Fix a div-by-zero error

ndaniels · Jul 5, 2012 · 2b75dc3 · 2b75dc3
1 parent c687e7a
commit 2b75dc3
Show file tree

Hide file tree

Showing 2 changed files with 6 additions and 1 deletion.
diff --git a/SearchStrategy.hs b/SearchStrategy.hs
@@ -25,7 +25,7 @@ import Debug.Trace (trace)
 -- | @isTick N t k@ is a clock that ticks @t@ times as 
 -- @k@ ranges over the interval [1..N].  It's used for
 -- emitting diagnostic output at regular intervals of a search
-isTick denom numIntervals num =
+isTick denom numIntervals num = denom > 0 &&
   num * numIntervals `div` denom > (num - 1) * numIntervals `div` denom
 
 tickProp (Positive n') (Positive t) =

diff --git a/testing/sandwich.fasta b/testing/sandwich.fasta
@@ -0,0 +1,5 @@
+> d2sbaa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]}
+AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIW
+DKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQV
+VAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLV
+YPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPHA