The AASequence
class handles amino acid sequences in OpenMS. A string of amino acid residues can be turned into a instance of AASequence
to provide some commonly used operations and data. The implementation supports mathematical operations like addition or subtraction. Also, average and mono isotopic weight and isotope distributions are accessible.
Weights, formulas and isotope distribution can be calculated depending on the charge state (additional proton count in case of positive ions) and ion type. Therefore, the class allows for a flexible handling of amino acid strings.
A very simple example of handling amino acid sequence with AASequence is given in the next few lines, which also calculates the weight of the (M)
and (M+2H)2+
ions.
from pyopenms import *
seq = AASequence.fromString("DFPIANGER")
prefix = seq.getPrefix(4)
suffix = seq.getSuffix(5)
concat = seq + seq
print(seq)
print(concat)
print(suffix)
mfull = seq.getMonoWeight() # weight of M
mprecursor = seq.getMonoWeight(Residue.ResidueType.Full, 2) # weight of M+2H
mz = seq.getMonoWeight(Residue.ResidueType.Full, 2) / 2.0 # m/z of M+2H
print()
print("Monoisotopic mass of peptide [M] is", mfull)
print("Monoisotopic mass of peptide precursor [M+2H]2+ is", mprecursor)
print("Monoisotopic m/z of [M+2H]2+ is", mz)
Which prints the amino acid sequence on line 7 as well as the result of concatenating two sequences or taking the suffix of a sequence (lines 8 and 9). On line 10 we compute the mass of the full peptide ([M]
), on line 11 we compute the mass of the peptide precursor ([M+2H]2+
) while on line 12 we compute the m/z
value of the peptide precursor ([M+2H]2+
). The mass of the peptide precursor is shifted by two protons that are now attached to the molecules as charge carriers (note that the proton mass of 1.007276 u is slightly different from the mass of an uncharged hydrogen atom at 1.007825 u).
DFPIANGER
DFPIANGERDFPIANGER
ANGER
Monoisotopic mass of peptide [M] is 1017.4879641373001
Monoisotopic mass of peptide precursor [M+2H]2+ is 1019.5025170708421
Monoisotopic m/z of [M+2H]2+ is 509.7512585354211
The AASequence
object also allows iterations directly in Python:
from pyopenms import *
seq = AASequence.fromString("DFPIANGER")
print("The peptide", str(seq), "consists of the following amino acids:")
for aa in seq:
print(aa.getName(), ":", aa.getMonoWeight())
Which will print
The peptide DFPIANGER consists of the following amino acids:
Aspartate : 133.0375092233
Phenylalanine : 165.0789793509
Proline : 115.0633292871
Isoleucine : 131.0946294147
Alanine : 89.04767922330001
Asparagine : 132.0534932552
Glycine : 75.0320291595
Glutamate : 147.05315928710002
Arginine : 174.1116764466
Note how we can easily calculate the charged weight of a (M+2H)2+
ion on line 11 and compute m/z on line 12 -- simply dividing by the charge. We can now combine our knowledge of AASequence
with what we learned above about EmpiricalFormula
to get accurate mass and isotope distributions from the amino acid sequence:
from pyopenms import *
seq = AASequence.fromString("DFPIANGER")
seq_formula = seq.getFormula()
print("Peptide", seq, "has molecular formula", seq_formula)
print("="*35)
isotopes = seq_formula.getIsotopeDistribution( CoarseIsotopePatternGenerator(6) )
for iso in isotopes.getContainer():
print ("Isotope", iso.getMZ(), "has abundance", iso.getIntensity()*100, "%")
suffix = seq.getSuffix(3) # y3 ion "GER"
print("="*35)
print("y3 ion sequence:", suffix)
y3_formula = suffix.getFormula(Residue.ResidueType.YIon, 2) # y3++ ion
suffix.getMonoWeight(Residue.ResidueType.YIon, 2) / 2.0 # CORRECT
suffix.getMonoWeight(Residue.ResidueType.XIon, 2) / 2.0 # CORRECT
suffix.getMonoWeight(Residue.ResidueType.BIon, 2) / 2.0 # INCORRECT
print("y3 mz:", suffix.getMonoWeight(Residue.ResidueType.YIon, 2) / 2.0 )
print("y3 molecular formula:", y3_formula)
Which will produce
Peptide DFPIANGER has molecular formula C44H67N13O15
===================================
Isotope 1017.4879641373 has abundance 56.81651830673218 %
Isotope 1018.4913189751 has abundance 30.52912950515747 %
Isotope 1019.4946738129 has abundance 9.802105277776718 %
Isotope 1020.4980286507 has abundance 2.3292064666748047 %
Isotope 1021.5013834885 has abundance 0.4492596257477999 %
Isotope 1022.5047383263 has abundance 0.07378293084912002 %
===================================
y3 ion sequence: GER
y3 mz: 181.09514385
y3 molecular formula: C13H24N6O6
Note on lines 15 to 17 we need to remember that we are dealing with an ion of the x/y/z series since we used a suffix of the original peptide and using any other ion type will produce a different mass-to-charge ratio (and while "GER" would also be a valid "x3" ion, note that it cannot be a valid ion from the a/b/c series and therefore the mass on line 17 cannot refer to the same input peptide "DFPIANGER" since its "b3" ion would be "DFP" and not "GER").
The AASequence
class can also handle modifications, modifications are specified using a unique string identifier present in the ModificationsDB
in round brackets after the modified amino acid or by providing the mass of the residue in square brackets. For example AASequence.fromString(".DFPIAM(Oxidation)GER.")
creates an instance of the peptide "DFPIAMGER" with an oxidized methionine. There are multiple ways to specify modifications, and AASequence.fromString("DFPIAM(UniMod:35)GER")
, AASequence.fromString("DFPIAM[+16]GER")
and AASequence.fromString("DFPIAM[147]GER")
are all equivalent).
from pyopenms import *
seq = AASequence.fromString("PEPTIDESEKUEM(Oxidation)CER")
print(seq.toUnmodifiedString())
print(seq.toString())
print(seq.toUniModString())
print(seq.toBracketString())
print(seq.toBracketString(False))
print(AASequence.fromString("DFPIAM(UniMod:35)GER"))
print(AASequence.fromString("DFPIAM[+16]GER"))
print(AASequence.fromString("DFPIAM[+15.99]GER"))
print(AASequence.fromString("DFPIAM[147]GER"))
print(AASequence.fromString("DFPIAM[147.035405]GER"))
The above code outputs:
PEPTIDESEKUEMCER
PEPTIDESEKUEM(Oxidation)CER
PEPTIDESEKUEM(UniMod:35)CER
PEPTIDESEKUEM[147]CER
PEPTIDESEKUEM[147.0354000171]CER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
Note there is a subtle difference between AASequence.fromString(".DFPIAM[+16]GER.")
and AASequence.fromString(".DFPIAM[+15.9949]GER.")
- while the former will try to find the first modification matching to a mass difference of 16 +/- 0.5, the latter will try to find the closest matching modification to the exact mass. The exact mass approach usually gives the intended results while the first approach may or may not. In all instances, it is better to use an exact description of the desired modification, such as UniMod, instead of mass differences.
N- and C-terminal modifications are represented by brackets to the right of the dots terminating the sequence. For example, ".(Dimethyl)DFPIAMGER."
and ".DFPIAMGER.(Label:18O(2))"
represent the labelling of the N- and C-terminus respectively, but ".DFPIAMGER(Phospho)."
will be interpreted as a phosphorylation of the last arginine at its side chain:
from pyopenms import *
s = AASequence.fromString(".(Dimethyl)DFPIAMGER.")
print(s, s.hasNTerminalModification())
s = AASequence.fromString(".DFPIAMGER.(Label:18O(2))")
print(s, s.hasCTerminalModification())
s = AASequence.fromString(".DFPIAMGER(Phospho).")
print(s, s.hasCTerminalModification())
Arbitrary/unknown amino acids (usually due to an unknown modification) can be specified using tags preceded by X: "X[weight]". This indicates a new amino acid ("X") with the specified weight, e.g. "RX[148.5]T"
. Note that this tag does not alter the amino acids to the left (R) or right (T). Rather, X represents an amino acid on its own. Be careful when converting such AASequence objects to an EmpiricalFormula using getFormula()
, as tags will not be considered in this case (there exists no formula for them). However, they have an influence on getMonoWeight()
and getAverageWeight()
!
Protein sequences can be accessed through the FASTAEntry
object and can be read and stored on disk using a FASTAFile
:
from pyopenms import *
bsa = FASTAEntry()
bsa.sequence = "MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE"
bsa.description = "BSA Bovine Albumin (partial sequence)"
bsa.identifier = "BSA"
alb = FASTAEntry()
alb.sequence = "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGE"
alb.description = "ALB Human Albumin (partial sequence)"
alb.identifier = "ALB"
entries = [bsa, alb]
f = FASTAFile()
f.store("example.fasta", entries)
Afterwards, the example.fasta
file can be read again from disk:
from pyopenms import *
entries = []
f = FASTAFile()
f.load("example.fasta", entries)
print( len(entries) )
for e in entries:
print (e.identifier, e.sequence)