Skip to content
TODO: one-line summary of your gem
Branch: master
Clone or download
Fetching latest commit…
Cannot retrieve the latest commit at this time.
Type Name Latest commit message Commit time
Failed to load latest commit information.



A simple biogem that implements Bio::Sequence::AA#aliphatic index according to the formula presented in

J Biochem. 1980 Dec;88(6):1895-8. Thermostability and aliphatic index of globular proteins. Ikai A.

For example:'MVKSYDRYEYEDCLGIVNSKSSNCVFLNNA').aliphatic_index #=> 71.33333

Contributing to bio-aliphatic_index

  • Check out the latest master to make sure the feature hasn't been implemented or the bug hasn't been fixed yet

  • Check out the issue tracker to make sure someone already hasn't requested it and/or contributed it

  • Fork the project

  • Start a feature/bugfix branch

  • Commit and push until you are happy with your contribution

  • Make sure to add tests for it. This is important so I don't break it in a future version unintentionally.

  • Please try not to mess with the Rakefile, version, or history. If you want to have your own version, or is otherwise necessary, that is fine, but please isolate to its own commit so I can cherry-pick around it.


Copyright © 2012 Ben J Woodcroft. See LICENSE.txt for further details.

You can’t perform that action at this time.
You signed in with another tab or window. Reload to refresh your session. You signed out in another tab or window. Reload to refresh your session.