Skip to content
Neural Bacteriocin Identifier - a recurrent neural network based software to predict bacteriocins from protein sequences.
Python
Branch: master
Clone or download
Cannot retrieve the latest commit at this time.
Cannot retrieve the latest commit at this time.
Permalink
Type Name Latest commit message Commit time
Failed to load latest commit information.
README.md Update README.md Mar 28, 2019
final_NN_model.h5
my_wordvec_model_trembl_size_200
neubi.py Update neubi.py Nov 12, 2018
primary_bacteriocin_training_set
requirements_linux.txt modified linux requirements Aug 8, 2019
requirements_mac.txt Create requirements_mac.txt Mar 28, 2019

README.md

NeuBI

Neural Bacteriocin Identifier (NeuBI) is a recurrent neural network based software to predict bacteriocins from protein sequences. Unlike traditional alignment based approaches such as BLAST or HMMER used by BAGEL or BACTIBASE, this is an alignment free approach towards finding novel bacteriocins. We show that performance of NeuBI is better than the alignment based approaches. You can learn more from our paper:

Md-Nafiz Hamid, Iddo Friedberg; Identifying Antimicrobial Peptides using Word Embedding with Deep Recurrent Neural Networks, Bioinformatics, bty937, https://doi.org/10.1093/bioinformatics/bty937

Installation

Installation of NeuBI is pretty straight forward. You only need python 3.6. The software has only been tested for python 3.6 on a linux machine.

First, download this repository. Then run the following commands

$ cd NeuBI

We will use virtualenv to make sure the software is installed in its own sandbox, and the installation of the softwares needed to run NeuBI do not affect the computer's default computing environment. Run

$ virtualenv bacteriocin_software

If you get an error that means virtualenv is not installed. So, do a pip installation of virtualenv.

$ pip install virtualenv

Activate the newly created virtual environment.

$ source bacteriocin_software/bin/activate

Now, based on your OS, install the necessary softwares to run NeuBI with

$ pip install -r requirements_linux.txt

For MacOS, you will need to run the previous command with requirements_mac.txt.

Now, you can get NeuBI to run against any fasta file with the following commmand

$ python neubi.py my_fav_fasta.fa

The program will output a new file that has the same name + 'results'. This file will contain all the sequences from your original fasta file that have lengths of <=302, and will assign a probability that the sequence is a bacteriocin. For example, a result file will have something like this

>EFGCFBOH_00014 Accessory gene regulator A|249|0.010913903
MNIFVLEDDFLHQTRIEKIIYKILTDNKLEVNHLEVYGKPNQLLEDISERGRHQLFFLDIDIKGEDKKGMEIAVEIRNRDPHAVIVFVTTHSEFMPVSFQYQVSALDFIDKELPEELF
SHRIEKAITYVQDNQGKTLAEDSFVFINVKSQIQVPFSDLLYIETSLIPHKLILYSTKQRVEFYGQLSEIVEQDDRLFQCHRSFVVNPYNISSIDRSERLVYLKGGLSCIVSRLKIRSLIKVV
EELHTKEK
>EFGCFBOH_00016 hypothetical protein|41|0.09664696
MNNKKTKNNFSTLSESELLKVIGGDIFKLVIDHISMKARKK
>EFGCFBOH_00019 hypothetical protein|74|0.9983411
MNTTKKQFEVIDDIKLSLMGGGSKISVGEVGQALAVCTLAGATIGSVFPIAGTLGGAVLGAQYCTGAWAIIRAH

Here, the number at the end of the description line is the assigned probability of a sequence being a bacteriocin. We suggest using a threshold of >=0.95 to decide if it is a bacteriocin or not. But depending on your task, you may want the threshold to be flexible.

When your work is done, you can deactivate the virtual environment with the following command

deactivate

If you see an error from Theano when running NeuBI, you might need to change the backend of Keras to Tensorflow. Theano is no longer supported as a deep learning library, so we are using Tensorflow. You can change this by

$ cd ~/.keras
$ vim keras.json

You will see this inside the file

{                                                                                                                                                                         
"image_dim_ordering": "th",                                                                                                                                           
"epsilon": 1e-07,                                                                                                                                                     
"floatx": "float32",                                                                                                                                                  
"backend": "theano"                                                                                                                                               
}    

Change the backend to tensorflow.

If you face any problem installing the software, you can contact me through email: nafizh at iastate dot edu

You can’t perform that action at this time.