We read every piece of feedback, and take your input very seriously.
To see all available qualifiers, see our documentation.
Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.
By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.
Already on GitHub? Sign in to your account
Describe the bug
I am running a philosopher pipeline command. During the DB annotation step the following error is shown:
time="11:38:55" level=info msg="Executing Pipeline v4.1.1" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=warning msg="A meta data folder was found and will not be overwritten. " time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_002_S413457_RPA32-IP_Repl2_Group_1" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_003_S413453_IgG-IP_Repl2_Control" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_004_S413458_RPA32-IP_Repl3_Group_1" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_005_S413455_IgG-IP_Repl4_Control" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_007_S413459_RPA32-IP_Repl4_Group_1" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_008_S413456_RPA32-IP_Repl1_Group_1" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_009_S413454_IgG-IP_Repl3_Control" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Initiating the workspace on 20221101_C29563_010_S413452_IgG-IP_Repl1_Control" time="11:38:55" level=info msg="Creating workspace" time="11:38:55" level=info msg="Annotating the database" panic: runtime error: index out of range [2] with length 0 goroutine 1 [running]: philosopher/lib/dat.ProcessUniProtKB(0xc003661ec1, 0x37, 0xc00376f4d0, 0x86, 0xc000024f90, 0x4, 0x0, 0x0, 0x0, 0x0, ...) /home/prvst/workspace/philosopher/lib/dat/db.go:274 +0xc7f philosopher/lib/dat.(*Base).ProcessDB(0xc00020eb80, 0xc000230280, 0x43, 0xc000024f90, 0x4) /home/prvst/workspace/philosopher/lib/dat/dat.go:132 +0x82d philosopher/lib/dat.Run(0xc000027c80, 0x24, 0xc000230c30, 0x4d, 0xc000027cb0, 0x29, 0xc00002af00, 0x5c, 0xc00002af60, 0x53, ...) /home/prvst/workspace/philosopher/lib/dat/dat.go:64 +0xb34 philosopher/lib/pip.AnnotateDatabase(0xc000027b30, 0x24, 0xc000230b40, 0x4b, 0xc000027b60, 0x29, 0xc00002ade0, 0x5a, 0xc00002ae40, 0x51, ...) /home/prvst/workspace/philosopher/lib/pip/pip.go:140 +0x26c philosopher/cmd.glob..func13(0x894f1a0, 0xc0001d5f40, 0x8, 0xa) /home/prvst/workspace/philosopher/cmd/pipeline.go:72 +0x41c github.com/spf13/cobra.(*Command).execute(0x894f1a0, 0xc0001d5e00, 0xa, 0xa, 0x894f1a0, 0xc0001d5e00) /home/prvst/go/pkg/mod/github.com/spf13/cobra@v0.0.6/command.go:844 +0x2aa github.com/spf13/cobra.(*Command).ExecuteC(0x894fc20, 0x0, 0x0, 0x0) /home/prvst/go/pkg/mod/github.com/spf13/cobra@v0.0.6/command.go:945 +0x317 github.com/spf13/cobra.(*Command).Execute(...) "philosopher.2.txt" 43L, 3086C 1,1 Top
This error always appears as soon as I add the following sequence as a spike-in to the DB:
>sp|ADD001|iRT-Kit_WR_fusion iRT-Kit WR fusion GN=iRTKit LGGNEQVTRYILAGVENSKGTFIIDPGGVIRGTFIIDPAAVIRGAGSSEPVTGLDAKTPVISGGPYEYRVEATFGVDESNAKTPVITGAPYEYRDGLDAASYYAPVRADVTPADFSEWSKLFLQFGAQGSPFL
Please complete the following information:
Additional context
The fasta DB is written to disc and contains the respective spike-ins:
tobiasko@fgcz-c-073:/scratch/FRAGPIPE/WU282798$ grep iRT 2022-11-03-decoys-contam-UP000005640.fas >rev_sp|ADD001|iRT-Kit_WR_fusion iRT-Kit WR fusion GN=iRTKit >sp|ADD001|iRT-Kit_WR_fusion iRT-Kit WR fusion GN=iRTKit
I can suppress this behaviour by changing the FASTA header line to:
>sp|ADD001|iRT-Kit_WR_fusion iRT-Kit_WR_fusion LGGNEQVTRYILAGVENSKGTFIIDPGGVIRGTFIIDPAAVIRGAGSSEPVTGLDAKTPVISGGPYEYRVEATFGVDESNAKTPVITGAPYEYRDGLDAASYYAPVRADVTPADFSEWSKLFLQFGAQGSPFLK
The text was updated successfully, but these errors were encountered:
Your sequence was not exactly matching the UniProt standard, but I did some changes and now it should be good.
Fixed. Added to v5.0.0
Sorry, something went wrong.
prvst
No branches or pull requests
Describe the bug
I am running a philosopher pipeline command. During the DB annotation step the following error is shown:
This error always appears as soon as I add the following sequence as a spike-in to the DB:
Please complete the following information:
Additional context
The fasta DB is written to disc and contains the respective spike-ins:
I can suppress this behaviour by changing the FASTA header line to:
The text was updated successfully, but these errors were encountered: