Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
- Loading branch information
Showing
85 changed files
with
3,367 additions
and
752 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,42 @@ | ||
|
||
/* | ||
* Copyright 2015 OpenCB | ||
* | ||
* Licensed under the Apache License, Version 2.0 (the "License"); | ||
* you may not use this file except in compliance with the License. | ||
* You may obtain a copy of the License at | ||
* | ||
* http://www.apache.org/licenses/LICENSE-2.0 | ||
* | ||
* Unless required by applicable law or agreed to in writing, software | ||
* distributed under the License is distributed on an "AS IS" BASIS, | ||
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. | ||
* See the License for the specific language governing permissions and | ||
* limitations under the License. | ||
*/ | ||
|
||
db.getCollection('clinical_variants').createIndex({'id': 1}) | ||
db.getCollection('clinical_variants').createIndex({'type': 1}) | ||
db.getCollection('clinical_variants').createIndex({'chromosome': 1, 'start': 1, 'end': 1}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.traitAssociation.source.name': 1}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.consequenceTypes.sequenceOntologyTerms.name': 1}) | ||
db.getCollection('clinical_variants').createIndex({'_featureXrefs': 1}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.traitAssociation.id': 1}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.id': 1}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.hgvs': 1}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.traitAssociation.consistencyStatus': 1}, {sparse: true}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.traitAssociation.variantClassification.clinicalSignificance': 1}, {sparse: true}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.traitAssociation.heritableTraits.inheritanceMode': 1}, {sparse: true}) | ||
db.getCollection('clinical_variants').createIndex({'annotation.traitAssociation.alleleOrigin': 1}, {sparse: true}) | ||
db.getCollection('clinical_variants').createIndex({'_traits': 1}) | ||
|
||
//db.getCollection('clinical_variants').createIndex({'annotation.traitAssociation.heritableTraits.trait':'text', | ||
// 'annotation.traitAssociation.somaticInformation.primarySite': 'text', | ||
// 'annotation.traitAssociation.somaticInformation.siteSubtype': 'text', | ||
// 'annotation.traitAssociation.somaticInformation.primaryHistology': 'text', | ||
// 'annotation.traitAssociation.somaticInformation.histologySubtype': 'text', | ||
// 'annotation.traitAssociation.somaticInformation.sampleSource': 'text', | ||
// 'annotation.traitAssociation.somaticInformation.tumourOrigin': 'text'}, {name: "_diseasePhenotype"}) | ||
|
||
|
||
|
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
157 changes: 157 additions & 0 deletions
157
cellbase-app/src/test/java/org/opencb/cellbase/app/builders/GeneParserTest.java
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,157 @@ | ||
/* | ||
* Copyright 2015-2020 OpenCB | ||
* | ||
* Licensed under the Apache License, Version 2.0 (the "License"); | ||
* you may not use this file except in compliance with the License. | ||
* You may obtain a copy of the License at | ||
* | ||
* http://www.apache.org/licenses/LICENSE-2.0 | ||
* | ||
* Unless required by applicable law or agreed to in writing, software | ||
* distributed under the License is distributed on an "AS IS" BASIS, | ||
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. | ||
* See the License for the specific language governing permissions and | ||
* limitations under the License. | ||
*/ | ||
|
||
package org.opencb.cellbase.app.builders; | ||
|
||
import com.fasterxml.jackson.annotation.JsonInclude; | ||
import com.fasterxml.jackson.databind.MapperFeature; | ||
import com.fasterxml.jackson.databind.ObjectMapper; | ||
import org.junit.Before; | ||
import org.junit.Test; | ||
import org.opencb.biodata.models.core.Exon; | ||
import org.opencb.biodata.models.core.Gene; | ||
import org.opencb.biodata.models.core.Transcript; | ||
import org.opencb.cellbase.core.config.SpeciesConfiguration; | ||
import org.opencb.cellbase.core.serializer.CellBaseJsonFileSerializer; | ||
import org.opencb.cellbase.core.serializer.CellBaseSerializer; | ||
import org.opencb.cellbase.lib.builders.GeneParser; | ||
import org.opencb.commons.utils.FileUtils; | ||
|
||
import java.io.BufferedReader; | ||
import java.io.IOException; | ||
import java.net.URISyntaxException; | ||
import java.nio.file.Path; | ||
import java.nio.file.Paths; | ||
import java.util.ArrayList; | ||
import java.util.List; | ||
|
||
import static org.junit.Assert.*; | ||
|
||
|
||
public class GeneParserTest { | ||
private GeneParser geneParser; | ||
private ObjectMapper jsonObjectMapper; | ||
public GeneParserTest() throws URISyntaxException { | ||
init(); | ||
} | ||
|
||
@Before | ||
public void init() throws URISyntaxException { | ||
Path genomeSequenceFastaFile | ||
= Paths.get(getClass().getResource("/gene/Homo_sapiens.GRCh38.fa.gz").toURI()); | ||
Path geneDirectoryPath = Paths.get(getClass().getResource("/gene").toURI()); | ||
// put the results in /tmp | ||
CellBaseSerializer serializer = new CellBaseJsonFileSerializer(Paths.get("/tmp/"), "gene", | ||
true); | ||
SpeciesConfiguration species = new SpeciesConfiguration("hsapiens", "Homo sapiens", | ||
"human", null, null, null); | ||
geneParser = new GeneParser(geneDirectoryPath, genomeSequenceFastaFile, species, serializer); | ||
jsonObjectMapper = new ObjectMapper(); | ||
jsonObjectMapper.configure(MapperFeature.REQUIRE_SETTERS_FOR_GETTERS, true); | ||
jsonObjectMapper.setSerializationInclusion(JsonInclude.Include.NON_NULL); | ||
} | ||
|
||
/** | ||
* Checks a case in which the stop codon is the first 3 nts of an exon. ENSE00003800362 is in the negative strand. | ||
* genomicCodingEnd, cdnaCodingStart and cdsStart must be set "manually" within the parser as there's no CDS line | ||
* in the GTF since the stop codon itself is not part of the coding sequence (but historically considered part of | ||
* the coding region in CellBase) | ||
*/ | ||
@Test | ||
public void testEdgeExonCodingStart() throws Exception { | ||
geneParser.parse(); | ||
List<Gene> genes = loadSerializedGenes("/tmp/gene.json.gz"); | ||
Exon exon = getExon("ENSE00003800362", genes); | ||
assertNotNull(exon); | ||
assertEquals(28477630, exon.getGenomicCodingEnd()); | ||
assertEquals(1302, exon.getCdnaCodingStart()); | ||
assertEquals(1198, exon.getCdsStart()); | ||
} | ||
|
||
private Exon getExon(String exonId, List<Gene> genes) { | ||
for (Gene gene : genes) { | ||
for (Transcript transcript : gene.getTranscripts()) { | ||
for (Exon exon : transcript.getExons()) { | ||
if (exonId.equals(exon.getId())) { | ||
return exon; | ||
} | ||
} | ||
} | ||
} | ||
|
||
return null; | ||
} | ||
|
||
@Test | ||
public void testTranscriptSequence() throws Exception { | ||
geneParser.parse(); | ||
final String TRANSCRIPT_SEQUENCE = "GTTAACTTGCCGTCAGCCTTTTCTTTGACCTCTTCTTTCTGTTCATGTGTATTTGCTGTCTCTTAGCCCAGACTTCCCGTGTCCTTTCCACCGGGCCTTTGAGAGGTCACAGGGTCTTGATGCTGTGGTCTTCATCTGCAGGTGTCTGACTTCCAGCAACTGCTGGCCTGTGCCAGGGTGCAAGCTGAGCACTGGAGTGGAGTTTTCCTGTGGAGAGGAGCCATGCCTAGAGTGGGATGGGCCATTGTTCATCTTCTGGCCCCTGTTGTCTGCATGTAACTTAATACCACAACCAGGCATAGGGGAAAGATTGGAGGAAAGATGAGTGAGAGCATCAACTTCTCTCACAACCTAGGCCAGTGTGTGGTGATGCCAGGCATGCCCTTCCCCAGCATCAGGTCTCCAGAGCTGCAGAAGACGACGGCCGACTTGGATCACACTCTTGTGAGTGTCCCCAGTGTTGCAGAGGCAGGGCCATCAGGCACCAAAGGGATTCTGCCAGCATAGTGCTCCTGGACCAGTGATACACCCGGCACCCTGTCCTGGACACGCTGTTGGCCTGGATCTGAGCCCTGGTGGAGGTCAAAGCCACCTTTGGTTCTGCCATTGCTGCTGTGTGGAAGTTCACTCCTGCCTTTTCCTTTCCCTAGAGCCTCCACCACCCCGAGATCACATTTCTCACTGCCTTTTGTCTGCCCAGTTTCACCAGAAGTAGGCCTCTTCCTGACAGGCAGCTGCACCACTGCCTGGCGCTGTGCCCTTCCTTTGCTCTGCCCGCTGGAGACGGTGTTTGTCATGGGCCTGGTCTGCAGGGATCCTGCTACAAAGGTGAAACCCAGGAGAGTGTGGAGTCCAGAGTGTTGCCAGGACCCAGGCACAGGCATTAGTGCCCGTTGGAGAAAACAGGGGAATCCCGAAGAAATGGTGGGTCCTGGCCATCCGTGAGATCTTCCCAGGGCAGCTCCCCTCTGTGGAATCCAATCTGTCTTCCATCCTGCGTGGCCGAGGGCCAGGCTTCTCACTGGGCCTCTGCAGGAGGCTGCCATTTGTCCTGCCCACCTTCTTAGAAGCGAGACGGAGCAGACCCATCTGCTACTGCCCTTTCTATAATAACTAAAGTTAGCTGCCCTGGACTATTCACCCCCTAGTCTCAATTTAAGAAGATCCCCATGGCCACAGGGCCCCTGCCTGGGGGCTTGTCACCTCCCCCACCTTCTTCCTGAGTCATTCCTGCAGCCTTGCTCCCTAACCTGCCCCACAGCCTTGCCTGGATTTCTATCTCCCTGGCTTGGTGCCAGTTCCTCCAAGTCGATGGCACCTCCCTCCCTCTCAACCACTTGAGCAAACTCCAAGACATCTTCTACCCCAACACCAGCAATTGTGCCAAGGGCCATTAGGCTCTCAGCATGACTATTTTTAGAGACCCCGTGTCTGTCACTGAAACCTTTTTTGTGGGAGACTATTCCTCCCATCTGCAACAGCTGCCCCTGCTGACTGCCCTTCTCTCCTCCCTCTCATCCCAGAGAAACAGGTCAGCTGGGAGCTTCTGCCCCCACTGCCTAGGGACCAACAGGGGCAGGAGGCAGTCACTGACCCCGAGACGTTTGCATCCTGCACAGCTAGAGATCCTTTATTAAAAGCACACTGTTGGTTTCTG"; | ||
List<Gene> genes = loadSerializedGenes("/tmp/gene.json.gz"); | ||
Transcript transcript = getTranscript("ENST00000456328", genes); | ||
assertNotNull(transcript); | ||
assertEquals(TRANSCRIPT_SEQUENCE, transcript.getcDnaSequence()); | ||
} | ||
|
||
private Transcript getTranscript(String transcriptId, List<Gene> geneList) { | ||
for (Gene gene : geneList) { | ||
for (Transcript transcript : gene.getTranscripts()) { | ||
if (transcript.getId().equals(transcriptId)) { | ||
return transcript; | ||
} | ||
} | ||
} | ||
|
||
return null; | ||
} | ||
|
||
@Test | ||
public void testProteinSequence() throws Exception { | ||
geneParser.parse(); | ||
final String PROTEIN_SEQUENCE = "MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAVTWGIGFLHSVSQLAFAVHLLFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVVLLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAHSSVKF"; | ||
List<Gene> genes = loadSerializedGenes("/tmp/gene.json.gz"); | ||
assertEquals(15, genes.size()); | ||
for (Gene gene : genes) { | ||
if (gene.getId().equals("ENSG00000223972")) { | ||
for (Transcript transcript : gene.getTranscripts()) { | ||
if (transcript.getId().equals("ENST00000456328")) { | ||
assertEquals(PROTEIN_SEQUENCE, transcript.getProteinSequence()); | ||
} | ||
} | ||
} | ||
} | ||
} | ||
|
||
private List<Gene> loadSerializedGenes(String fileName) { | ||
List<Gene> geneList = new ArrayList(); | ||
|
||
try { | ||
BufferedReader bufferedReader = FileUtils.newBufferedReader(Paths.get(fileName)); | ||
String line; | ||
while ((line = bufferedReader.readLine()) != null) { | ||
if (line.startsWith("#") || line.trim().isEmpty()) { | ||
continue; | ||
} | ||
geneList.add(jsonObjectMapper.readValue(line, Gene.class)); | ||
} | ||
} catch (IOException e) { | ||
e.printStackTrace(); | ||
assertFalse(false); | ||
} | ||
|
||
return geneList; | ||
} | ||
|
||
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Binary file removed
BIN
-12.1 KB
cellbase-app/src/test/resources/clinicalVariant/ClinVarFullRelease_2018-10.xml.gz
Binary file not shown.
Binary file not shown.
Binary file not shown.
Binary file not shown.
Binary file not shown.
Binary file renamed
BIN
+13.5 KB
...Variant/ClinVarFullRelease_2019-06.xml.gz → ...Variant/ClinVarFullRelease_2020-02.xml.gz
Binary file not shown.
Binary file modified
BIN
+201 Bytes
(110%)
cellbase-app/src/test/resources/variant/annotation/clinicalVariant/variant_summary.txt.gz
Binary file not shown.
Binary file modified
BIN
+12 Bytes
(100%)
cellbase-app/src/test/resources/variant/annotation/clinicalVariant/variation_allele.txt.gz
Binary file not shown.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Binary file added
BIN
+7.32 KB
...rces/variant/annotation/commandExecutor/proteinChangeMatch/clinical_variants.full.json.gz
Binary file not shown.
Binary file added
BIN
+10.3 KB
...app/src/test/resources/variant/annotation/commandExecutor/proteinChangeMatch/gene.json.gz
Binary file not shown.
Binary file added
BIN
+22.2 KB
...ant/annotation/commandExecutor/proteinChangeMatch/proband.duprem.atomic.left.split.vcf.gz
Binary file not shown.
Oops, something went wrong.