-
Notifications
You must be signed in to change notification settings - Fork 2
FASTA sequences
PAMPA processes amino-acid sequences. For that, it uses the standard FASTA format with UniprotKB-like header.
For each sequence, the first line starts with a greater-than character (>) followed by some sequence identifier (SeqID), which is provided for informational purposes and can be customized by the user. Additionally, this line must contain three mandatory fields:
OS : scientific name of the organism
OX : taxonomic identifier of the organism
GN : gene name
Other fields are ignored, which means that Uniprot sequences are recognized. The other lines of the file are the sequence representation, with one letter per amino acid.
>P02453 OS=Bos taurus OX=9913 GN=COL1A1
MFSFVDLRLLLLLAATALLTHGQEEGQEEGQEEDIPPVTCVQNGLRYHDRDVWKPVPCQI
CVCDNGNVLCDDVICDELKDCPNAKVPTDECCPVCPEGQESPTDQETTGVEGPKGDTGPR
GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGISVPGPM
GPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRP
GERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQM
Each file can contain as many sequences as needed. PAMPA can also process multiple FASTA files from a specified directory.
The main purpose of the taxonomic identifier is to create a link between the taxon and the taxonomy. So, if you use the NCBI taxonomy, you should also use NCBI TaxID in the FASTA heading. These TaxIDs can be found here : https://www.ncbi.nlm.nih.gov/taxonomy. Sequences downloaded from Uniprot come with the NCBI TaxID.
If the sequences does not have any standard TaxID, you can define your own TaxID.