Is there an option to add padding to the sequence used to generate the esm3 embeddings. I'm currently using this script:
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, SamplingConfig
from esm.utils.constants.models import ESM3_OPEN_SMALL
from time import time
client = ESM3.from_pretrained(ESM3_OPEN_SMALL, device="cpu")
protein = ESMProtein(
sequence=(
"FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG"
"NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAP"
"ILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN"
)
)
protein_tensor = client.encode(protein)
print(protein_tensor)
output = client.forward_and_sample(
protein_tensor, SamplingConfig(return_per_residue_embeddings=True)
)
Is there an option to add padding to the sequence used to generate the esm3 embeddings. I'm currently using this script: