Use newer GFP model for test2.py and uncomment GitHub actions tests

gitter-lab · Apr 25, 2024 · a536cb2 · a536cb2
1 parent d90175d
commit a536cb2
Show file tree

Hide file tree

Showing 2 changed files with 6 additions and 6 deletions.
diff --git a/.github/workflows/test.yml b/.github/workflows/test.yml
@@ -35,10 +35,10 @@ jobs:
         pip list
     - name: Test METL-G
       run: python metl/test.py
-    #- name: Test 1D low-N METL-L avGFP
-    #  run: python metl/test2.py
-    #- name: Test 3D low-N METL-L avGFP
-    #  run: python metl/test3.py
+    - name: Test 1D low-N METL-L avGFP
+      run: python metl/test2.py
+    - name: Test 3D low-N METL-L avGFP
+      run: python metl/test3.py
     - name: Test MELT-L GB1
       run: |
         cd metl

diff --git a/metl/test2.py b/metl/test2.py
@@ -3,8 +3,8 @@
 
 
 def main():
-    # "bcEoygY3" is a METL-L (2M, 1D) [GFP] model that was fine-tuned on 80 examples from the avGFP DMS dataset
-    model, data_encoder = metl.get_from_uuid(uuid="bcEoygY3")
+    # "YoQkzoLD" is a METL-L (2M, 1D) [GFP] model that was fine-tuned on 64 examples from the avGFP DMS dataset
+    model, data_encoder = metl.get_from_uuid(uuid="YoQkzoLD")
 
     # the GFP wild-type sequence
     wt = "SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQ" \