You signed in with another tab or window. Reload to refresh your session.You signed out in another tab or window. Reload to refresh your session.You switched accounts on another tab or window. Reload to refresh your session.Dismiss alert
get the erro:
Warning: AbNumber not available. Provide --use_abnum to renumber with the AbNum server.
cannot import name 'clean_pdb' from 'igfold.utils.pdb' (/data/miniconda3/envs/igfold/lib/python3.9/site-packages/igfold/utils/pdb.py)
Completed folding in 0.90 seconds.
How to solve it?
The text was updated successfully, but these errors were encountered:
i use the sample :
from igfold import IgFoldRunner
sequences = {
"H": "QVQLQESGGGLVQAGGSLTLSCAVSGLTFSNYAMGWFRQAPGKEREFVAAITWDGGNTYYTDSVKGRFTISRDNAKNTVFLQMNSLKPEDTAVYYCAAKLLGSSRYELALAGYDYWGQGTQVTVS"
}
pred_pdb = "my_nanobody.pdb"
igfold = IgFoldRunner()
igfold.fold(
pred_pdb, # Output PDB file
sequences=sequences, # Nanobody sequence
do_refine=False, # Refine the antibody structure with PyRosetta
do_renum=True, # Renumber predicted antibody structure (Chothia)
)
get the erro:
Warning: AbNumber not available. Provide --use_abnum to renumber with the AbNum server.
cannot import name 'clean_pdb' from 'igfold.utils.pdb' (/data/miniconda3/envs/igfold/lib/python3.9/site-packages/igfold/utils/pdb.py)
Completed folding in 0.90 seconds.
How to solve it?
The text was updated successfully, but these errors were encountered: