Like Punycode (it's namesake and inspiration), funycode maps an input string in an extended alphabet to an output string in a more limited alphabet. The output alphabet used by funycode consists of all 7-bit ASCII characters that are valid for ANSI/ISO C symbol names:
0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz_
A funycode-encoded string consist of a prefix and a suffix, separated by an underscore (_), one of which must always be present. The prefix contains all direct-mapped characters in the input string (all characters in the alphabet except underscore), the suffix a sequence of variable-length encoded step counts for the decoder's state machine (see Punycode description for an explanation as to how this works).
| Original | Encoded | Remarks |
|---|---|---|
foo |
foo |
Prefix only. |
føø |
f_670 |
Prefix and suffix. |
𝓯𝓸𝓸 |
cxr0I00_ |
Suffix only. |
The position of the separator and the encoding of the suffix are both chosen in a way as to always result in a valid non-reserved C identifier; specifically, the output will never start with an underscore or a digit.
Symbol names for modern programming languages typically contain a lot of redundancy: not only as the names of parameter types, but also in the form of deeply-nested namespaces. When encoding these symbol names their length tends to be come unwieldy. Therefore, a simple compression algorithm is a mandatory part of funycode.
Consider a symbol such as the following 261-character one (from OpenBSD 7.1's /usr/lib/libc++.a):
std::__1::__fs::filesystem::__last_write_time(std::__1::__fs::filesystem::path const&, std::__1::chrono::time_point<std::__1::__fs::filesystem::_FilesystemClock, std::__1::chrono::duration<__int128, std::__1::ratio<1ll, 1000000000ll> > >, std::__1::error_code*)
Without compression, this would translate to the following 278-character long funycode string:
std1fsfilesystemlastwritetimestd1fsfilesystempathconststd1chronotimepointstd1fsfilesystemFilesystemClockstd1chronodurationint128std1ratio1ll1000000000llstd1errorcode_n05oOCC00xw3M7pAf5vAp0PDFxsI01020A0H01020A0G01060C01020A0K01060J010T010xSc1Lvg11rrx1030G045A030Y0FB030GM0K0D0c08
With compression however the result is this large but manageable 176-character string:
std1fsfilesystemlastwritetimepathconstchronopointFClockdurationint1281ll10llerrorcode_X05Y40sjb4l6z2z7Zrr7030h0BzEF6rH11vwT0J5Q6G0Qqrwrzx0Wt1nuGEr4WrFln1ouLQp29SmzE8LSty1Mu5Ph6
Typically, for longer strings compression results in output that is 80-90% of the input; without compression that would be around 110%.
The compression algorithm used is based on LZRW1-A. Internally, matches are encoded as symbols in the 0xd800-0xdfff range, with a 4-bit length and 7-bit distance.
| Original | Encoded |
|---|---|
foo |
foo |
foo_bar |
foobar_H7 |
supercalifragilisticexpialidocious |
supercalifragilisticexpialidocious |
bücher |
bcher_eL |
hörbücher |
hrbcher_5S0u0 |
_ |
C1_ |
| (space) | A0_ |
自転車 |
qeE4K2A1_ |
велосипед |
FH420EHL9G_ |
wikipedia::article::wikilink::wikilink(std::string const&) |
wikipediaarticlelinkstdstringconst_T0zGw0s0sw007080sywurJ3t1 |
<mycrate::Foo<u32> as mycrate::Bar<u64>>::foo |
mycrateFoou32asBaru64foo_D02qs10G0ZCAy0B0sqzxxE |