You signed in with another tab or window. Reload to refresh your session.You signed out in another tab or window. Reload to refresh your session.You switched accounts on another tab or window. Reload to refresh your session.Dismiss alert
Select snake mode >> try to see sequence on the Canvas
Actual behavior
Scrollbar problem and wrong sequence layout on the Macro Canvas.
2024-05-23_00h30_06.mp4
Expected behavior
User should be able to use any scrollbars on the Canvas.
Sequence should be visible while Canvas is switched to Snake mode.
Versions:
Windows 11
Chrome Version Version 123.0.6312.106 (Official Build) (64-bit)
Ketcher Version 2.21.0-rc.1 Build at 2024-04-15; 20:00:15
Indigo Toolkit Version 1.20.0-rc.1.0-g8e8ffc3c3-wasm32-wasm-clang-12.0.0
The text was updated successfully, but these errors were encountered:
Steps to Reproduce
QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE
KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS
VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP
FLFLIKHNPTNTIVYFGRYWSP
Actual behavior
Scrollbar problem and wrong sequence layout on the Macro Canvas.
2024-05-23_00h30_06.mp4
Expected behavior
Versions:
Windows 11
Chrome Version Version 123.0.6312.106 (Official Build) (64-bit)
Ketcher Version 2.21.0-rc.1 Build at 2024-04-15; 20:00:15
Indigo Toolkit Version 1.20.0-rc.1.0-g8e8ffc3c3-wasm32-wasm-clang-12.0.0
The text was updated successfully, but these errors were encountered: