Biotech AI Platform for Drug Discovery
CroweLM is an integrated AI platform combining NVIDIA BioNeMo NIMs with local LLMs for comprehensive drug discovery workflows. Built for researchers, scientists, and biotech professionals.
- Drug Target Analysis - Automated UniProt, ChEMBL, and PubMed data integration
- Protein Structure Prediction - ESMFold via NVIDIA NIMs
- Molecule Generation - MolMIM for de novo drug design
- AI-Powered Research - Specialized biotech and research agents
- MLX Training - LoRA fine-tuning on Apple Silicon
# Install all components
pip install crowelm
# Or install specific packages
pip install crowelm-agents # Biotech & research agents
pip install crowelm-nims # NVIDIA NIMs integration
pip install crowelm-pipelines # Drug discovery workflows
pip install crowelm-training # MLX fine-tuning (Apple Silicon)import asyncio
from crowelm.agents import BiotechAgent
async def main():
async with BiotechAgent() as agent:
# Analyze a drug target
results = await agent.analyze_target("P15056") # BRAF kinase
print(results["analysis"])
asyncio.run(main())import asyncio
from crowelm.pipelines import DrugDiscoveryPipeline
async def main():
async with DrugDiscoveryPipeline() as pipeline:
results = await pipeline.run_full_pipeline(
target_id="P15056",
generate_ligands=True,
num_ligands=10
)
print(results["report"])
asyncio.run(main())import asyncio
from crowelm.nims import NVIDIANIMs
async def main():
async with NVIDIANIMs() as nims:
# Predict protein structure
structure = await nims.predict_structure_esmfold("MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFL")
# Generate novel molecules
molecules = await nims.generate_molecules(num_molecules=10, property_name="QED")
# Ask scientific questions
answer = await nims.science_chat("What is protein folding?")
asyncio.run(main())# Run biotech agent interactively
python -m crowelm.agents.biotech -i
# Analyze a drug target
python -m crowelm.agents.biotech --target P15056
# Run research agent
python -m crowelm.agents.research --topic "CRISPR drug discovery"
# Test NVIDIA NIMs
python -m crowelm.nims.nvidia --test
# Run drug discovery pipeline
python -m crowelm.pipelines.drug_discovery --target P15056# Pull the agent runtime
docker pull crowelogic/crowelm-agents:latest
# Run interactively
docker run -it --rm \
-e NVIDIA_API_KEY=$NVIDIA_API_KEY \
crowelogic/crowelm-agents:latest
# Run a specific analysis
docker run --rm \
-e NVIDIA_API_KEY=$NVIDIA_API_KEY \
crowelogic/crowelm-agents:latest \
python -m crowelm.agents.biotech --target P15056# Install globally
npm install -g @crowe-logic/crowelm-cli
# Check system status
crowelm status
# Run agents
crowelm agent research --topic "drug discovery"
crowelm nvidia pipeline P15056| Variable | Description | Required |
|---|---|---|
NVIDIA_API_KEY |
NVIDIA API key for NIMs | For NVIDIA features |
CROWELM_MODEL_URL |
Local model endpoint | No (default: localhost:12434) |
CROWELM_MODEL_NAME |
Model to use | No (default: crowelogic/crowelogic:v1.0) |
| Package | Description |
|---|---|
crowelm |
Meta-package installing all components |
crowelm-core |
Shared configuration and utilities |
crowelm-agents |
Biotech and research AI agents |
crowelm-nims |
NVIDIA BioNeMo NIMs integration |
crowelm-pipelines |
Drug discovery workflow pipelines |
crowelm-training |
MLX LoRA fine-tuning for Apple Silicon |
- Python 3.10+
- NVIDIA API key (for NIMs features)
- Docker (optional, for containerized deployment)
- Apple Silicon Mac (for MLX training)
MIT License - see LICENSE for details.
Michael Crowe - Crowe Logic
CroweLM - Accelerating Drug Discovery with AI