© 2020 Blockchain Commons
Authors: Wolf McNally, Christopher Allen
Date: June 8, 2020
Revised: November 8, 2021
Output descriptors [OD-IN-CORE] [OSD], also called output script descriptors, are a way of specifying Bitcoin payment outputs that can range from a simple address to multisig and segwit using a simple domain-specific language. For more on the motivation for output descriptors, see [WHY-OD].
This document specifies a native CBOR encoding for output descriptors, as well as a Uniform Resource [UR] type crypto-output
(CBOR tag #6.308) for transmitting such descriptors.
The following specification is written in Concise Data Definition Language [CDDL]. The semantics and allowable nesting syntax is as described in [OD-IN-CORE] except for the extension described below.
This specification introduces an extension to [OD-IN-CORE], adding a new descriptor function cosigner(KEY)
, which can be accepted by the sh
and wsh
script functions defined in [OD-IN-CORE]. The cosigner(KEY)
is not used to derive ScriptPubKeys directly, but is used as a placeholder to be used when transmitting a single public key representing an account to be used by a party in a multisig transaction. This document defines a corresponding CBOR tag #6.410 to be used when encoding the cosigner(KEY)
function.
key_exp = #6.306(crypto-eckey) / #6.303(crypto-hdkey)
script_exp = (
script-hash / ; sh
witness-script-hash / ; wsh
public-key / ; pk
public-key-hash / ; pkh
witness-public-key-hash / ; wpkh
combo / ; combo
multisig / ; multi
sorted-multisig / ; sortedmulti
address / ; addr
raw-script / ; raw
taproot / ; tr
cosigner ; cosigner
)
script-hash = #6.400(script_exp)
witness-script-hash = #6.401(script_exp)
public-key = #6.402(key_exp)
public-key-hash = #6.403(key_exp)
witness-public-key-hash = #6.404(key_exp)
combo = #6.405(key_exp)
multikey = {
threshold: uint,
keys: [1* key_exp]
}
multisig = #6.406(multikey)
sorted-multisig = #6.407(multikey)
address = #6.307(crypto-address)
raw-script = #6.408(script-bytes)
taproot = #6.409(script_exp)
cosigner = #6.410(key_exp)
threshold = 1
keys = 2
script-bytes = bytes
- Describes a P2PKH output with the specified public key.
pkh(02c6047f9441ed7d6d3045406e95c07cd85c778e4b8cef3ca7abac09b95c709ee5)
- In the CBOR diagnostic notation:
403( ; public-key-hash
306( ; crypto-eckey
{
3: h'02c6047f9441ed7d6d3045406e95c07cd85c778e4b8cef3ca7abac09b95c709ee5' ; data
}
)
)
- Encoded as binary using [CBOR-PLAYGROUND]:
D9 0193 # tag(403) public-key-hash
D9 0132 # tag(306) crypto-eckey
A1 # map(1)
03 # unsigned(3) data
58 21 # bytes(33)
02C6047F9441ED7D6D3045406E95C07CD85C778E4B8CEF3CA7ABAC09B95C709EE5
- As a hex string:
d90193d90132a103582102c6047f9441ed7d6d3045406e95c07cd85c778e4b8cef3ca7abac09b95c709ee5
- As a UR:
ur:crypto-output/taadmutaadeyoyaxhdclaoswaalbmwfpwekijndyfefzjtmdrtketphhktmngrlkwsfnospypsasrhhhjonnvwtsqzwljy
- Describes a P2SH-P2WPKH output with the specified public key.
sh(wpkh(03fff97bd5755eeea420453a14355235d382f6472f8568a18b2f057a1460297556))
- In the CBOR diagnostic notation:
400( ; script-hash
404( ; witness-public-key-hash
306( ; crypto-eckey
{
3: h'03fff97bd5755eeea420453a14355235d382f6472f8568a18b2f057a1460297556' ; data
}
)
)
)
- Encoded as binary using [CBOR-PLAYGROUND]:
D9 0190 # tag(400) script-hash
D9 0194 # tag(404) witness-public-key-hash
D9 0132 # tag(306) crypto-eckey
A1 # map(1)
03 # unsigned(3) data
58 21 # bytes(33)
03FFF97BD5755EEEA420453A14355235D382F6472F8568A18B2F057A1460297556
- As a hex string:
d90190d90194d90132a103582103fff97bd5755eeea420453a14355235d382f6472f8568a18b2f057a1460297556
- As a UR:
ur:crypto-output/taadmhtaadmwtaadeyoyaxhdclaxzmytkgtlkphywyoxcxfeftbbecgmectelfynfldllpisoyludlahknbbhndtkphfhlehmust
- Describes a P2SH 2-of-2 multisig output with keys in the specified order.
sh(multi(2,022f01e5e15cca351daff3843fb70f3c2f0a1bdd05e5af888a67784ef3e10a2a01,03acd484e2f0c7f65309ad178a9f559abde09796974c57e714c35f110dfc27ccbe))
- In the CBOR diagnostic notation:
400( ; script-hash
406({ ; multisig
1: 2, ; threshold
2: [ ; keys
306( ; crypto-eckey
{
3: h'022f01e5e15cca351daff3843fb70f3c2f0a1bdd05e5af888a67784ef3e10a2a01' ; data
}
),
306( ; crypto-eckey
{
3: h'03acd484e2f0c7f65309ad178a9f559abde09796974c57e714c35f110dfc27ccbe' ; data
}
)
]
})
)
- Encoded as binary using [CBOR-PLAYGROUND]:
D9 0190 # tag(400) script-hash
D9 0196 # tag(406) multisig
A2 # map(2) threshold
01 # unsigned(1)
02 # unsigned(2) keys
02 # unsigned(2)
82 # array(2)
D9 0132 # tag(306) crypto-eckey
A1 # map(1)
03 # unsigned(3) data
58 21 # bytes(33)
022F01E5E15CCA351DAFF3843FB70F3C2F0A1BDD05E5AF888A67784EF3E10A2A01
D9 0132 # tag(306) crypto-eckey
A1 # map(1)
03 # unsigned(3) data
58 21 # bytes(33)
03ACD484E2F0C7F65309AD178A9F559ABDE09796974C57E714C35F110DFC27CCBE
- As a hex string:
d90190d90196a201020282d90132a1035821022f01e5e15cca351daff3843fb70f3c2f0a1bdd05e5af888a67784ef3e10a2a01d90132a103582103acd484e2f0c7f65309ad178a9f559abde09796974c57e714c35f110dfc27ccbe
- As a UR:
ur:crypto-output/taadmhtaadmtoeadaoaolftaadeyoyaxhdclaodladvwvyhhsgeccapewflrfhrlbsfndlbkcwutahvwpeloleioksglwfvybkdradtaadeyoyaxhdclaxpstylrvowtstynguaspmchlenegonyryvtmsmtmsgshgvdbbsrhebybtztdisfrnpfadremh
- Describes a set of P2PKH outputs derived from this key by
/1/*
, but additionally specifies that the specified xpub is a child of a master with fingerprintd34db33f
, and derived using path44'/0'/0'
.
pkh([d34db33f/44'/0'/0']xpub6ERApfZwUNrhLCkDtcHTcxd75RbzS1ed54G1LkBUHQVHQKqhMkhgbmJbZRkrgZw4koxb5JaHWkY4ALHY2grBGRjaDMzQLcgJvLJuZZvRcEL/1/*)
Key:
04 ; version 4
88b21e ; `xpub`
04 ; depth 4
78412e3a ; parent fingerprint
fffffffe ; child number
637807030d55d01f9a0cb3a7839515d796bd07706386a6eddf06cc29a65a0e29 ; chain code
02d2b36900396c9282fa14628566582f206a5dd0bcc8d5e892611806cafb0301f0 ; key data
7e652001 ; base58 checksum
- In the CBOR diagnostic notation:
403( ; public-key-hash
303({ ; crypto-hdkey
3: h'02d2b36900396c9282fa14628566582f206a5dd0bcc8d5e892611806cafb0301f0', ; key-data
4: h'637807030d55d01f9a0cb3a7839515d796bd07706386a6eddf06cc29a65a0e29', ; chain-code
6: 304({ ; origin: crypto-keypath
1: [ ; components
44, true, 0, true, 0, true ; 44'/0'/0'
],
2: 3545084735, ; source-fingerprint
3: 4 ; depth
}),
7: 304({ ; children: crypto-keypath
1: [ ; components
1, false, [], false ; 1/*
]
}),
8: 2017537594 ; parent-fingerprint
})
)
- Encoded as binary using [CBOR-PLAYGROUND]:
D9 0193 # tag(403) public-key-hash
D9 012F # tag(303) crypto-hdkey
A5 # map(5)
03 # unsigned(3) key-data
58 21 # bytes(33)
02D2B36900396C9282FA14628566582F206A5DD0BCC8D5E892611806CAFB0301F0
04 # unsigned(4) chain-code
58 20 # bytes(32)
637807030D55D01F9A0CB3A7839515D796BD07706386A6EDDF06CC29A65A0E29
06 # unsigned(6) origin
D9 0130 # tag(304) crypto-keypath
A3 # map(3)
01 # unsigned(1) components
86 # array(6)
18 2C # unsigned(44) child-index
F5 # primitive(21) is-hardened true
00 # unsigned(0) child-index
F5 # primitive(21) is-hardened true
00 # unsigned(0) child-index
F5 # primitive(21) is-hardened true
02 # unsigned(2) source-fingerprint
1A D34DB33F # unsigned(3545084735)
03 # unsigned(3) depth
04 # unsigned(4)
07 # unsigned(7) children
D9 0130 # tag(304) crypto-keypath
A1 # map(1)
01 # unsigned(1) components
84 # array(4)
01 # unsigned(1) child-index
F4 # primitive(20) is-hardened false
80 # array(0) child-index-wildcard
F4 # primitive(20) is-hardened false
08 # unsigned(8) parent-fingerprint
1A 78412E3A # unsigned(2017537594)
- As a hex string:
D90193D9012FA503582102D2B36900396C9282FA14628566582F206A5DD0BCC8D5E892611806CAFB0301F0045820637807030D55D01F9A0CB3A7839515D796BD07706386A6EDDF06CC29A65A0E2906D90130A30186182CF500F500F5021AD34DB33F030407D90130A1018401F480F4081A78412E3A
- As a UR:
ur:crypto-output/taadmutaaddlonaxhdclaotdqdinaeesjzmolfzsbbidlpiyhddlcximhltirfsptlvsmohscsamsgzoaxadwtaahdcxiaksataxbtgotictnybnqdoslsmdbztsmtryatjoialnolweuramsfdtolhtbadtamtaaddyotadlncsdwykaeykaeykaocytegtqdfhaxaaattaaddyoyadlradwklawkaycyksfpdmftkiiozsfd
- Describes a set of 1-of-2 P2WSH multisig outputs where the first multisig key is the 1/0/
i
child of the first specified xpub and the second multisig key is the 0/0/i
child of the second specified xpub, andi
is any number in a configurable range.
wsh(multi(1,xpub661MyMwAqRbcFW31YEwpkMuc5THy2PSt5bDMsktWQcFF8syAmRUapSCGu8ED9W6oDMSgv6Zz8idoc4a6mr8BDzTJY47LJhkJ8UB7WEGuduB/1/0/*,xpub69H7F5d8KSRgmmdJg2KhpAK8SR3DjMwAdkxj3ZuxV27CprR9LgpeyGmXUbC6wb7ERfvrnKZjXoUmmDznezpbZb7ap6r1D3tgFxHmwMkQTPH/0/0/*))
key 1:
04 ; version 4
88b21e ; `xpub`
00 ; depth 0 == public key of a master key
00000000 ; parent fingerprint
00000000 ; child index
60499f801b896d83179a4374aeb7822aaeaceaa0db1f85ee3e904c4defbd9689 ; chain code
03cbcaa9c98c877a26977d00825c956a238e8dddfbd322cce4f74b0b5bd6ace4a7 ; key data
e233a252 ; base58 checksum
key 2:
04 ; version 4
88b21e ; `xpub`
01 ; depth 1
bd16bee5 ; parent fingerprint
00000000 ; child index
f0909affaa7ee7abe5dd4e100598d4dc53cd709d5a5c2cac40e7412f232f7c9c ; chain code
02fc9e5af0ac8d9b3cecfe2a888e2117ba3d089d8585886c9c826b6b22a98d12ea ; key data
44183bfc ; base58 checksum
- In the CBOR diagnostic notation:
401( ; witness-script-hash
406({ ; multisig
1: 1, ; threshold
2: [ ; keys
303({ ; crypto-hdkey
3: h'03cbcaa9c98c877a26977d00825c956a238e8dddfbd322cce4f74b0b5bd6ace4a7', ; key-data
4: h'60499f801b896d83179a4374aeb7822aaeaceaa0db1f85ee3e904c4defbd9689', ; chain-code
6: 304({ ; origin: crypto-keypath
1: [], ; components
3: 0 ; depth
}),
7: 304({ ; children: crypto-keypath
1: [ ; components
1, false, 0, false, [], false ; 1/0/*
]
})
}),
303({ ; crypto-hdkey
3: h'02fc9e5af0ac8d9b3cecfe2a888e2117ba3d089d8585886c9c826b6b22a98d12ea', ; key-data
4: h'f0909affaa7ee7abe5dd4e100598d4dc53cd709d5a5c2cac40e7412f232f7c9c', ; chain-code
6: 304({ ; origin: crypto-keypath
1: [ ; components
0, false
],
2: 3172384485 ; source-fingerprint
}),
7: 304({ ; children: crypto-keypath
1: [ ; components
0, false, 0, false, [], false ; 0/0/*
]
})
})
]
})
)
- Encoded as binary using [CBOR-PLAYGROUND]:
D9 0191 # tag(401) witness-script-hash
D9 0196 # tag(406) multisig
A2 # map(2)
01 # unsigned(1) threshold
01 # unsigned(1)
02 # unsigned(2) keys
82 # array(2)
D9 012F # tag(303) crypto-hdkey
A4 # map(4)
03 # unsigned(3) key-data
58 21 # bytes(33)
03CBCAA9C98C877A26977D00825C956A238E8DDDFBD322CCE4F74B0B5BD6ACE4A7
04 # unsigned(4) chain-code
58 20 # bytes(32)
60499F801B896D83179A4374AEB7822AAEACEAA0DB1F85EE3E904C4DEFBD9689
06 # unsigned(6) origin
D9 0130 # tag(304) crypto-keypath
A2 # map(2)
01 # unsigned(1)
80 # array(0)
03 # unsigned(3) depth
00 # unsigned(0)
07 # unsigned(7) children
D9 0130 # tag(304) crypto-keypath
A1 # map(1)
01 # unsigned(1) components
86 # array(6)
01 # unsigned(1) child-index
F4 # primitive(20) is-hardened: false
00 # unsigned(0) child-index
F4 # primitive(20) is-hardened: false
80 # array(0) child-index-wildcard
F4 # primitive(20) is-hardened: false
D9 012F # tag(303) crypto-hdkey
A4 # map(4)
03 # unsigned(3) key-data
58 21 # bytes(33)
02FC9E5AF0AC8D9B3CECFE2A888E2117BA3D089D8585886C9C826B6B22A98D12EA
04 # unsigned(4) chain-code
58 20 # bytes(32)
F0909AFFAA7EE7ABE5DD4E100598D4DC53CD709D5A5C2CAC40E7412F232F7C9C
06 # unsigned(6) origin
D9 0130 # tag(304) crypto-keypath
A2 # map(2)
01 # unsigned(1) components
82 # array(2)
00 # unsigned(0) child-index
F4 # primitive(20) is-hardened: false
02 # unsigned(2) source-fingerprint
1A BD16BEE5 # unsigned(3172384485)
07 # unsigned(7) children
D9 0130 # tag(304) crypto-keypath
A1 # map(1)
01 # unsigned(1) components
86 # array(6)
00 # unsigned(0) child-index
F4 # primitive(20) is-hardened: false
00 # unsigned(0) child-index
F4 # primitive(20) is-hardened: false
80 # array(0) child-index
F4 # primitive(20) is-hardened: false
- As a hex string:
d90191d90196a201010282d9012fa403582103cbcaa9c98c877a26977d00825c956a238e8dddfbd322cce4f74b0b5bd6ace4a704582060499f801b896d83179a4374aeb7822aaeaceaa0db1f85ee3e904c4defbd968906d90130a20180030007d90130a1018601f400f480f4d9012fa403582102fc9e5af0ac8d9b3cecfe2a888e2117ba3d089d8585886c9c826b6b22a98d12ea045820f0909affaa7ee7abe5dd4e100598d4dc53cd709d5a5c2cac40e7412f232f7c9c06d90130a2018200f4021abd16bee507d90130a1018600f400f480f4
- As a UR:
ur:crypto-output/taadmetaadmtoeadadaolftaaddloxaxhdclaxsbsgptsolkltkndsmskiaelfhhmdimcnmnlgutzotecpsfveylgrbdhptbpsveosaahdcxhnganelacwldjnlschnyfxjyplrllfdrplpswdnbuyctlpwyfmmhgsgtwsrymtldamtaaddyoeadlaaxaeattaaddyoyadlnadwkaewklawktaaddloxaxhdclaoztnnhtwtpslgndfnwpzedrlomnclchrdfsayntlplplojznslfjejecpptlgbgwdaahdcxwtmhnyzmpkkbvdpyvwutglbeahmktyuogusnjonththhdwpsfzvdfpdlcndlkensamtaaddyoeadlfaewkaocyrycmrnvwattaaddyoyadlnaewkaewklawktdbsfttn
- [WHY-OD] StackOverflow answer by Peter Wuille explaining motivation for Output Descriptors
- [OD-IN-Core] GitHub: Support for Output Descriptors in Bitcoin Core
- [OSD] Bitcoin Optech: Output Script Descriptors
- [CDDL] RFC8610: Concise Data Definition Language (CDDL): A Notational Convention to Express Concise Binary Object Representation (CBOR) and JSON Data Structures
- [UR] Uniform Resources (UR)