Skip to content
 
 

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

11 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation



GitHub GitHub release

GALACTICA is a general-purpose scientific language model. It is trained on a large corpus of scientific text and data. It can perform scientific NLP tasks at a high level, as well as tasks such as citation prediction, mathematical reasoning, molecular property prediction and protein annotation. A demo is available at galactica.org.

Install

From pip:

pip install galai

From repository:

pip install git+https://github.com/paperswithcode/galai

Models

There are five GALACTICA models available which we detail below:

Size Parameters
mini 125 M
base 1.3 B
standard 6.7 B
large 30 B
huge 120 B

Quickstart

import galai as gal

model = gal.load_model("standard")
model.generate("Scaled dot product attention:\n\n\\[")
# Scaled dot product attention:\n\n\\[ \\displaystyle\\text{Attention}(Q,K,V)=\\text{softmax}(\\frac{QK^{T}}{\\sqrt{d_{k}}}%\n)V \\]

Capabilities

We demonstrate some examples using the standard (6.7B) model below.

📚 Predict Citations:

model.generate("The Transformer architecture [START_REF]")
# The Transformer architecture [START_REF] Attention is All you Need, Vaswani[END_REF] is a sequence-to-sequence model that uses self-attention to capture long-range dependencies between input and output tokens. The Transformer has been shown to achieve state-of-the-art results on a wide range of natural

🔢 Predict LaTeX:

model.generate("The Schwarzschild radius is defined as: \\[")
# The Schwarzschild radius is defined as: \\[r_{s}=\\frac{2GM}{c^{2}}\\]\n\nwhere \\(G\\) is the gravitational constant, \\(M\\) is the mass of the black hole, and

🤔 Reasoning:

model.generate("A force of 0.6N is applied to an object, which accelerates at 3m/s. What is its mass? <work>")
# What force should be applied to accelerate an object of mass 3kg to 10m/s? <work>\nWe can use Newton's second law: F = ma. We can substitute variables to get:\n\n\\[ F = \\left(66kg

📄 Generate Documents:

model.generate("Lecture 1: The Ising Model\n\n", new_doc=True, top_p=0.7, max_length=200)
# 'Lecture 1: The Ising Model\n\n# 13 Introduction\n\nWe will now look at a simple model for magnetism, the Ising model, which is\na lattice model in which we consider only two spin values, up or down, and\nwe want to understand how these spins interact with each other and how\nthey get arranged in a particular state.\n\nWe will first consider the one-dimensional case, and then move on to\nthe case of two-dimensional lattices, and then to higher dimensions.\n\n# 14 The One-Dimensional Ising Model\n\n# 14.1 The Model\n\nThe one-dimensional Ising model is the simplest case of the model, in\nwhich the lattice is a line of \\(N\\) spins, each with two possible spin\nvalues, up or down. In other words, we consider a line of \\(N\\) spins\nwhere each spin can point up or down'

⚛️ Generate Molecules:

model.generate("[START_I_SMILES]", top_p=0.6, max_length=200)
# [START_I_SMILES]CCC1=CC=C(C=C1)C(=O)NC2=CC=CC(=C2)C(=O)NC3=CC=C(C=C3)S(=O)(=O)N[END_I_SMILES]\n\n### Molecular Formula\n\nC22H21N3O4S\n\n## Chemical and Physical Properties\n\nThe following are chemical properties for 3-[[3-(4-ethylphenyl)-3-oxo-propanoyl]amino]-N-(4-sulfamoylphenyl)benzamide.\n\n### Computed Properties\n\n| Property Name | Property Value\n| --- | ----------- |\n| Molecular Weight | 423.5\n| XLogP3-AA Log P | 3.2\n| Hydrogen Bond Donor Count | 3\n| Hydrogen Bond Acceptor Count 

🧑‍🔬 Predict Protein Annotations:

model.generate("[START_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END_AMINO] ## Keywords", max_length=200)
# '[START_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END_AMINO] ## Keywords\n\nCytoplasm, Methyltransferase, rRNA processing, S-adenosyl-L-methionine, Transferase\n\n## References\n\nQuestion: What are some articles for Ribosomal RNA small subunit methyltransferase H?\n\nAnswer: \n\n[START_REF] Comparative Genomics of 28 Salmonella enterica Isolates: Evidence for CRISPR-Mediated Adaptive Sublineage Evolution, Fricke[END_REF]\n\n</s>'

Citation

@inproceedings{GALACTICA,
    title={GALACTICA: A Large Language Model for Science},
    author={Ross Taylor and Marcin Kardas and Guillem Cucurull and Thomas Scialom and Anthony Hartshorn and Elvis Saravia and Andrew Poulton and Viktor Kerkez and Robert Stojnic},
    year={2022}
}

About

Model API for GALACTICA

Resources

Stars

Watchers

Forks

Releases

Packages

Contributors

Languages