Permalink
Find file
Fetching contributors…
Cannot retrieve contributors at this time
executable file 127 lines (126 sloc) 7.48 KB
>sp|P48449|ERG7_HUMAN Lanosterol synthase OS=Homo sapiens GN=LSS PE=1 SV=1
MTEG-TCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERA-GREQTGLEAYALGL
DTKNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIP
LPAGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARN
ILHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYL
PMSYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNVAPDELYTPHSWLLRVVYA
LLNLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYVDGPASTAF
QEHVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFL
RLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHI
PRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVM
QALKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFAC
MGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYLQSAQSQIHNTCWAMMG
LMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGR
---------FSQLYPERALAG--HP-------------
>UPI0000E25965 status=active
MRGGPGCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERA-GREQTGLEAYALGL
DTKNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIP
LPAGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARN
ILHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYL
PMSYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNVAPDELYTPHSWLLRVVYA
LLNLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYVDGPTSTAF
QEHVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFL
RLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHI
PRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVM
QALKCFHKHFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFAC
MGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQSAQSQIHNTCWAMMG
LMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGR
---------FSQLYTERALAG--HP-------------
>UPI0001CE251D status=active
MTEG-TSLRRRGGPYKTEPATDLSRWRLRSELGRQTWTYVGDTEAPERAQTALEAHSVGL
DTTSYFKDLPKAHTALEGALNGITFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHTARIP
LPAGYREEMVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARN
LLHQKGGAVAIPSWGKFWLAILNVYSWEGLNTLFPEMWLFPDWVPAHPSTLWCHCRQVYL
PMSYCYATRLSASEDPLIQSLRQELYVEDYASINWPAQRNNVAPDDLYTPHSWLLHVVYA
VLNLYESYHSTSLRQRAVRKLYAHIDADDRFTKGISIGPISKTINMLVRWFVDGPASPAF
QEHVSRIPDYLWLGLDGMKMQGTNGSQIWDTSFAIQAMLEAGAHHRPEFASCLQKAHEFL
RLSQIPDNPPDYQKYYRQMSKGGFCFSTLDCGWIVADCTAEALKSVLLLQETCPFVTEHV
PRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVM
QALRHFHAQFPDHRAQEIRETLQQGLEFCRQKQRPDGSWEGSWGVCFTYGTWFGLEAFAC
MGQRYQDGTACAEVSRACDFLLSRQMADGGWGEDFESCEQRRYVQSAQSQIHNTCWALMG
LMAVRHPDLEAQERGVRCLLDKQLPNGDWPQENISGVFNKSCAISYTSYRNVFPIWTLGR
---------FSRLYPERALAG--RP-------------
>tr|B0S5M5|B0S5M5_DANRE Novel protein similar to vertebrate lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) (LSS) OS=Danio rerio GN=lss PE=4 SV=1
MTEG-TCLRRRGGPYKTEPATDLSRWRLSNVDGRQSWRYIEETDSLDRPQSMLERHSLGL
DTSEFISASPAAHTAVEAALKGMDFYSRLQAEDGHWAGDYGGPLFLLPGLLITCHIAKIP
LPDAWKKEMVRYLRSVQLPDGGWGLHIEDKSTVFGTALSYTTLRILGVGPDDPDMVRARN
ALHNRGGAVGIPSWGKFWLAILNVYNWEGMNTLFPEMWLLPSWMPAHPSTLWCHCRQVYL
PMSYCYAVRLSADEDPLVLSLRQELYVQDYSTIDWPAQRNNVAACDLYTPHSNLLTFAYF
FLNVYEAHHSTILREKAVKELYDHIKADDRFTKCISIGPISKTINMLVRWYVDGPTSPAF
QKHVSRIPDYLWLGLDGMKMQGTNGSQLWDTAFAVQAFLEAGAQDIPRFTECLTQAHHFL
DLTQVKDNPPEYEKYYRQMNKGGFPFSTRDCGWIVADCVSEGLKSVMLLQEQCNFLKENI
PKERLFDAVNVLLSMRNPDGGFATYETKRGGKLLELLNPSEVFGDIMIDYTYVECTSAVL
QALKHFHSVYPEHRAEEIRSTLQRGLDYCRRVQRPDGSWEGSWGVCFTYGAWFGLEAFAC
MGHTFQNGSVCEEVKRACEFLLAKQMEDGGWGEDFESCEQRRYVQSSSSQIHNTCWALLG
LMAVRYPGTKVIERGIQLLIDKQLPNGDWPQENISGVFNKSCAISYTSYRNVFPVWTLGR
---------FTRLYPCNALTGKLKL-------------
>sp|P84466|ERG7_BOVIN Lanosterol synthase OS=Bos taurus GN=LSS PE=1 SV=2
MTEG-TCLRRRGGPYKTEPATDLSRWRLSNQVGRQTWTYSQEEDP-VREQSGLEAHLLGL
DTKSFFKDLPKAHTACRGALNGVTFYAALQTEDGHWAGDYGGPLFLLPGLLITCHVANIP
LPAGYREEIIRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARN
LLHKKGGAVFIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWMPAHPSTIWCHCRQVYL
PMAYCYSTRLSAEEGPLVQSLRQELYLEDYSCIDWAAHRNSVAPDDLYTPHSWLLHVVYA
ILNLYERHHSTSLRQWATQKLYEHIAADDRFTKCISIGPISKTINMLVRWHVDGPASAVF
QEHVSRIPDYLWLGLDGMKMQGTNGSQIWDTAFAIQALLEARAQHRPEFWSCLRKAHEYL
RISQVPDNFPDYQKYYRHMSKGGFSFSTLDCGWIVADCTAEALKSILLLQEKCPFVSNHV
PRERLFDTVAVLLSLRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVM
QALKTFHKQFPDHRAGEIRETLEQGLQFCRQKQRPDGSWEGSWGVCFTYGAWFGLEAFAC
MGHTYHNGVACAEISRACDFLLSRQMADGGWGEDFESCKQRRYVQSAQSQIHNTCWALMG
LMAVRHPDVAALERGVSYLLEKQLPNGDWPQENISGVFNKSCAISYTSYRNVFPIWTLGR
---------FSRLHPDPALAG--HP-------------
>sp|P48450|ERG7_RAT Lanosterol synthase OS=Rattus norvegicus GN=Lss PE=1 SV=2
MTEG-TCLRRRGGPYKTEPATDLTRWRLHNELGRQRWTYYQAEEDPGREQTGLEAHSLGL
DTTSYFKNLPKAQTAHEGALNGVTFYAKLQAEDGHWAGDYGGPLFLLPGLLITCHIAHIP
LPAGYREEMVRYLRSVQLPDGGWGLHIEDKSTVFGTALSYVSLRILGIGPDDPDLVRARN
ILHKKGGAVAIPSWGKFWLAVLNVYSWEGINTLFPEMWLLPEWFPAHPSTLWCHCRQVYL
PMSYCYATRLSASEDPLVQSLRQELYVEDYASIDWPAQKNNVCPDDMYTPHSWLLHVVYG
LLNLYERFHSTSLRKWAIQLLYEHVAADDRFTKCISIGPISKTVNMLIRWSVDGPSSPAF
QEHVSRIKDYLWLGLDGMKMQGTNGSQTWDTSFAVQALLEAGAHRRPEFLPCLQKAHEFL
RLSQVPDNNPDYQKYYRHMHKGGFPFSTLDCGWIVADCTAEALKAVLLLQERCPSITEHV
PRERLYDAVAVLLSMRNSDGGFATYETKRGGYLLELLNPSEVFGDIMIDYTYVECTSAVM
QALRHFREYFPDHRATESRETLNQGLDFCRKKQRADGSWEGSWGVCFTYGTWFGLEAFAC
MGHIYQNRTACAEVAQACHFLLSRQMADGGWGEDFESCEQRRYVQSAGSQVHSTCWALLG
LMAVRHPDISAQERGIRCLLGKQLPNGDWPQENISGVFNKSCAISYTNYRNIFPIWALGR
---------FSSLYPDNTLAG--HI-------------
>sp|Q8BLN5|ERG7_MOUSE Lanosterol synthase OS=Mus musculus GN=Lss PE=2 SV=2
MTEG-TCLRRRGGPYKTEPATDLTRWRLQNELGRQRWTYYQAEDDPGREQTGLEAHSLGL
DTRSYFTDLPKAQTAHEGALNGVTFYAKLQAEDGHWAGDYGGPLFLLPGLLITCHISHIS
LPAGYREEMVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVALRILGIGPDDPDLVRARN
VLHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPEWVPAHPSTLWCHCRQVYL
PMSYCYATRLSASEDPLVQSLRQELYVQDYASIDWPAQRNNVSPDEMYTPHSWLLHVVYG
LLNLYERFHSTSLRKWAVQMLYEHIAADDCFTKCISIGPISKTINMLVRWSVDGPSSPAF
QEHVSRIKDYLWLGLDGMKMQGTNGSQIWDTSFAIQALLEAGAHHRPEFLPCLQKAHEFL
RLSQVPENCPDYQKYYRHMRKGGFSFSTLDCGWIVADCTAEGLKAVLLLQNQCPSITEHI
PRERLCDAVDVLLSLRNADGGFATYEKKRGGYLLELLNPSEVFGDIMIDYTYVECTSAVM
QALKHFHEHFPDYRAAEVRETLNQGLDFCRRKQRADGSWEGSWGVCFTYGTWFGLEAFAC
MGHTYQDGAACAEVAQACNFLLSQQMADGGWGEDFESCEQRRYVQSARSQVHSTCWALMG
LMAVRHPDITAQERGIRCLLGKQLPNGDWPQENISGVFNKSCAISYTSYRNIFPIWALGR
---------FSNLYPDNTLAG--HI-------------
>tr|Q0IHW7|Q0IHW7_XENTR Lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) OS=Xenopus tropicalis GN=lss PE=2 SV=1
MS-GETCLRRRGGPYKTAPATDLTHWRLSCTEGRQTWCYVEEED---RKQTVLEAHSLGL
ETSDLLKDLPPPQTAYDGAYNGITFYSALQAEDGHWAGDYGGPLFLLPGLLIACHVTKTS
LPDATKKEMIRYLRSVQLPDGGWGLHIEDKSTVFGTALSYTSLRLLGVSQDDLDLTRARN
NLLSKGGAVGIPSWGKFWLAVLNVYSWEGMNTLFPEMWLLPHWFPAHPSTLWCHCRQVYL
PMSYCYATRLSAHEDDLIRSLRQELYLEDYSSINWPAQRNNVASCDIYTPHSTLLHIAYA
FLNVYESYHIPALRRRAVHELYDHIAADDRFTKCISIGPISKVINMLVRWHVDGSESSVF
REHVDRIPDYLWLGLDGMKMQGTNGSQLWDTAFAVQAYLEAGAHRRKEFQNCLEKAHEFL
RISQIPDNPPDYKKYYRQMNKGGFPFSTRDCGWIVADCTAEGLKSVMLLQEQCPFLTDLV
PPERLRDAVDVLLSMRNSDRGFATYETKRGGLLLELLNPSEVFGDIMIDYTYVECTSAVM
QALKHFQARDPNYRAQEIRETLQKGLDYCCSVQRQDGSWEGSWGVCFTYGIWFGLEAFAC
MGHTYKEG--CPEIIRACNFLLSHQMEDGGWGEDFESCEQRRYVQSAGSQIHNTCWALMG
LMAVGFPDVTVLERGVRLLLDKQLSNGDWPQENISGVFNKSCAISYTSYRNVFPIWTLGR
---------FFHLHPESSLAGLLKN-------------
>tr|F1NED1|F1NED1_CHICK Uncharacterized protein OS=Gallus gallus GN=LSS PE=4 SV=1
MR----------------------------------------------------------
------------------------FYATLQAEDGHWAGDYGGPLFLLPGLLIVCHTARIP
LPDGFRREMVRYLRSVQLPDGGWGLHVEDKSTVFGTALNYVALRILGLGPDDPDIVRARV
NLHSKGGAVGIPSWGKFWLAVLNVYSWEGMNTLLPEMWLLPTWFPAHPSRLWCHCRQVYL
PMSYCYAKRLSAEEDELIRSLQQELYVQDYASIDWPAQRNNVAACDVYTPHSWLLGIAYA
IMNVYEAHHSTYLRQRAITELYDHIKADDRFTKCISIGPISKTINMLVRWFVDGENSPAF
QEHVSRIPDYLWLGLDGMKMQGTNGSQLWDTAFAVQAFLEAEAQKIPEFMSCLQNAHEFL
RFTQIPENPPDYQKYYRHMNKGGFPFSTRDCGWIVADCTAEGLKSIMLLQEKCPFIANPV
PAERLFDAVNVLLSMKNSDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVM
QALRHFQDVYPEHRAPEIRETLQKGLDFCRKKQQADGSWEGSWGVCFTYGTWFGLEAFAS
MQHVYRDGVACREVARACQFLLSKQMTDGGWGEDFESCEQRTYVQSSTSQIHNTCWALLG
LMAVRYPDTGVLERGIKLLIDKQLPNGDWPQENVAGVFNKSCAISYTAYRNVFPIWTLGR
LGCIPTALLLSTCNPDPWL-GWGRPQRQHCLIEPMLWL