Error: AbNumber not installed. Please install AbNumber to use renumbering

[suhailislam]

We have installed IgFold (RedHat 7) following the instructions on GitHub and Anaconda Python 3.9.13. Testing with below example from Git. abnumber is definitely installed (works: python -c 'import abnumber'). However running (python ig-test.py) below we get error "Error: AbNumber not installed. Please install AbNumber to use renumbering".

igtest.py

from igfold import IgFoldRunner
sequences = {
"H": "QVQLQESGGGLVQAGGSLTLSCAVSGLTFSNYAMGWFRQAPGKEREFVAAITWDGGNTYYTDSVKGRFTISRDNAKNTVFLQMNSLKPEDTAVYYCAAKLLGSSRYELALAGYDYWGQGTQVTVS"
}
pred_pdb = "my_nanobody.pdb"
igfold = IgFoldRunner()
igfold.fold(
pred_pdb, # Output PDB file
sequences=sequences, # Nanobody sequence
do_refine=False, # Refine the antibody structure with PyRosetta
do_renum=True, # Renumber predicted antibody structure (Chothia)
)

Thank you

[yshen25]

@suhailislam I hade the same issue and fixed it by upgrading numpy and pandas. The error message is misleading.
The line of code that caused error is
if do_renum: try: from igfold.utils.abnumber_ import renumber_pdb except: exit("AbNumber not installed. Please install AbNumber to use renumbering.")
The real issue is at the bottom of chain of imports:
from pandas.compat.numpy import is_numpy_dev as _is_numpy_dev
As the real error message indicates, the real issue is that the pandas version doesn't match the numpy version.