#1. CreatePredictor_AAINDEX_based Protein encoding for mashine learning tasks & predictor's testing methods Archive CreatePredictor_AAINDEX_based.zip contain c++ program text, for creating predictors by protein sequence. Predictors based on aminoacid's phisical & chemical properties from databese AAINDEX*.
File TEST\CowardVariables.task is a simple example of tume file for creating predictor's set.
Аfter program execution, TEST\CowardVariables.task is created, which contains predictor values for sequence "RAPRARAKALRLLLKLLKLLSRYWVRVKRLLL" given with the testing procedure CowardVariables_test::first_test()
*. Kawashima S., Pokarowski P., Pokarowska M., Kolinski A., Katayama T., Kanehisa M. 2008. AAindex: amino acid index database, progress report 2008. Nucleic Acids Res. 36, D202-205.
#2. sda - Stepwise discriminant analysis A model of discrimination is built step-by-step. Specifically, at each step all variables are reviewed and evaluated to determine which one will contribute most to the discrimination between groups. Archeve sda.zip contain c++ program text, and test data files.
Files ex.dat ex.names are required for program testing
For detain read README.md from sda.zip
#3 The program performs protein chain assignment by Protein Block according to RMSD & RMSDA metrics. Input - standard PDB file. For detain read README.md from PB_RMSD_release