggggaa 15000
ccgcacatgc tctgatgacc cgcttttcct gtttgagaac tacacccgaa ccgcgcaggt 15060
gctggccgac acaatggctg aggcgcacat gtgggcggtc gataagccca tcaccgcatc 15120
gctcatccgt gacattgtcg acggcattaa cgccaaattc cgcgagctga aatcaaatgg 15180
ctacatcgtg gacggtgaat gctggttcga cgaggaatcg aacgataagg aaaccctcaa 15240
ggccgggaaa ctgtatatcg actacgacta tacaccggtt cccccactgg aaagcctgac 15300
cctgcgccag cgtatcaccg ataaatatct ggtgaatctg gctgaatcgg tcaacagcta 15360
aggagcctga aacaacatgg cactaccccg caaacttaaa tatctgaaca tgttcaatga 15420
cggccttagc tacatgggcg ttgttgaatc cgtgacgctg ccgaagctga cccgcaagct 15480
cgaaaactat cgcggcggcg gtatgaatgg cgctgcagcg attgacctcg gcctcgacga 15540
tgatgcgctt actgtcgaat ggtctgtcgg tggcctgcct gatgtggcgc tgtgggcgca 15600
gtatgccgcg ccgggggctg atgccgtgcc gctgcgtttt gctggctctt accagcgtga 15660
cgacactggc gaaatcgttg cggtcgaggt ggtcatgcgt ggccgtcata aagaaatcga 15720
cggcggcgaa aataagcagg gtgaaaatac ctcgaccaaa ctgtcgaccg tttgcaccta 15780
ttaccgcctc acgattgatg gtagcgacat tatcgaaatc gacaccgtca acatggtcga 15840
gaaggtgaac ggcgtcgacc gtctggaaca gcaccgccgc gcaatcgggc tgctgtaatt 15900
ccctgaccgg tcagcactgc tggccggtta ttacccccat tcagagcaga gaaaaaatca 15960
tggcaaaagc accacgcaaa acccctgaat ttattgatac ggctggcaat gaaattgaca 16020
ccgtaaaccc gaatgtcgtg accctcgaca agccgattaa acgcgccggt cagacaattg 16080
aaaaggtcac gctgattgaa ccgaacgcag gcaccctgcg cggcgtcagt ctggcggcgg 16140
tggcgcagtc cgaggtcgat gcgctgatta aggtgctgcc ccgcatgacc tacccggcac 16200
tcaccacgca ggagctcacc gcaatgaacc tgcccgatat gctgtcgctg gccgctaagg 16260
tgattggttt tttgtcaccg gcttcggcgg aatagacttc ccgcccggcc tgtcgaccga 16320
tgacctgatg gcggatatcg cagtgatatt ccactggccg ccatcagagc tctattccct 16380
gagcctgacc gagctcatca catggcgcga aaaggcgctg cagcgtagcg gaaaccacaa 16440
tgagtaataa cctgaggctt gaggtattgc tgaaagcggt cgaccaggcg acccgaccgc 16500
ttaaatccat ccagaccgcg agtaaaagcc tgtcgggcga tattcgcgac acacaaaaag 16560
ggctgcgtga cctgaatggt caggcgtcga aaatcgacgg ctttcgtaag gcaagcgcgc 16620
aactggccgt aaccagtcag gcgcttgata aggcgaaacg cgaggccggt gagctggccg 16680
tgcagtttaa aaacaccacc aatccgaccc gcgcgcaggc gcaggcactt gaagcggcaa 16740
ggcgtgccgc ctctgagttg cagacgaaat acaacagcct gagaacgtcg gtacagcgcc 16800
agcgctccga gctgatgcag gccggtatta atacccgcac tctctctgca gatgagcgtc 16860
ggctcaaaac ctccatcagc gaaacaactg cgcacgttaa tcgacaacgt gaggcactgg 16920
cgcgcgtcag tgcgcagcag gcgaaattaa gccgggtgaa agagcgatat aaatcaggca 16980
aggagcttgc cggtaacatg gccgcagcag gcgctgcggg gtcggtatcg cgacacggaa 17040
cgatggccgg ggttaaatta ctgatgcccg gttatgactt tacgcagaaa aattccgagc 17100
tgcaggctgt gctcggggtc gataagcagt cgccagaaat gcaggcgtta cgcaaacagg 17160
cgcgccacgt cggcgacaat actgcagcct ctgcagatga tgcagcaagc gcgcaaatca 17220
tcattgcgaa aagcggcggt gatgcagctg ccattcaggc gcgacgccga gtcacgctga 17280
atatggcgct gtcaaaccgg cgcacgatgg aggaaaacgc agcgctgctg accgggatga 17340
aatcagcgtt tcagctttca aacgacaaga ttgcgcacat tggcgacgtt ctctcgatga 17400
cgatgaacaa aaccgccgcc gattttgacg gactgagcga cgcgctgacc tatgccgcac 17460
cggtggcaaa aaatgccggg gtgagcatcg agcaaaccgc cgcaatggtc ggtgcactgc 17520
acgatgccaa aatcaccggg tcaatggcgg gcacgggtag ccgcgccatt ctcagccgcc 17580
tgcagctccc accggaaaaa gcgtttgagg ccattaagga gctcggcgtc aaaacgtcag 17640
acagcaaggg gaacacgcgc ccgatattct ccatcctgaa agaaatgcag cgcagctttg 17700
agaaaaacaa cctcgggaca agccagcgcg gcgagtatat gaaaaccatt ttcggcgagg 17760
aggccagctc ggcggcggcg gtactgatgg aagccgcctc aagcggcaaa cttgaccggc 17820
tcaccgctgc gtttaaagcc tcggacggta aaaccgagga actggttaag gttatgcagg 17880
ataacctcgg cggcgacttt aaagagttcc agtctgctta tgaggcagtc ggtactgacc 17940
tttttgacca gcaagagggc tcgctgcgta aactcaccca aaccgccacg caatacgtgt 18000
taaagctcga cggctggatc cagaagaaca aagggctggc gacaaccatt ggcatcatcg 18060
ccggtggcgc tctagctctg attggtatca tcggcggtat tggcctcgtt gcgtggccgg 18120
ttgttatggg gattaacgcc attatcgctg ctgctggcgt gctgggtacg gtctttactg 18180
ttaccggtag tgccattgtg accgcacttg gcgcgattac ctggccgatt gtcgcagtgg 18240
gggcggctat tgtggctggt gcgttactca tccgtaaata ttgggagccc atcagcgcat 18300
ttttctcggg ggtgattgag ggcatcatga gtgcctttgc accggtcgca gaaatgttcg 18360
ctccactggc acccattttt gacggtctcg gtgagaaact gcgcggcgtc tggcagtggt 18420
ttaaagacct gatagcaccg gtcaaagcca cgcaggaaac gctcgatagc tgcaaaaatg 18480
tcggcgtcat atttggtcag gcgctggcct ctgctttgat gcgtccgctc aatgtattta 18540
acaagttgcg cagcggtgtc gactggcttc tcgaaaagct cggtatcatc aacaaagagt 18600
cagacaacct cgaccagact gccgccaaaa ccaacgccgc cacgcagggt aattcctaca 18660
tcccggcaac cagcacatat ggcggctatc aagcttacca gccagttacc gcaccggcgg 18720
gacgctctta cattgaccag agtaaaagcg aatacaaaat cactctgccg ggaggtgctg 18780
cgccggggca tcagcttgac agacagctac gcgacacgct cgaacagatt gagcgcgaaa 18840
agcgtgcgcg tcagcgtgcc agtatgagcc atgactgaga ggaataaacg atgatgcttg 18900
cgcttggaat gtttgtgttt gaacgtcgca ccctgcctta tcagtcgatg cagcactcga 18960
aggattaccg ctgggcgtct aatgaccggg tgggtaagcc gcctgcttat cagtttctcg 19020
gcgaggggga aacgtcgata cagcttgccg gtacactgta cccagccatc accggcggct 19080
ggatctcact aaaggctgta gaggtaatgg ctaacgaggg cagagcgtgg ccgttgattg 19140
agggaactgg aaacatttta gggatgtata tcgtcgataa ggtgtcgacc acgcacgccg 19200
agtttttcag cgacggcgct gccagaaaga ttgatttcac cctttcgctt aaacgggtcg 19260
acgaatcact gacggcaatg tttggcgacc tgaataagca ggccagcgag cttctaggct 19320
ctgccggaaa tctgactgat aagctgcaga gtgcgctcgg aggactgacc gcatgattac 19380
gggcatgact attgacgccg gaactagcct tgcaccggca tttatgttaa cgctgaacag 19440
ccaggacatt accagcaatt ttagtgaccg gctgatttct ctcaccatga cagacaaccg 19500
gggctttgag gctgaccagc tcgacattga gctcgacgac accgacggca aagtcgaatt 19560
accactgcgc ggggcggtgc tgacgttgtg gcttggctgg cagggttcgg cgcttctgaa 19620
taagggcgat ttcacggtcg atgagattga gcaccggggc gcgcctgata tcctgaccat 19680
ccgcgcgcgt agtgcagact ttcgcggaac gctcaattca cggcgtgaag aatcatggca 19740
cgatactacc atcggtgagt tggtcagcac cattgcaaag cgcaataaac tgacggccag 19800
tgtcgcggat tcactgaaaa aaattccggt accgcatatc gaccagtcgc aggagtccga 19860
cgccgtattt ctgacccgac tggctgaccg caatggggcg acggtgtcag tgaaagcggg 19920
gaaactcctg tttctgaaag ccggtagtgc gatgacggcc agcggcaagc ccgtcccgca 19980
aatgacacta actcgcaacg atggtgaccg tcatcagttt gctattgccg accgtggggc 20040
ttacaccggc gtaaccgcaa aatggttgca caccaaagac ccgaagccgc aaaagcagaa 20100
agtaacactg aaacgcaagc caaaagagaa gcacctgcgc gcactggagc acccgaaagc 20160
aaagccagtc agcaaaaaga caaaggccaa aaaagagccg gaagcgcgcg agggtgagta 20220
tatggccggt gaggccgata acgtgctggc gctgacgacg gtctacgctt ctaaggcgca 20280
ggcgatgcgt gccgctcagg ctaagtggga taagctgcag cgaggcgttg cggagttttc 20340
aattacgctg gcgcttggta gggctgattt attccctgag acaccggtgc gcgtatcagg 20400
ctttaagcgc gtcatagatg agcaggcatg gttaatcagt aaggtaactc acaatctgaa 20460
taatagcggc ttcacgacgg gcttagagct tgaggttaaa ctctctgatg tggagtacaa 20520
cgcggaatcg gatgatgaat aaaatgtatt cacaaaaagt gaatttatga ttatcattta 20580
ttcacgaatt gagaataaag ggtgggttat gtttcattgt ccgaagtgcc atcatgccgc 20640
acatgcgcga acaagccgct atctaaccga aaacacgaaa gaacgctacc accagtgcca 20700
gaacatcaac tgtagttgta cgtttatgac aatggaaacg atagagcgct ttattgttac 20760
tccgggagcc attgacccgg caccgcctca cccgactgtc ggtggtcagc ggccattgtg 20820
gctctgataa atttccgcta aatgcccgcc gcgtgcgggt ttttttatgc actcaggaaa 20880
gtggcggtaa aaaatccacc gccattctat cgccactcga aaacgaggca acaaaaaggc 20940
cactcgagag agtggcctaa ctgtatgtat ttactactta aatttggtgg cccctgctgg 21000
acttgaacca gcgaccaagc gattatgagt tcctacaaga acaaccgaaa atcaatagta 21060
tgcgttattt atcattgaca tagattgcca ttgtttgcca ataattacct attattcgcc 21120
atttctaccg ccactttatc gccattctat tatctgttac tcagaaccat cgccgacata 21180
ggttccatca ggtgcgagat gatatcttcc accaacataa gtcccatctg gggcaagtgt 21240
tgggcggcca gcaacataac ttccatttgg cgctaagcgt ggaacgccac cgacataagt 21300
tccatcgggt gcaaggcgtg gtgctcctcc tccaacataa gtcccattag gggcaagcat 21360
aggttgtccg taaacatagg taccatcagg tgctaatcga actgacatac aacctccata 21420
acttatttgc tgttagtaat gtgaactaaa ggatttagtt taactgcatc ctctaaatgg 21480
tcgggtgcaa agtgcgcata tcgcatggtc atttttatat ctgtatggcc gagtacgcgc 21540
tgcaacacca aaatattacc gccattcatc ataaagtgac tagcgaaggt gtgacgtaaa 21600
acgtgggtaa gttgtcctgc cggtagttcg atacctgttc tttccaaagc tgaccggaac 21660
gcgccataac aatcactgaa caaccggccc tttttatcat caggcagaga ctcatagagc 21720
tctttgctga ttgggacggt gcgatttttt ctacctttcg tgttggtgta tgtgattttg 21780
tatttcgcga gttggctttt tctcagactc tcggcctcag accaccgtgc gccagttgcg 21840
agacagattc ttaccacggt ttctaaatca gggtggtcat gtcggttaca ctctccgagc 21900
agttgcgaaa tttggtcgtg agttagccaa gtcatttcca tttcttctgt gcggaatggg 21960
cgcatatttt ttagtgggtt ttcacccttc cattctccga ggcggtttag ctcattgaac 22020
accgcccgga agtaggccag ctcaagatta agcgtgcgag gcgatacctc tttcactctg 22080
tttgaacggg catactcacc ttttaaccgt ttttctcggt agcgggaaaa catctgcgca 22140
tcgaaatcgc gtgcgagtgg ttcgcccata cactcaaaag catggtgcat ggctaactgg 22200
cgtttcaaac catctttcag tgtaatgcca tgagcgctat accatgaatc aaccagctct 22260
tttaacgtgc gcctgtcttc cttttcttcc tgccacgggt tttgaacggt gtactgctca 22320
aacgccagag cctcgccttt agtagcgaat ttctttctga tacgtttgcc ttttgcaccg 22380
tttgggtaga gttcacaaat ccaaccgcca gccggatttt tacggacggt cattagttaa 22440
cctcgctgta tacacccacc acacgcccca acgttttaat atcatcaatg ccgcattcga 22500
aaggaacctt cccgcctgca acatgtagtt ttctacccgg tagttttgtt aactctcgaa 22560
tgcttattgc tccctcaatg tcgactagcc ataagccgtc agacaatgat gcttgcttgt 22620
ccacaaaata aattttcccc tcggaacgga tagccatccc atctgtgagc ggttttgtga 22680
aaaattgggc atcaacactc aattgtttat cggatttgag gatttcttca cttaatgtga 22740
atccctcaat cctttttgcg tcgctcgatt ctctgttatt tacaaatgct tctccttctc 22800
cggtaagtaa ccactggaga ttagcacctg tttcaagggc acagtgagcc gcaaagtcat 22860
aggagatagc gcctcgggtg tacctgtttg acaatgagct ggacgcgata tcgaagtggt 22920
tagctaattg aattttctgc gaaaatccgt acgcctcgca gatgcggtca agtacatcca 22980
cgttgctcca tcctaaagaa tctattctca tttcgataaa acctatttac tatctctcaa 23040
ttgggagata tattttggct aaacccacgc aattgatggc aagtgttggc aaacagagtc 23100
aaatcaattg caaactttgg ctaataggga atcatgcaat atggcttctg aaatcgcaat 23160
catcaaagtg cctgcaccta tcgttactct gcaacaattc gcagagcttg agggtgtttc 23220
tgaacgcacc gcctaccgct ggacaaccgg cgacaaccct tgtgtaccaa tcgaaccccg 23280
cacaatccgt aaaggctgca agaaagcagg tggcccgatt cgcatttatt acgcacgctg 23340
gaaagaagag cagttgcgta aggcgttggg acattcccgt tttcaactcg tcatcggtgc 23400
ttaattcact ttatgtgaat tgtaaggatg caacatgttt gattttcagg tttccaaaca 23460
tccccactat gacgaagcgt gccgggcttt tgcgcagcgt cacaacatgg cgaagctggc 23520
cgagcgtgcg ggtatgaatg ttcaaacgtt acgtaacaag ctcaacccag aacagcctca 23580
ccagttcacg ccgcctgaat tgtggctgct gactgacctg accgaagact caaccctcgt 23640
tgatggtttt ctggcgcaga ttcattgtct gccatgcgtg ccggttaatg agctggctaa 23700
agataaattg cagtcttacg tcatgcgcgc aatgagtgaa ctcggtgaac tggcgagcgg 23760
tgcggtatct gatgagcgtc tgaccactgc ccgtaagcac aacatgattg aaagcgttaa 23820
ctccggcatt cgcatgttgt cattgtcggc tctggcgctg catgcacgtc tgcagactaa 23880
tcccgctatg tcgagcgtgg tcgataccat gagcggtatt ggcgcatcgt ttggtctgat 23940
ttgaggtgcg tatgctgaaa agtgaaccgt catttgcgtc tctgctcgtt aagcaaagcc 24000
ccggtatgca ttacggccac ggctggatcg caggtaagga cggcaagcgc tggcacccgt 24060
gccgctcaca gtccgaatta ttaaaagggc tgaaaacaaa gtcgccgaaa tcgtcaggtt 24120
ttttaattat tcgtattgtc cactttgtaa ttaaaggagt gaaacatgtc acgcgatgaa 24180
ttaagaattg ttttgggtgc catgattcca aatatggagg aaggttttga aattaaaacc 24240
cgcgacggcg caatacttcg cgttgaccct gagtgggagt gctgcaaaga atttaaggat 24300
ggattaaaag ccgaaatcat caagcagtta aaaagcaaac ctgctgttgt atttggatat 24360
agttaattaa ttaaacgtaa ttacttggcg taaacccgcc gggcattctt ttgccaaaaa 24420
acaggaggat atatgagtcg aactatttat ttatcaacgc cgagtggtgc tggcgaccac 24480
ttgctggagt ctttgtttaa agaagccaaa aaagaagagc gcaaagaccg ccgtctcgcc 24540
gtttcaatcc gtctcgaaga tctggccgtt cacattacca attcagatat gacaggcaaa 24600
gaagcggccg agctactgcg ccgcgaagcc actcgctttg agaacgaatc acaggagctt 24660
cactaatggc cgacgcaatg gatttagcac aactgcgcga gcaggaagac cgcgaacgcc 24720
acataagcaa cgcgcgcagc cgtcgccatg aggtttctgc atttatctgt gaggaatgcg 24780
atgcacctat cccggaagcg cgccgccgag ccataccggg cgtgcagtgc tgcgttacct 24840
gtcaggaaat cttagagctg aaaagtaaac attataacgg aggtgcttta tgagcattac 24900
caatgcaact attagccagc gtgcaaaaaa atggcttgaa gatgaccgta tatttattga 24960
caccgaaact acgggtttgg gtgatgatgc ggaaatagta gaaatctgtt taatagatag 25020
cgctggtttt atcatgctaa atacattggt taaaccaact aaaccaattc cagcagaggc 25080
tacggccatt catggaataa ctgatgaaat ggttatgtat gcgccaacgt ggaaagatat 25140
tcacggcgca gtagcttctt tattttttga gtatggcttt gttatttata acgccgatta 25200
cgacacaaga cttatatatc aaactgcgaa attatatggg cttgagaatg acggcttttg 25260
ttatttttta aatgagcgtt cggcctgcgc catgatgcta tatgcagagt atcgcggcga 25320
gccagggcga tttaaaggtt ataaatggca caaattagtt gatgccgctg cacatgaagg 25380
ggttagcgtt gaaggaaagg cacaccgtgc attagcagat tgccggatga ctcttggcat 25440
tatcgacgct ttggcaaaag gcggtgcagc atgagtatcc gtatcgaaat aggtgataaa 25500
tgggtaatca ccagcgacca atatcaattc atcctgaatg aaaaaaaagt cgttaagacc 25560
ggcaataaag ctggcgagga atggctcgac accatcggtt attacccgaa gattaatcag 25620
ctcatttctg gtctggtaca tcaccacatt catacggcaa tgattatttc ccttagtgca 25680
atggcagagg aaatagagaa gttatctttt atctgtgaag aagcatttaa ggcggttaaa 25740
aaatgattga ttcccgctgc tttgctgaaa gcacaataaa tattgtttct gtttctggtg 25800
gaaaggacag ccttgctcaa tggattcttg cggtagagaa cgacgtaccg cgcaccactg 25860
tttttgcaga taccgggcat gagcattccc aaacaatgga gtatctggat tatcttgaat 25920
ccagactcgg cccggttatt cgagtgaaag ccgattttac tcggcggatt gaaggcaaac 25980
ggaaattcat tgctgaaaaa tggcctgtct ctctcgttga agaatgcgga atgtctcatg 26040
agcaggctgc agaacgaatc gcaaaggcac tggaaatcct taagccaacc ggtaatccgt 26100
ttctcgattt gtgcatgtgg aaaggacggt tcccgagcac gaaagcaagg ttttgttcac 26160
tggaactgaa acatgactca gtacgggaca agattgtact cccagcgctg gagaaatatg 26220
acgaagtaat tctatggcag ggtgttcgtg ctcaggagtc accagcccgc gctgcgttac 26280
ctatgtggga ggaggatgca gataataccc ccggtttgca tgtgtatcgc ccaattctta 26340
actggacaca tgaagacgta tttgccttag ctaaacgaca cggaattaaa ccgaacccac 26400
tctatcagca aggttgtagc agagttggct gcatgccatg tattcatgca agaaaatctg 26460
agctggcaga gatttttgct cgctggccgg aggagattgc gcgcgttgca gagtgggaac 26520
gtcttgttgc tgcctgttca cgtcggggaa actcaacatt tttcccttcg actcacgacc 26580
cgcggcgagc agaaaaacgt attgaagttg ttaccgtaga agaatatggg atagcttcat 26640
atcgtgactg ggcgatgact acgcgtggcg gttctcagta cgatttgctc gctgctacaa 26700
acgacaaaac tgtgtgcagt agcgtttatg ccggtgtatg tgaatgacgg gtgtcgttta 26760
cgcgtttccg tggaatgccc cacggtcggc aatagccagc tcatatctta cctatgacca 26820
acagcatcgc cgcgaccgta tgttcgcggc tttgctgcat gcgagaaagg tgctttttct 26880
ccagccagaa tgtgtgcgct ttgacgttta tcgcaccgct gcagttctgg agcaaaatca 26940
gggcagtcaa cgagccaatg cctttttaat cagcttctgc aaaaaggcat taccacgtct 27000
tgaactggtc gcaaaaaaat acgagtgctc gggcatcaac agcaatgtat cagccgctgt 27060
tttcgatggt cattttgata cccagcttat gcaatatctg gcgtcacgca tggtcaatat 27120
ggtcgccaga tttaaccgcc tcccggatat gtcgcgcgcc gatattgacc tgctggccgc 27180
ggatatcgct aattttattc gcgctgaact ggccgacatt gatgacaccg gatttagcga 27240
actcaaaacg ctgtacactt ggtacatgcg cgccggtttt atttccctgc aattcaacgt 27300
tacaccgccg aaatgggagc gtgtgactaa aaaatatttt tgtgaggatg aaatcgcacc 27360
ggcagtaatg cgcatgttta atgaggtttg gtggcgcggc cgcttgcgac gcattgcggc 27420
tgcatggcgc gaacatctgc aaattgcagt cggcaacgta agcaagaaac gacacgcata 27480
cgcgagtaaa aactgcgtca ccgactggcg cgagcagaag cgccgcacgc gcgaatttct 27540
caaggggctg gatctcgaag acgaagaagg caaccgcatc agtctgattg aaaaatacga 27600
cggctcggtc gctaatccag caatacgccg ctgtgagctg atggcccgca ttcgtgggtt 27660
tgaaaatatc tgtaatgagc tcggttatgt cggggagttc tatactctga ctgcaccgtc 27720
taaatatcac gccaccacca aagcgggcta ccgtaacagc aaatggaacg gtgcaagccc 27780
gtcagacacg cagagctatc tcacaggcct ttgggcacgc atacgcgcca agctgcaccg 27840
ggaagaaatc cgcattttcg gaatacgcgt cgctgaaccg catcacgatg gaacgccgca 27900
ctggcatatg cttatgttca tgttgccgga agatgtcgag cgtgtgcgac tcatcatccg 27960
agattatgcg tgggaggaag accactacga actgagaagc gataaagcca aaaaggcgcg 28020
cttccatgct gaggccattg acccggaaaa aggcagtgct actggctatg tcgctaaata 28080
catttccaaa aatatcgacg gttatgctct cgatggtgaa accgatgacg aaagtggtga 28140
gttgttaaaa gagactgcac ccgccgtttc agcatgggcg gcgcgctggc acatccgtca 28200
gtttcaattt atcggcggtg cgccggtgac ggtatacagg gagctacgca gaatggctga 28260
ccctgaaaca gccagggcgc tcagtgttga attcgccgca gtgcatgatg ctgctcacta 28320
tggacgctgg gctgattatg tgaatgctca aggcggacca ttcgttcgcc gtgacgattt 28380
acaggtacgt acattgtatg aacctcgaac tgaatttaat cagtatggcg aagaaactgt 28440
gtgcatcaaa ggtgtctacg atgcctcgat aggtgctggc tctcctattc taacccggtt 28500
aacgcagtgg aagattgttc caaagcgtgc cgttgatttg gccgttgacg ttaagggcgc 28560
ttctgcgccc tctcggagtt ctgtcaataa ctgtacggga agcgaaagcg atccaccgat 28620
actcgattta acaaaaccgc tgagtcggcg tgaaagacga gagttgacga accgactcag 28680
gaagaaaaag ccaacaacac ggcgaaaatt catccacgga acggataagc aaaacgtcgc 28740
tataacgaaa actatcgacg agatacactc tgacaaccgg catcacaatc agccggggcg 28800
aagccctgca cctgatggcc ggtggtaaaa gttgttttaa cggtcgatgg gtgcgcggaa 28860
cgtcaaaagg tgaaatcttt gctgcagctc cttcacatca ggcgagacgc ggaaaatcct 28920
taatcgtgtt gcagatttag ctgagctggc aacgaaaatg taaccgctaa tattcatcca 28980
tatcatgtac atacagtgta tttaactgtg atttttttct tcacaccttt tgccaatacg 29040
tgctactgta tgtttataca gtatctcgta gtggaggttg tgtggataga gagctaaatg 29100
agcacgttat gattgagcgg gtcgaaatga ttgcgcgtct gactgctgaa ggtacttgtc 29160
aggaaagaga ccgtgaaatc gcattgaatc taattgcgga aatagcaaga ggcaacctaa 29220
tgaaaaataa taatttttct gttgtttttt ccgcaccgcc tgttggtgaa acatttgcaa 29280
aggagggcaa agtgaaagta aatatcacgt tggataaaga ccaaaaaatc ggccagccgg 29340
taattgatgc ttttcagtgc gaattgacca agcgaataca gtccgttttc ccgtcaacgc 29400
gcgttactgt taaaaaggga tccatgaccg gtgtcgagct gatggggttc gataaagatt 29460
cagaccgcga agcgctggat agcatccttc aggaagtgtg ggaagatgag agctggcgtt 29520
aatccctgaa aaatgtgcaa ccatcgaccc catgtttgat agcatggggt tgttttgtat 29580
gggattacac acaaaggaaa atcatggata ccgtaatagc atttttatct ctggctctct 29640
ttattgcttt tatcgtcggg ttaatcaagc cgtcgctggt tcgaatgccg agccgtaagc 29700
gctccagtgc tgtttatctc ggtggctgtc tggcgctggg cgttattggc tcaatcttat 29760
ggccgactga aaaaactcag ccggtggcaa aaactgacgt accggcggtt aaagcggaac 29820
cggctacgcc aacgtttgag tacgcagata aaaccctcaa agaatatcgc aacgagccaa 29880
aagaaacccg gcacgaaatc gttaaagact atgttggatt caaaggtgtg caggccagcg 29940
ctaccgatgt tttttatgcc tgtatgagcg agtacacttt taccaaagat gatgcgttaa 30000
agctcagtga tgtgttgggg tggtgtttca acgacttcga gaaagatcca caatctctga 30060
ataataaaat caaccttgac gaatttcagg gtaattttag cggttgggat ggctcttatc 30120
gcccgttaga gaagctgata aaagccagta tgaatgatga ttcctcttat aaacatgttt 30180
caacggtcta ccatctgatt ttgaataaag acccgcatgc cgttgtaaaa acaacgtttc 30240
gcggcactaa tgcttatggt ggcgtggtca aacagaccgt agcagcacgc gtcaacgtgc 30300
gaacgggcga ggtcgattca atactcgaca attaaacatg acaaacgccg ccggtgctga 30360
aactcgcttt cagtgctggc ggggttgaac aacgagcccc gcgaggcgtt agcctacccc 30420
tgagcaaccg cccaagaccg gtactattaa agccggtttt tttatgccac ttttccacga 30480
atttcccgtt tttttagccg tgcatgcaac aggtgcattg ttttgcatgc gtcaggcttg 30540
cccgttctgg ttgtgcgtcg ccagagctgg cgcggctcca gagtggtcat gcaactgcat 30600
taaaaccgac ccataaagtg ggca 30624
//